Query         psy11499
Match_columns 70
No_of_seqs    131 out of 833
Neff          6.3 
Searched_HMMs 46136
Date          Fri Aug 16 19:56:17 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy11499.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/11499hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF01607 CBM_14:  Chitin bindin  99.6 5.6E-16 1.2E-20   82.9   2.9   48   22-69      6-53  (53)
  2 smart00494 ChtBD2 Chitin-bindi  99.4   2E-13 4.3E-18   73.1   4.4   45   22-66      8-52  (56)
  3 PF03427 CBM_19:  Carbohydrate   89.9    0.38 8.1E-06   27.3   2.5   20   33-52     36-55  (61)
  4 PF08475 Baculo_VP91_N:  Viral   74.4     3.8 8.1E-05   27.8   2.8   38   24-63    106-143 (183)
  5 PF01826 TIL:  Trypsin Inhibito  66.1     1.2 2.7E-05   23.6  -0.8   19   45-64     35-53  (55)
  6 cd00064 FU Furin-like repeats.  63.4     7.1 0.00015   20.0   1.9   29   31-60     20-48  (49)
  7 PF12662 cEGF:  Complement Clr-  53.2     9.7 0.00021   17.6   1.2   18   46-63      5-22  (24)
  8 PF09064 Tme5_EGF_like:  Thromb  44.3      26 0.00056   17.7   2.0   15   43-57     18-32  (34)
  9 PF07645 EGF_CA:  Calcium-bindi  34.5      24 0.00051   17.6   1.0   32   29-60     10-42  (42)
 10 PF07422 s48_45:  Sexual stage   28.6      19 0.00042   21.3   0.1    9    1-9      40-48  (115)
 11 cd03529 Rieske_NirD Assimilato  27.0      92   0.002   18.1   2.8   21   44-64     63-84  (103)
 12 PF04833 COBRA:  COBRA-like pro  26.7      65  0.0014   21.7   2.3   34   27-60     43-82  (169)
 13 smart00032 CCP Domain abundant  26.3      87  0.0019   15.2   2.4   24   34-57     27-54  (57)
 14 PHA02714 CD-30-like protein; P  25.6      38 0.00082   21.1   0.9   20   42-61     19-38  (110)
 15 PF08779 SARS_X4:  SARS coronav  24.8      63  0.0014   19.1   1.7   20   33-52      4-25  (84)
 16 PF00220 Hormone_4:  Neurohypop  23.5      41 0.00089   12.2   0.5    6   45-50      4-9   (9)
 17 PF12191 stn_TNFRSF12A:  Tumour  23.4      40 0.00087   21.7   0.8   20   42-61     31-50  (129)
 18 PF09207 Yeast-kill-tox:  Yeast  20.6      50  0.0011   19.4   0.8   16   54-69     11-26  (87)

No 1  
>PF01607 CBM_14:  Chitin binding Peritrophin-A domain;  InterPro: IPR002557 This entry represents a chitin binding domain []. It is found in (amongst others) the Peritrophin-A chitin binding proteins, particularly the peritrophic matrix proteins of insects and animal chitinases [, , ]. Copies of the domain are also found in some baculoviruses. It is an extracellular domain that contains six conserved cysteines that probably form three disulphide bridges. Chitin binding has been demonstrated for a protein containing only two of these domains [].; GO: 0008061 chitin binding, 0006030 chitin metabolic process, 0005576 extracellular region; PDB: 1DQC_A.
Probab=99.60  E-value=5.6e-16  Score=82.90  Aligned_cols=48  Identities=27%  Similarity=0.573  Sum_probs=36.7

Q ss_pred             CCCCCCccCCcccEEcCCCeeeEeeCCCCCeeecCCCcCCCCCCCCCC
Q psy11499         22 YPRFPVPGDRERLITCVDGHPRLISCGDGKLFDEASLTCLGPEDYTDK   69 (70)
Q Consensus        22 ~~~~p~p~dC~~yy~C~~G~~~~~~Cp~Gl~Fd~~~~~C~~p~~v~~C   69 (70)
                      .++++++.+|++||+|.+|.+.++.||.|++||+.++.|+++++|..|
T Consensus         6 ~~~~~~~~~C~~Y~~C~~g~~~~~~C~~g~~fd~~~~~C~~~~~~~~C   53 (53)
T PF01607_consen    6 DGFYPHPDDCRKYYQCVNGQAVEQRCPEGLYFDPSSQRCVPPSNVVQC   53 (53)
T ss_dssp             SEEE--SS-SSEEEEEETTEEEEEE-TTS-EE-TTTSSEE-TTT-TT-
T ss_pred             CeeEeCCCCCCEEEEeeCCcEECCCCcCCCEECcCcCEEcCCccCCCC
Confidence            457899999999999999999999999999999999999999997666


No 2  
>smart00494 ChtBD2 Chitin-binding domain type 2.
Probab=99.43  E-value=2e-13  Score=73.08  Aligned_cols=45  Identities=33%  Similarity=0.642  Sum_probs=42.5

Q ss_pred             CCCCCCccCCcccEEcCCCeeeEeeCCCCCeeecCCCcCCCCCCC
Q psy11499         22 YPRFPVPGDRERLITCVDGHPRLISCGDGKLFDEASLTCLGPEDY   66 (70)
Q Consensus        22 ~~~~p~p~dC~~yy~C~~G~~~~~~Cp~Gl~Fd~~~~~C~~p~~v   66 (70)
                      .++++||.+|++|++|.+|.+..+.||.|++||..++.|+++.++
T Consensus         8 ~g~~~~~~~C~~y~~C~~~~~~~~~C~~g~~f~~~~~~C~~~~~~   52 (56)
T smart00494        8 DGLYPHPTDCSKYYQCSNGRPIVGSCPAGLVFDPATQTCDWPDNV   52 (56)
T ss_pred             CccccCcccCCeeEEcCCCcEEeccCcCCCeECCCCCCcCCcccC
Confidence            458999999999999999999999999999999999999999875


No 3  
>PF03427 CBM_19:  Carbohydrate binding domain (family 19);  InterPro: IPR005089 A carbohydrate-binding module (CBM) is defined as a contiguous amino acid sequence within a carbohydrate-active enzyme with a discreet fold having carbohydrate-binding activity. A few exceptions are CBMs in cellulosomal scaffolding proteins and rare instances of independent putative CBMs. The requirement of CBMs existing as modules within larger enzymes sets this class of carbohydrate-binding protein apart from other non-catalytic sugar binding proteins such as lectins and sugar transport proteins. CBMs were previously classified as cellulose-binding domains (CBDs) based on the initial discovery of several modules that bound cellulose [, ]. However, additional modules in carbohydrate-active enzymes are continually being found that bind carbohydrates other than cellulose yet otherwise meet the CBM criteria, hence the need to reclassify these polypeptides using more inclusive terminology. Previous classification of cellulose-binding domains were based on amino acid similarity. Groupings of CBDs were called "Types" and numbered with roman numerals (e.g. Type I or Type II CBDs). In keeping with the glycoside hydrolase classification, these groupings are now called families and numbered with Arabic numerals. Families 1 to 13 are the same as Types I to XIII. For a detailed review on the structure and binding modes of CBMs see []. This entry represents CBM19 from CAZY which consists of 60-70 residues with chitin-binding function.; GO: 0004568 chitinase activity, 0006032 chitin catabolic process
Probab=89.92  E-value=0.38  Score=27.35  Aligned_cols=20  Identities=20%  Similarity=0.439  Sum_probs=18.7

Q ss_pred             ccEEcCCCeeeEeeCCCCCe
Q psy11499         33 RLITCVDGHPRLISCGDGKL   52 (70)
Q Consensus        33 ~yy~C~~G~~~~~~Cp~Gl~   52 (70)
                      +|-+|.+|+-....||+|++
T Consensus        36 ~faiC~~G~Wv~~~C~~Gt~   55 (61)
T PF03427_consen   36 SFAICDHGTWVITPCPAGTT   55 (61)
T ss_pred             CEEEcCCCcEEEeeCCCCCE
Confidence            69999999999999999986


No 4  
>PF08475 Baculo_VP91_N:  Viral capsid protein 91 N-terminal;  InterPro: IPR013682 This domain is found in Baculoviridae including the nucleopolyhedrovirus at the N terminus of the viral capsid protein 91 (VP91) []. 
Probab=74.44  E-value=3.8  Score=27.84  Aligned_cols=38  Identities=24%  Similarity=0.379  Sum_probs=32.3

Q ss_pred             CCCCccCCcccEEcCCCeeeEeeCCCCCeeecCCCcCCCC
Q psy11499         24 RFPVPGDRERLITCVDGHPRLISCGDGKLFDEASLTCLGP   63 (70)
Q Consensus        24 ~~p~p~dC~~yy~C~~G~~~~~~Cp~Gl~Fd~~~~~C~~p   63 (70)
                      .-+|+.|=+||..=.+---..+.||.+..||..  +|+..
T Consensus       106 V~~~~~d~~kF~~~~DDGwv~~~CP~~~~FD~~--~Cvp~  143 (183)
T PF08475_consen  106 VRPHPNDPTKFIARGDDGWVDMDCPENERFDGN--KCVPI  143 (183)
T ss_pred             eecCCCCCceEEEEecCCcEEEeCCCccccccc--ceeec
Confidence            448899999999987655888999999999999  88754


No 5  
>PF01826 TIL:  Trypsin Inhibitor like cysteine rich domain;  InterPro: IPR002919 This domain is found in proteinase inhibitors as well as in many extracellular proteins. The domain typically contains ten cysteine residues that form five disulphide bonds. The cysteine residues that form the disulphide bonds are 1-7, 2-6, 3-5, 4-10 and 8-9. This inhibitor domain belongs to MEROPS inhibitor family I8 (clan IA). Proteins containing this domain inhibit peptidases belonging to families S1 (IPR001254 from INTERPRO), S8 (IPR000209 from INTERPRO), and M4 (IPR001570 from INTERPRO) [] and are restricted to the chordata, nematoda, arthropoda and echinodermata. Examples of proteins containing this domain are:  chymotrypsin/elastase inhibitor from Ascaris suum (pig roundworm) Acp62F protein from Drosophila melanogaster  Bombina trypsin inhibitor from Bombina maxima (large-webbed bell toad) Bombyx subtilisin inhibitor from Bombyx mori (silk moth) von Willebrand factor ; PDB: 2P3F_N 1HX2_A 1CCV_A 1EAI_D 2H9E_C 1COU_A 1ATE_A 1ATB_A 1ATD_A 1ATA_A ....
Probab=66.13  E-value=1.2  Score=23.57  Aligned_cols=19  Identities=21%  Similarity=0.490  Sum_probs=15.4

Q ss_pred             eeCCCCCeeecCCCcCCCCC
Q psy11499         45 ISCGDGKLFDEASLTCLGPE   64 (70)
Q Consensus        45 ~~Cp~Gl~Fd~~~~~C~~p~   64 (70)
                      =.|++|+++|.. +.|+.++
T Consensus        35 C~C~~G~v~~~~-~~CV~~~   53 (55)
T PF01826_consen   35 CFCPPGYVRNDN-GRCVPPS   53 (55)
T ss_dssp             EEETTTEEEETT-SEEEEGG
T ss_pred             CCCCCCeeEcCC-CCEEcHH
Confidence            459999999998 8887653


No 6  
>cd00064 FU Furin-like repeats. Cysteine rich region. Exact function of the domain is not known. Furin is a serine-kinase dependent proprotein processor. Other members of this family include endoproteases and cell surface receptors.
Probab=63.36  E-value=7.1  Score=20.02  Aligned_cols=29  Identities=21%  Similarity=0.374  Sum_probs=18.4

Q ss_pred             CcccEEcCCCeeeEeeCCCCCeeecCCCcC
Q psy11499         31 RERLITCVDGHPRLISCGDGKLFDEASLTC   60 (70)
Q Consensus        31 C~~yy~C~~G~~~~~~Cp~Gl~Fd~~~~~C   60 (70)
                      |...+. .++..=+..||.+.++|.....|
T Consensus        20 C~~~~~-~~~~~Cv~~C~~~~~~~~~~~~C   48 (49)
T cd00064          20 CRHGFY-LDGGTCVSECPEGTYADTEGGVC   48 (49)
T ss_pred             CcCccC-CCCCcccccCCCCceecCcCCcC
Confidence            444443 33333445899999999777666


No 7  
>PF12662 cEGF:  Complement Clr-like EGF-like
Probab=53.23  E-value=9.7  Score=17.58  Aligned_cols=18  Identities=22%  Similarity=0.407  Sum_probs=15.0

Q ss_pred             eCCCCCeeecCCCcCCCC
Q psy11499         46 SCGDGKLFDEASLTCLGP   63 (70)
Q Consensus        46 ~Cp~Gl~Fd~~~~~C~~p   63 (70)
                      +|++|+..++....|..-
T Consensus         5 ~C~~Gy~l~~d~~~C~DI   22 (24)
T PF12662_consen    5 SCPPGYQLSPDGRSCEDI   22 (24)
T ss_pred             eCCCCCcCCCCCCccccC
Confidence            499999999988888653


No 8  
>PF09064 Tme5_EGF_like:  Thrombomodulin like fifth domain, EGF-like;  InterPro: IPR015149 This domain adopts a fold similar to other EGF domains, with a flat major and a twisted minor beta sheet. Disulphide pairing, however, is not of the usual 1-3, 2-4, 5-6 type; rather 1-2, 3-4, 5-6 pairing is found. Its extended major sheet (strands beta-2 and beta-3 and the connecting loop) projects into thrombin's active site groove. This domain is required for interaction of thrombomodulin with thrombin, and subsequent activation of protein-C []. ; GO: 0004888 transmembrane signaling receptor activity, 0016021 integral to membrane
Probab=44.35  E-value=26  Score=17.66  Aligned_cols=15  Identities=33%  Similarity=0.587  Sum_probs=11.4

Q ss_pred             eEeeCCCCCeeecCC
Q psy11499         43 RLISCGDGKLFDEAS   57 (70)
Q Consensus        43 ~~~~Cp~Gl~Fd~~~   57 (70)
                      ..=.||+|++.|+..
T Consensus        18 ~~C~CPeGyIlde~~   32 (34)
T PF09064_consen   18 GQCFCPEGYILDEGS   32 (34)
T ss_pred             CceeCCCceEecCCc
Confidence            344599999998865


No 9  
>PF07645 EGF_CA:  Calcium-binding EGF domain;  InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins. Many of these proteins require calcium for their biological function and a calcium-binding site has been found at the N terminus of some EGF-like domains []. Calcium-binding may be crucial for numerous protein-protein interactions. For human coagulation factor IX it has been shown [] that the calcium-ligands form a pentagonal bipyramid. The first, third and fourth conserved negatively charged or polar residues are side chain ligands. The latter is possibly hydroxylated (see aspartic acid and asparagine hydroxylation site) []. A conserved aromatic residue, as well as the second conserved negative residue, are thought to be involved in stabilising the calcium-binding site. As in non-calcium binding EGF-like domains, there are six conserved cysteines and the structure of both types is very similar as calcium-binding induces only strictly local structural changes [].  +------------------+ +---------+ | | | | nxnnC-x(3,14)-C-x(3,7)-CxxbxxxxaxC-x(1,6)-C-x(8,13)-Cx | | +------------------+ 'n': negatively charged or polar residue [DEQN] 'b': possibly beta-hydroxylated residue [DN] 'a': aromatic amino acid 'C': cysteine, involved in disulphide bond 'x': any amino acid. ; GO: 0005509 calcium ion binding; PDB: 2VJ3_A 1TOZ_A 1LMJ_A 1UZQ_A 1UZK_A 1UZJ_B 1UZP_A 1EMO_A 1EMN_A 2RR0_A ....
Probab=34.47  E-value=24  Score=17.61  Aligned_cols=32  Identities=25%  Similarity=0.379  Sum_probs=23.1

Q ss_pred             cCCcccEEcCCC-eeeEeeCCCCCeeecCCCcC
Q psy11499         29 GDRERLITCVDG-HPRLISCGDGKLFDEASLTC   60 (70)
Q Consensus        29 ~dC~~yy~C~~G-~~~~~~Cp~Gl~Fd~~~~~C   60 (70)
                      ..|...-.|+|- -.+.=.|++|+..+.....|
T Consensus        10 ~~C~~~~~C~N~~Gsy~C~C~~Gy~~~~~~~~C   42 (42)
T PF07645_consen   10 HNCPENGTCVNTEGSYSCSCPPGYELNDDGTTC   42 (42)
T ss_dssp             SSSSTTSEEEEETTEEEEEESTTEEECTTSSEE
T ss_pred             CcCCCCCEEEcCCCCEEeeCCCCcEECCCCCcC
Confidence            468778888764 24455699999988777665


No 10 
>PF07422 s48_45:  Sexual stage antigen s48/45 domain;  InterPro: IPR010884 This family contains sexual stage s48/45 antigens from Plasmodium (approximately 450 residues long). These are surface proteins expressed by Plasmodium male and female gametes that have been shown to play a conserved and important role in fertilisation [].; PDB: 2LOE_A.
Probab=28.63  E-value=19  Score=21.28  Aligned_cols=9  Identities=56%  Similarity=1.427  Sum_probs=5.1

Q ss_pred             CCcccCCCC
Q psy11499          1 IVGFKCPDS    9 (70)
Q Consensus         1 ~~gf~CP~~    9 (70)
                      ++||.||.+
T Consensus        40 ~iG~~CP~~   48 (115)
T PF07422_consen   40 IIGFYCPKG   48 (115)
T ss_dssp             -EEEE--TT
T ss_pred             EEEEECCCC
Confidence            479999986


No 11 
>cd03529 Rieske_NirD Assimilatory nitrite reductase (NirD) family, Rieske domain; Assimilatory nitrate and nitrite reductases convert nitrate through nitrite to ammonium. Members include bacterial and fungal proteins. The bacterial NirD contains a single Rieske domain while fungal proteins have a C-terminal Rieske domain in addition to several other domains. The fungal NirD is involved in nutrient acquisition, functioning at the soil/fungus interface to control nutrient exchange between the fungus and the host plant. The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer. The Rieske [2Fe-2S] cluster is liganded to two histidine and two cysteine residues present in conserved sequences called Rieske motifs. In this family, only a few members contain these residues. Other members may have lost the ability to bind the Rieske [2Fe-2S] cluster.
Probab=27.04  E-value=92  Score=18.10  Aligned_cols=21  Identities=19%  Similarity=0.303  Sum_probs=18.0

Q ss_pred             EeeCC-CCCeeecCCCcCCCCC
Q psy11499         44 LISCG-DGKLFDEASLTCLGPE   64 (70)
Q Consensus        44 ~~~Cp-~Gl~Fd~~~~~C~~p~   64 (70)
                      .+.|| .|..||.+++.|..+.
T Consensus        63 ~i~Cp~Hg~~Fdl~tG~~~~~p   84 (103)
T cd03529          63 VVASPLYKQHFSLKTGRCLEDE   84 (103)
T ss_pred             EEECCCCCCEEEcCCCCccCCC
Confidence            68899 7999999999997653


No 12 
>PF04833 COBRA:  COBRA-like protein;  InterPro: IPR006918 In Arabidopsis thaliana (Mouse-ear cress) members of the family are all extracellular glycosyl-phosphatidyl inositol-anchored proteins (GPI-linked) []. The type example of the family is COBRA (Q94KT8 from SWISSPROT) and the family is generally annotated as COBRA-like (COBL). COBRA is involved in determining the orientation of cell expansion, probably by playing an important role in cellulose deposition. It may act by recruiting cellulose synthesizing complexes to discrete positions on the cell surface. Some members of this family are annotated as phytochelatin synthase, but these annotations are incorrect [].
Probab=26.71  E-value=65  Score=21.66  Aligned_cols=34  Identities=18%  Similarity=0.495  Sum_probs=27.6

Q ss_pred             CccCCcccE------EcCCCeeeEeeCCCCCeeecCCCcC
Q psy11499         27 VPGDRERLI------TCVDGHPRLISCGDGKLFDEASLTC   60 (70)
Q Consensus        27 ~p~dC~~yy------~C~~G~~~~~~Cp~Gl~Fd~~~~~C   60 (70)
                      +..||.+|+      .|=.-.+.+..=|+|.-+|.++..|
T Consensus        43 dqgdCs~~~~~~~~ph~C~k~P~IvDLpp~~~~n~qi~nC   82 (169)
T PF04833_consen   43 DQGDCSKFYKDGDFPHCCKKRPTIVDLPPGTPYNQQIGNC   82 (169)
T ss_pred             cCCcccccccCCCCCcccCCCCEEEeCCCCCCCccccccc
Confidence            677899988      6656678888889999999987766


No 13 
>smart00032 CCP Domain abundant in complement control proteins; SUSHI repeat; short complement-like repeat (SCR). The complement control protein (CCP) modules (also known as short  consensus repeats SCRs or SUSHI repeats) contain approximately 60 amino  acid residues and have been identified in several proteins of the  complement system. A missense mutation in seventh CCP domain causes  deficiency of the b subunit of factor XIII.
Probab=26.29  E-value=87  Score=15.16  Aligned_cols=24  Identities=17%  Similarity=0.405  Sum_probs=12.8

Q ss_pred             cEEcCCCee----eEeeCCCCCeeecCC
Q psy11499         34 LITCVDGHP----RLISCGDGKLFDEAS   57 (70)
Q Consensus        34 yy~C~~G~~----~~~~Cp~Gl~Fd~~~   57 (70)
                      -|.|..|..    ...+|..+-.|+...
T Consensus        27 ~~~C~~Gy~l~g~~~~~C~~~g~Ws~~~   54 (57)
T smart00032       27 TYSCNPGYTLIGSSTITCLEDGTWSPPA   54 (57)
T ss_pred             EEEcCCCCEEcCCCeeEECCCCEECCCC
Confidence            456665522    345666665565554


No 14 
>PHA02714 CD-30-like protein; Provisional
Probab=25.59  E-value=38  Score=21.13  Aligned_cols=20  Identities=10%  Similarity=0.165  Sum_probs=16.4

Q ss_pred             eeEeeCCCCCeeecCCCcCC
Q psy11499         42 PRLISCGDGKLFDEASLTCL   61 (70)
Q Consensus        42 ~~~~~Cp~Gl~Fd~~~~~C~   61 (70)
                      ....+|+.+.++|++...|.
T Consensus        19 sf~kqC~~dYY~Dpe~g~Ct   38 (110)
T PHA02714         19 SFGKTCPKDYYLEPEDGLCT   38 (110)
T ss_pred             hhhccCCCcccccCCCCcee
Confidence            44568999999999888775


No 15 
>PF08779 SARS_X4:  SARS coronavirus X4 like;  InterPro: IPR014888 The structure of the coronavirus X4 protein (also known as 7a and U122) shows similarities to the immunoglobulin like fold and suggests a binding activity to integrin I domains []. ; PDB: 1XAK_A 1YO4_A.
Probab=24.78  E-value=63  Score=19.07  Aligned_cols=20  Identities=30%  Similarity=0.607  Sum_probs=12.7

Q ss_pred             ccEEcCCCeeeE--eeCCCCCe
Q psy11499         33 RLITCVDGHPRL--ISCGDGKL   52 (70)
Q Consensus        33 ~yy~C~~G~~~~--~~Cp~Gl~   52 (70)
                      .|-.|+.|..++  ..||+|++
T Consensus         4 hyqecvrgttvllkepc~~~ty   25 (84)
T PF08779_consen    4 HYQECVRGTTVLLKEPCPSGTY   25 (84)
T ss_dssp             EEEEEETTSEEEEE-SSTT-EE
T ss_pred             hHHhHhcCceEEecCCCCCCCc
Confidence            366788886555  45888865


No 16 
>PF00220 Hormone_4:  Neurohypophysial hormones, N-terminal Domain;  InterPro: IPR022423 Oxytocin (or ocytocin) and vasopressin [] are small (nine amino acid residues), structurally and functionally related neurohypophysial peptide hormones. Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland while vasopressin has a direct antidiuretic action on the kidney and also causes vasoconstriction of the peripheral vessels. Like the majority of active peptides, both hormones are synthesized as larger protein precursors that are enzymatically converted to their mature forms. Peptides belonging to this family are also found in birds, fish, reptiles and amphibians (mesotocin, isotocin, valitocin, glumitocin, aspargtocin, vasotocin, seritocin, asvatocin, phasvatocin), in worms (annetocin), octopi (cephalotocin), locust (locupressin or neuropeptide F1/F2) and in molluscs (conopressins G and S) [].  The pattern developed to detect this category of peptides spans their entire sequence and includes four invariant amino acid residues.  .; GO: 0005185 neurohypophyseal hormone activity, 0005576 extracellular region
Probab=23.50  E-value=41  Score=12.16  Aligned_cols=6  Identities=33%  Similarity=0.623  Sum_probs=3.1

Q ss_pred             eeCCCC
Q psy11499         45 ISCGDG   50 (70)
Q Consensus        45 ~~Cp~G   50 (70)
                      ..||.|
T Consensus         4 ~nCP~G    9 (9)
T PF00220_consen    4 RNCPIG    9 (9)
T ss_pred             ccCCCC
Confidence            456544


No 17 
>PF12191 stn_TNFRSF12A:  Tumour necrosis factor receptor stn_TNFRSF12A_TNFR domain;  InterPro: IPR022316 The tumour necrosis factor (TNF) receptor (TNFR) superfamily comprises more than 20 type-I transmembrane proteins. Family members are defined based on similarity in their extracellular domain - a region that contains many cysteine residues arranged in a specific repetitive pattern []. The cysteines allow formation of an extended rod-like structure, responsible for ligand binding []. Upon receptor activation, different intracellular signalling complexes are assembled for different members of the TNFR superfamily, depending on their intracellular domains and sequences []. Activation of TNFRs can therefore induce a range of disparate effects, including cell proliferation, differentiation, survival, or apoptotic cell death, depending upon the receptor involved []. TNFRs are widely distributed and play important roles in many crucial biological processes, such as lymphoid and neuronal development, innate and adaptive immunity, and maintenance of cellular homeostasis []. Drugs that manipulate their signalling have potential roles in the prevention and treatment of many diseases, such as viral infections, coronary heart disease, transplant rejection, and immune disease []. TNF receptor 12 (also known as TWEAK receptor, and fibroblast growth factor-inducible-14 (Fn14)) has been implicated in endothelial cell growth and migration []. The receptor may also play a role in cell-matrix interactions [].; PDB: 2KN0_A 2RPJ_A 2KMZ_A 2EQP_A.
Probab=23.40  E-value=40  Score=21.74  Aligned_cols=20  Identities=20%  Similarity=0.524  Sum_probs=15.9

Q ss_pred             eeEeeCCCCCeeecCCCcCC
Q psy11499         42 PRLISCGDGKLFDEASLTCL   61 (70)
Q Consensus        42 ~~~~~Cp~Gl~Fd~~~~~C~   61 (70)
                      +....||.|..||+....|.
T Consensus        31 ~~~~~Cp~G~sWs~dLdkCm   50 (129)
T PF12191_consen   31 PGTTPCPRGSSWSADLDKCM   50 (129)
T ss_dssp             CSCSSS-SSEEEETTTTEEE
T ss_pred             CCCCCCCCCCcCcccccccc
Confidence            45678999999999988875


No 18 
>PF09207 Yeast-kill-tox:  Yeast killer toxin;  InterPro: IPR015290 Members of this entry, which are produced by Williopsis fungi, adopt a secondary structure consisting of eight strands in two beta sheets, in a Greek-key topology []. ; GO: 0008219 cell death, 0009405 pathogenesis, 0005576 extracellular region; PDB: 1WKT_A.
Probab=20.62  E-value=50  Score=19.40  Aligned_cols=16  Identities=19%  Similarity=0.247  Sum_probs=6.6

Q ss_pred             ecCCCcCCCCCCCCCC
Q psy11499         54 DEASLTCLGPEDYTDK   69 (70)
Q Consensus        54 d~~~~~C~~p~~v~~C   69 (70)
                      |+.+..|||..|-.-|
T Consensus        11 dpn~gscdwkqnwntc   26 (87)
T PF09207_consen   11 DPNSGSCDWKQNWNTC   26 (87)
T ss_dssp             -TTTS--B-S--TTS-
T ss_pred             CCCCCccchhccccee
Confidence            6788899998765443


Done!