Query         psy11498
Match_columns 143
No_of_seqs    128 out of 1260
Neff          8.2 
Searched_HMMs 46136
Date          Fri Aug 16 19:55:13 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy11498.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/11498hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF01607 CBM_14:  Chitin bindin  99.4 7.7E-14 1.7E-18   81.6   2.0   48   95-142     6-53  (53)
  2 PF01607 CBM_14:  Chitin bindin  99.3 7.9E-13 1.7E-17   77.2   3.5   48   15-63      1-49  (53)
  3 smart00494 ChtBD2 Chitin-bindi  99.2 2.1E-11 4.6E-16   71.6   5.0   50   14-64      2-52  (56)
  4 smart00494 ChtBD2 Chitin-bindi  99.2 2.1E-11 4.5E-16   71.7   4.4   46   95-140     8-53  (56)
  5 PF03427 CBM_19:  Carbohydrate   91.5    0.21 4.5E-06   30.0   2.5   20  106-125    36-55  (61)
  6 PF03427 CBM_19:  Carbohydrate   87.3    0.69 1.5E-05   27.7   2.5   22   30-51     35-56  (61)
  7 PF08475 Baculo_VP91_N:  Viral   60.8     9.3  0.0002   28.0   2.7   38   97-136   106-143 (183)
  8 PF12662 cEGF:  Complement Clr-  50.9      15 0.00032   17.7   1.7   18  119-136     5-22  (24)
  9 PF01826 TIL:  Trypsin Inhibito  47.5     3.2   7E-05   23.7  -1.2   18  119-137    36-53  (55)
 10 PF08475 Baculo_VP91_N:  Viral   43.9      25 0.00054   25.8   2.7   37   21-60    106-142 (183)
 11 cd00064 FU Furin-like repeats.  42.4      23  0.0005   19.5   1.9   17  118-134    33-49  (49)
 12 PF07645 EGF_CA:  Calcium-bindi  31.2      23  0.0005   19.0   0.6   32   26-58     10-42  (42)
 13 PF09064 Tme5_EGF_like:  Thromb  30.4      43 0.00094   17.6   1.5   21   35-55     12-32  (34)
 14 PF12191 stn_TNFRSF12A:  Tumour  23.5      25 0.00054   24.2  -0.1   20  115-134    31-50  (129)
 15 PF00220 Hormone_4:  Neurohypop  22.8      44 0.00095   12.3   0.5    6  118-123     4-9   (9)

No 1  
>PF01607 CBM_14:  Chitin binding Peritrophin-A domain;  InterPro: IPR002557 This entry represents a chitin binding domain []. It is found in (amongst others) the Peritrophin-A chitin binding proteins, particularly the peritrophic matrix proteins of insects and animal chitinases [, , ]. Copies of the domain are also found in some baculoviruses. It is an extracellular domain that contains six conserved cysteines that probably form three disulphide bridges. Chitin binding has been demonstrated for a protein containing only two of these domains [].; GO: 0008061 chitin binding, 0006030 chitin metabolic process, 0005576 extracellular region; PDB: 1DQC_A.
Probab=99.41  E-value=7.7e-14  Score=81.58  Aligned_cols=48  Identities=27%  Similarity=0.573  Sum_probs=37.1

Q ss_pred             CCCCCCCCCCCccEEcCCCceeeeeCCCCCceecCCCCCCCCCCCCCC
Q psy11498         95 YPRFPVPGDRERLITCVDGHPRLISCGDGKLFDEASLTCLGPEDYTDK  142 (143)
Q Consensus        95 ~g~~~~p~~C~~y~~C~~g~~~~~~Cp~g~~Fn~~~~~C~~~~~v~~~  142 (143)
                      .|+++++.+|++||+|.+|.++++.||.|++||+.+++|+++++|..|
T Consensus         6 ~~~~~~~~~C~~Y~~C~~g~~~~~~C~~g~~fd~~~~~C~~~~~~~~C   53 (53)
T PF01607_consen    6 DGFYPHPDDCRKYYQCVNGQAVEQRCPEGLYFDPSSQRCVPPSNVVQC   53 (53)
T ss_dssp             SEEE--SS-SSEEEEEETTEEEEEE-TTS-EE-TTTSSEE-TTT-TT-
T ss_pred             CeeEeCCCCCCEEEEeeCCcEECCCCcCCCEECcCcCEEcCCccCCCC
Confidence            578999999999999999999999999999999999999999997765


No 2  
>PF01607 CBM_14:  Chitin binding Peritrophin-A domain;  InterPro: IPR002557 This entry represents a chitin binding domain []. It is found in (amongst others) the Peritrophin-A chitin binding proteins, particularly the peritrophic matrix proteins of insects and animal chitinases [, , ]. Copies of the domain are also found in some baculoviruses. It is an extracellular domain that contains six conserved cysteines that probably form three disulphide bridges. Chitin binding has been demonstrated for a protein containing only two of these domains [].; GO: 0008061 chitin binding, 0006030 chitin metabolic process, 0005576 extracellular region; PDB: 1DQC_A.
Probab=99.35  E-value=7.9e-13  Score=77.24  Aligned_cols=48  Identities=29%  Similarity=0.673  Sum_probs=36.3

Q ss_pred             CCC-CCceeeCCCCcccccEEcCCCceeEecCCCCCeeeCCCCccCCCCC
Q psy11498         15 CEF-KYGIYAESSACSTNYIKCEEGYPYLQPCEPGLAYDDRVHKCNWPDE   63 (143)
Q Consensus        15 C~~-~~g~~p~~~~C~~~y~~C~~g~~~~~~Cp~gl~Fn~~~~~C~~~~~   63 (143)
                      |+. .+|+|+++.+|+ +||+|.+|+++++.||.|++||..++.|+++..
T Consensus         1 C~~~~~~~~~~~~~C~-~Y~~C~~g~~~~~~C~~g~~fd~~~~~C~~~~~   49 (53)
T PF01607_consen    1 CPGRGDGFYPHPDDCR-KYYQCVNGQAVEQRCPEGLYFDPSSQRCVPPSN   49 (53)
T ss_dssp             ----SSEEE--SS-SS-EEEEEETTEEEEEE-TTS-EE-TTTSSEE-TTT
T ss_pred             CCccCCeeEeCCCCCC-EEEEeeCCcEECCCCcCCCEECcCcCEEcCCcc
Confidence            443 478999999999 999999999999999999999999999999987


No 3  
>smart00494 ChtBD2 Chitin-binding domain type 2.
Probab=99.22  E-value=2.1e-11  Score=71.62  Aligned_cols=50  Identities=34%  Similarity=0.961  Sum_probs=45.6

Q ss_pred             CCCC-CCceeeCCCCcccccEEcCCCceeEecCCCCCeeeCCCCccCCCCCC
Q psy11498         14 PCEF-KYGIYAESSACSTNYIKCEEGYPYLQPCEPGLAYDDRVHKCNWPDEL   64 (143)
Q Consensus        14 ~C~~-~~g~~p~~~~C~~~y~~C~~g~~~~~~Cp~gl~Fn~~~~~C~~~~~~   64 (143)
                      .|.. ..|+++++.+|+ +||+|.+|....+.||.|++||..++.|+++..+
T Consensus         2 ~C~~~~~g~~~~~~~C~-~y~~C~~~~~~~~~C~~g~~f~~~~~~C~~~~~~   52 (56)
T smart00494        2 ECPGRGDGLYPHPTDCS-KYYQCSNGRPIVGSCPAGLVFDPATQTCDWPDNV   52 (56)
T ss_pred             cCCCCCCccccCcccCC-eeEEcCCCcEEeccCcCCCeECCCCCCcCCcccC
Confidence            4654 468999999999 8999999999999999999999999999999876


No 4  
>smart00494 ChtBD2 Chitin-binding domain type 2.
Probab=99.21  E-value=2.1e-11  Score=71.66  Aligned_cols=46  Identities=33%  Similarity=0.621  Sum_probs=43.1

Q ss_pred             CCCCCCCCCCCccEEcCCCceeeeeCCCCCceecCCCCCCCCCCCC
Q psy11498         95 YPRFPVPGDRERLITCVDGHPRLISCGDGKLFDEASLTCLGPEDYT  140 (143)
Q Consensus        95 ~g~~~~p~~C~~y~~C~~g~~~~~~Cp~g~~Fn~~~~~C~~~~~v~  140 (143)
                      .|+++++.+|++||+|..|.++.+.||.|++||..++.|++++.+.
T Consensus         8 ~g~~~~~~~C~~y~~C~~~~~~~~~C~~g~~f~~~~~~C~~~~~~~   53 (56)
T smart00494        8 DGLYPHPTDCSKYYQCSNGRPIVGSCPAGLVFDPATQTCDWPDNVG   53 (56)
T ss_pred             CccccCcccCCeeEEcCCCcEEeccCcCCCeECCCCCCcCCcccCC
Confidence            5799999999999999999999999999999999999999998743


No 5  
>PF03427 CBM_19:  Carbohydrate binding domain (family 19);  InterPro: IPR005089 A carbohydrate-binding module (CBM) is defined as a contiguous amino acid sequence within a carbohydrate-active enzyme with a discreet fold having carbohydrate-binding activity. A few exceptions are CBMs in cellulosomal scaffolding proteins and rare instances of independent putative CBMs. The requirement of CBMs existing as modules within larger enzymes sets this class of carbohydrate-binding protein apart from other non-catalytic sugar binding proteins such as lectins and sugar transport proteins. CBMs were previously classified as cellulose-binding domains (CBDs) based on the initial discovery of several modules that bound cellulose [, ]. However, additional modules in carbohydrate-active enzymes are continually being found that bind carbohydrates other than cellulose yet otherwise meet the CBM criteria, hence the need to reclassify these polypeptides using more inclusive terminology. Previous classification of cellulose-binding domains were based on amino acid similarity. Groupings of CBDs were called "Types" and numbered with roman numerals (e.g. Type I or Type II CBDs). In keeping with the glycoside hydrolase classification, these groupings are now called families and numbered with Arabic numerals. Families 1 to 13 are the same as Types I to XIII. For a detailed review on the structure and binding modes of CBMs see []. This entry represents CBM19 from CAZY which consists of 60-70 residues with chitin-binding function.; GO: 0004568 chitinase activity, 0006032 chitin catabolic process
Probab=91.47  E-value=0.21  Score=29.98  Aligned_cols=20  Identities=20%  Similarity=0.439  Sum_probs=18.8

Q ss_pred             ccEEcCCCceeeeeCCCCCc
Q psy11498        106 RLITCVDGHPRLISCGDGKL  125 (143)
Q Consensus       106 ~y~~C~~g~~~~~~Cp~g~~  125 (143)
                      +|-+|.+|.++.+.||+|++
T Consensus        36 ~faiC~~G~Wv~~~C~~Gt~   55 (61)
T PF03427_consen   36 SFAICDHGTWVITPCPAGTT   55 (61)
T ss_pred             CEEEcCCCcEEEeeCCCCCE
Confidence            69999999999999999986


No 6  
>PF03427 CBM_19:  Carbohydrate binding domain (family 19);  InterPro: IPR005089 A carbohydrate-binding module (CBM) is defined as a contiguous amino acid sequence within a carbohydrate-active enzyme with a discreet fold having carbohydrate-binding activity. A few exceptions are CBMs in cellulosomal scaffolding proteins and rare instances of independent putative CBMs. The requirement of CBMs existing as modules within larger enzymes sets this class of carbohydrate-binding protein apart from other non-catalytic sugar binding proteins such as lectins and sugar transport proteins. CBMs were previously classified as cellulose-binding domains (CBDs) based on the initial discovery of several modules that bound cellulose [, ]. However, additional modules in carbohydrate-active enzymes are continually being found that bind carbohydrates other than cellulose yet otherwise meet the CBM criteria, hence the need to reclassify these polypeptides using more inclusive terminology. Previous classification of cellulose-binding domains were based on amino acid similarity. Groupings of CBDs were called "Types" and numbered with roman numerals (e.g. Type I or Type II CBDs). In keeping with the glycoside hydrolase classification, these groupings are now called families and numbered with Arabic numerals. Families 1 to 13 are the same as Types I to XIII. For a detailed review on the structure and binding modes of CBMs see []. This entry represents CBM19 from CAZY which consists of 60-70 residues with chitin-binding function.; GO: 0004568 chitinase activity, 0006032 chitin catabolic process
Probab=87.32  E-value=0.69  Score=27.74  Aligned_cols=22  Identities=23%  Similarity=0.641  Sum_probs=19.8

Q ss_pred             cccEEcCCCceeEecCCCCCee
Q psy11498         30 TNYIKCEEGYPYLQPCEPGLAY   51 (143)
Q Consensus        30 ~~y~~C~~g~~~~~~Cp~gl~F   51 (143)
                      ++|-+|.+|+..+..||+|+.=
T Consensus        35 G~faiC~~G~Wv~~~C~~Gt~C   56 (61)
T PF03427_consen   35 GSFAICDHGTWVITPCPAGTTC   56 (61)
T ss_pred             CCEEEcCCCcEEEeeCCCCCEE
Confidence            4799999999999999999863


No 7  
>PF08475 Baculo_VP91_N:  Viral capsid protein 91 N-terminal;  InterPro: IPR013682 This domain is found in Baculoviridae including the nucleopolyhedrovirus at the N terminus of the viral capsid protein 91 (VP91) []. 
Probab=60.77  E-value=9.3  Score=28.02  Aligned_cols=38  Identities=24%  Similarity=0.379  Sum_probs=32.0

Q ss_pred             CCCCCCCCCccEEcCCCceeeeeCCCCCceecCCCCCCCC
Q psy11498         97 RFPVPGDRERLITCVDGHPRLISCGDGKLFDEASLTCLGP  136 (143)
Q Consensus        97 ~~~~p~~C~~y~~C~~g~~~~~~Cp~g~~Fn~~~~~C~~~  136 (143)
                      .-+|+.|=.+|..=..-.+..+.||.+..||..  +|+..
T Consensus       106 V~~~~~d~~kF~~~~DDGwv~~~CP~~~~FD~~--~Cvp~  143 (183)
T PF08475_consen  106 VRPHPNDPTKFIARGDDGWVDMDCPENERFDGN--KCVPI  143 (183)
T ss_pred             eecCCCCCceEEEEecCCcEEEeCCCccccccc--ceeec
Confidence            457888889998877666899999999999999  88754


No 8  
>PF12662 cEGF:  Complement Clr-like EGF-like
Probab=50.87  E-value=15  Score=17.71  Aligned_cols=18  Identities=22%  Similarity=0.407  Sum_probs=15.2

Q ss_pred             eCCCCCceecCCCCCCCC
Q psy11498        119 SCGDGKLFDEASLTCLGP  136 (143)
Q Consensus       119 ~Cp~g~~Fn~~~~~C~~~  136 (143)
                      +|++|+..++....|..-
T Consensus         5 ~C~~Gy~l~~d~~~C~DI   22 (24)
T PF12662_consen    5 SCPPGYQLSPDGRSCEDI   22 (24)
T ss_pred             eCCCCCcCCCCCCccccC
Confidence            699999999998888753


No 9  
>PF01826 TIL:  Trypsin Inhibitor like cysteine rich domain;  InterPro: IPR002919 This domain is found in proteinase inhibitors as well as in many extracellular proteins. The domain typically contains ten cysteine residues that form five disulphide bonds. The cysteine residues that form the disulphide bonds are 1-7, 2-6, 3-5, 4-10 and 8-9. This inhibitor domain belongs to MEROPS inhibitor family I8 (clan IA). Proteins containing this domain inhibit peptidases belonging to families S1 (IPR001254 from INTERPRO), S8 (IPR000209 from INTERPRO), and M4 (IPR001570 from INTERPRO) [] and are restricted to the chordata, nematoda, arthropoda and echinodermata. Examples of proteins containing this domain are:  chymotrypsin/elastase inhibitor from Ascaris suum (pig roundworm) Acp62F protein from Drosophila melanogaster  Bombina trypsin inhibitor from Bombina maxima (large-webbed bell toad) Bombyx subtilisin inhibitor from Bombyx mori (silk moth) von Willebrand factor ; PDB: 2P3F_N 1HX2_A 1CCV_A 1EAI_D 2H9E_C 1COU_A 1ATE_A 1ATB_A 1ATD_A 1ATA_A ....
Probab=47.49  E-value=3.2  Score=23.74  Aligned_cols=18  Identities=22%  Similarity=0.538  Sum_probs=14.7

Q ss_pred             eCCCCCceecCCCCCCCCC
Q psy11498        119 SCGDGKLFDEASLTCLGPE  137 (143)
Q Consensus       119 ~Cp~g~~Fn~~~~~C~~~~  137 (143)
                      .|+.|+|+|.. +.|+.++
T Consensus        36 ~C~~G~v~~~~-~~CV~~~   53 (55)
T PF01826_consen   36 FCPPGYVRNDN-GRCVPPS   53 (55)
T ss_dssp             EETTTEEEETT-SEEEEGG
T ss_pred             CCCCCeeEcCC-CCEEcHH
Confidence            58999999988 8887654


No 10 
>PF08475 Baculo_VP91_N:  Viral capsid protein 91 N-terminal;  InterPro: IPR013682 This domain is found in Baculoviridae including the nucleopolyhedrovirus at the N terminus of the viral capsid protein 91 (VP91) []. 
Probab=43.94  E-value=25  Score=25.81  Aligned_cols=37  Identities=14%  Similarity=0.183  Sum_probs=31.8

Q ss_pred             eeeCCCCcccccEEcCCCceeEecCCCCCeeeCCCCccCC
Q psy11498         21 IYAESSACSTNYIKCEEGYPYLQPCEPGLAYDDRVHKCNW   60 (143)
Q Consensus        21 ~~p~~~~C~~~y~~C~~g~~~~~~Cp~gl~Fn~~~~~C~~   60 (143)
                      +-+++.+=+ +|..=.+--...+.||.+..||..  +|+.
T Consensus       106 V~~~~~d~~-kF~~~~DDGwv~~~CP~~~~FD~~--~Cvp  142 (183)
T PF08475_consen  106 VRPHPNDPT-KFIARGDDGWVDMDCPENERFDGN--KCVP  142 (183)
T ss_pred             eecCCCCCc-eEEEEecCCcEEEeCCCccccccc--ceee
Confidence            557888888 998877666999999999999999  8884


No 11 
>cd00064 FU Furin-like repeats. Cysteine rich region. Exact function of the domain is not known. Furin is a serine-kinase dependent proprotein processor. Other members of this family include endoproteases and cell surface receptors.
Probab=42.37  E-value=23  Score=19.51  Aligned_cols=17  Identities=29%  Similarity=0.618  Sum_probs=13.6

Q ss_pred             eeCCCCCceecCCCCCC
Q psy11498        118 ISCGDGKLFDEASLTCL  134 (143)
Q Consensus       118 ~~Cp~g~~Fn~~~~~C~  134 (143)
                      ..||.++++|.....|.
T Consensus        33 ~~C~~~~~~~~~~~~C~   49 (49)
T cd00064          33 SECPEGTYADTEGGVCL   49 (49)
T ss_pred             ccCCCCceecCcCCcCC
Confidence            37999999997777763


No 12 
>PF07645 EGF_CA:  Calcium-binding EGF domain;  InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins. Many of these proteins require calcium for their biological function and a calcium-binding site has been found at the N terminus of some EGF-like domains []. Calcium-binding may be crucial for numerous protein-protein interactions. For human coagulation factor IX it has been shown [] that the calcium-ligands form a pentagonal bipyramid. The first, third and fourth conserved negatively charged or polar residues are side chain ligands. The latter is possibly hydroxylated (see aspartic acid and asparagine hydroxylation site) []. A conserved aromatic residue, as well as the second conserved negative residue, are thought to be involved in stabilising the calcium-binding site. As in non-calcium binding EGF-like domains, there are six conserved cysteines and the structure of both types is very similar as calcium-binding induces only strictly local structural changes [].  +------------------+ +---------+ | | | | nxnnC-x(3,14)-C-x(3,7)-CxxbxxxxaxC-x(1,6)-C-x(8,13)-Cx | | +------------------+ 'n': negatively charged or polar residue [DEQN] 'b': possibly beta-hydroxylated residue [DN] 'a': aromatic amino acid 'C': cysteine, involved in disulphide bond 'x': any amino acid. ; GO: 0005509 calcium ion binding; PDB: 2VJ3_A 1TOZ_A 1LMJ_A 1UZQ_A 1UZK_A 1UZJ_B 1UZP_A 1EMO_A 1EMN_A 2RR0_A ....
Probab=31.22  E-value=23  Score=18.98  Aligned_cols=32  Identities=22%  Similarity=0.474  Sum_probs=21.6

Q ss_pred             CCcccccEEcCCCcee-EecCCCCCeeeCCCCcc
Q psy11498         26 SACSTNYIKCEEGYPY-LQPCEPGLAYDDRVHKC   58 (143)
Q Consensus        26 ~~C~~~y~~C~~g~~~-~~~Cp~gl~Fn~~~~~C   58 (143)
                      ..|. ..-.|+|-... .=.|++|+..+.....|
T Consensus        10 ~~C~-~~~~C~N~~Gsy~C~C~~Gy~~~~~~~~C   42 (42)
T PF07645_consen   10 HNCP-ENGTCVNTEGSYSCSCPPGYELNDDGTTC   42 (42)
T ss_dssp             SSSS-TTSEEEEETTEEEEEESTTEEECTTSSEE
T ss_pred             CcCC-CCCEEEcCCCCEEeeCCCCcEECCCCCcC
Confidence            3566 66777765433 33689999987776665


No 13 
>PF09064 Tme5_EGF_like:  Thrombomodulin like fifth domain, EGF-like;  InterPro: IPR015149 This domain adopts a fold similar to other EGF domains, with a flat major and a twisted minor beta sheet. Disulphide pairing, however, is not of the usual 1-3, 2-4, 5-6 type; rather 1-2, 3-4, 5-6 pairing is found. Its extended major sheet (strands beta-2 and beta-3 and the connecting loop) projects into thrombin's active site groove. This domain is required for interaction of thrombomodulin with thrombin, and subsequent activation of protein-C []. ; GO: 0004888 transmembrane signaling receptor activity, 0016021 integral to membrane
Probab=30.39  E-value=43  Score=17.60  Aligned_cols=21  Identities=24%  Similarity=0.472  Sum_probs=13.3

Q ss_pred             cCCCceeEecCCCCCeeeCCC
Q psy11498         35 CEEGYPYLQPCEPGLAYDDRV   55 (143)
Q Consensus        35 C~~g~~~~~~Cp~gl~Fn~~~   55 (143)
                      |.......=.||+|++.|...
T Consensus        12 CDpn~~~~C~CPeGyIlde~~   32 (34)
T PF09064_consen   12 CDPNSPGQCFCPEGYILDEGS   32 (34)
T ss_pred             cCCCCCCceeCCCceEecCCc
Confidence            444344455789999887653


No 14 
>PF12191 stn_TNFRSF12A:  Tumour necrosis factor receptor stn_TNFRSF12A_TNFR domain;  InterPro: IPR022316 The tumour necrosis factor (TNF) receptor (TNFR) superfamily comprises more than 20 type-I transmembrane proteins. Family members are defined based on similarity in their extracellular domain - a region that contains many cysteine residues arranged in a specific repetitive pattern []. The cysteines allow formation of an extended rod-like structure, responsible for ligand binding []. Upon receptor activation, different intracellular signalling complexes are assembled for different members of the TNFR superfamily, depending on their intracellular domains and sequences []. Activation of TNFRs can therefore induce a range of disparate effects, including cell proliferation, differentiation, survival, or apoptotic cell death, depending upon the receptor involved []. TNFRs are widely distributed and play important roles in many crucial biological processes, such as lymphoid and neuronal development, innate and adaptive immunity, and maintenance of cellular homeostasis []. Drugs that manipulate their signalling have potential roles in the prevention and treatment of many diseases, such as viral infections, coronary heart disease, transplant rejection, and immune disease []. TNF receptor 12 (also known as TWEAK receptor, and fibroblast growth factor-inducible-14 (Fn14)) has been implicated in endothelial cell growth and migration []. The receptor may also play a role in cell-matrix interactions [].; PDB: 2KN0_A 2RPJ_A 2KMZ_A 2EQP_A.
Probab=23.49  E-value=25  Score=24.22  Aligned_cols=20  Identities=20%  Similarity=0.524  Sum_probs=16.2

Q ss_pred             eeeeeCCCCCceecCCCCCC
Q psy11498        115 PRLISCGDGKLFDEASLTCL  134 (143)
Q Consensus       115 ~~~~~Cp~g~~Fn~~~~~C~  134 (143)
                      +-...||.|..||+....|+
T Consensus        31 ~~~~~Cp~G~sWs~dLdkCm   50 (129)
T PF12191_consen   31 PGTTPCPRGSSWSADLDKCM   50 (129)
T ss_dssp             CSCSSS-SSEEEETTTTEEE
T ss_pred             CCCCCCCCCCcCcccccccc
Confidence            44578999999999999985


No 15 
>PF00220 Hormone_4:  Neurohypophysial hormones, N-terminal Domain;  InterPro: IPR022423 Oxytocin (or ocytocin) and vasopressin [] are small (nine amino acid residues), structurally and functionally related neurohypophysial peptide hormones. Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland while vasopressin has a direct antidiuretic action on the kidney and also causes vasoconstriction of the peripheral vessels. Like the majority of active peptides, both hormones are synthesized as larger protein precursors that are enzymatically converted to their mature forms. Peptides belonging to this family are also found in birds, fish, reptiles and amphibians (mesotocin, isotocin, valitocin, glumitocin, aspargtocin, vasotocin, seritocin, asvatocin, phasvatocin), in worms (annetocin), octopi (cephalotocin), locust (locupressin or neuropeptide F1/F2) and in molluscs (conopressins G and S) [].  The pattern developed to detect this category of peptides spans their entire sequence and includes four invariant amino acid residues.  .; GO: 0005185 neurohypophyseal hormone activity, 0005576 extracellular region
Probab=22.76  E-value=44  Score=12.25  Aligned_cols=6  Identities=33%  Similarity=0.623  Sum_probs=3.0

Q ss_pred             eeCCCC
Q psy11498        118 ISCGDG  123 (143)
Q Consensus       118 ~~Cp~g  123 (143)
                      ..||-|
T Consensus         4 ~nCP~G    9 (9)
T PF00220_consen    4 RNCPIG    9 (9)
T ss_pred             ccCCCC
Confidence            455543


Done!