Query         psy11507
Match_columns 113
No_of_seqs    108 out of 1034
Neff          6.2 
Searched_HMMs 46136
Date          Fri Aug 16 20:10:47 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy11507.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/11507hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd07170 NR_DBD_ERR DNA-binding  99.9 2.8E-25 6.2E-30  150.4   4.7   75   38-112     3-82  (97)
  2 cd06956 NR_DBD_RXR DNA-binding  99.9 3.5E-25 7.7E-30  144.0   4.8   71   41-111     2-77  (77)
  3 cd07160 NR_DBD_LXR DNA-binding  99.9   8E-25 1.7E-29  149.1   5.2   74   38-111    17-95  (101)
  4 cd07168 NR_DBD_DHR4_like DNA-b  99.9 6.4E-25 1.4E-29  146.7   4.5   76   37-112     4-84  (90)
  5 cd07155 NR_DBD_ER_like DNA-bin  99.9   9E-25 1.9E-29  141.4   4.6   70   42-111     1-75  (75)
  6 cd06961 NR_DBD_TR DNA-binding   99.9   1E-24 2.2E-29  144.3   4.3   72   41-112     1-77  (85)
  7 cd06959 NR_DBD_EcR_like The DN  99.9 1.5E-24 3.3E-29  139.7   4.7   67   41-107     1-72  (73)
  8 cd07173 NR_DBD_AR DNA-binding   99.9 2.6E-24 5.6E-29  141.7   5.8   70   39-108     3-77  (82)
  9 cd07172 NR_DBD_GR_PR DNA-bindi  99.9 2.1E-24 4.6E-29  140.8   5.2   67   39-105     2-73  (78)
 10 cd07171 NR_DBD_ER DNA-binding   99.9 1.8E-24   4E-29  142.3   4.8   71   39-109     3-78  (82)
 11 cd06964 NR_DBD_RAR DNA-binding  99.9   4E-25 8.6E-30  146.3   1.5   74   39-112     4-82  (85)
 12 cd07161 NR_DBD_EcR DNA-binding  99.9 2.5E-24 5.5E-29  144.2   4.9   71   40-110     2-77  (91)
 13 cd06970 NR_DBD_PNR DNA-binding  99.9 5.2E-25 1.1E-29  147.8   1.3   76   37-112     4-85  (92)
 14 cd06967 NR_DBD_TR2_like DNA-bi  99.9 5.7E-25 1.2E-29  146.1   1.3   75   38-112     2-81  (87)
 15 cd07164 NR_DBD_PNR_like_1 DNA-  99.9 3.5E-24 7.5E-29  139.6   3.9   71   42-112     1-76  (78)
 16 cd06969 NR_DBD_NGFI-B DNA-bind  99.9 1.3E-24 2.7E-29  140.8   1.3   69   40-108     1-74  (75)
 17 cd07179 2DBD_NR_DBD2 The secon  99.9 6.2E-24 1.3E-28  137.2   4.5   66   42-107     1-71  (74)
 18 cd07165 NR_DBD_DmE78_like DNA-  99.9 4.9E-24 1.1E-28  139.8   4.1   71   42-112     1-76  (81)
 19 cd06963 NR_DBD_GR_like The DNA  99.9 6.8E-24 1.5E-28  136.8   4.6   64   42-105     1-69  (73)
 20 cd07169 NR_DBD_GCNF_like DNA-b  99.9 6.7E-24 1.5E-28  141.8   4.4   73   39-111     6-83  (90)
 21 cd06958 NR_DBD_COUP_TF DNA-bin  99.9   6E-24 1.3E-28  136.9   4.0   66   42-107     1-71  (73)
 22 cd07156 NR_DBD_VDR_like The DN  99.9 4.1E-24   9E-29  137.3   3.3   65   42-106     1-70  (72)
 23 KOG4846|consensus               99.9 2.6E-24 5.7E-29  175.2   2.3   69   40-108   133-207 (538)
 24 cd06960 NR_DBD_HNF4A DNA-bindi  99.9 2.5E-24 5.5E-29  139.5   1.7   71   42-112     1-76  (76)
 25 cd07158 NR_DBD_Ppar_like The D  99.9 9.5E-24 2.1E-28  135.8   4.2   65   42-106     1-71  (73)
 26 cd07167 NR_DBD_Lrh-1_like The   99.9 6.9E-24 1.5E-28  142.6   3.6   70   42-111     1-75  (93)
 27 cd06966 NR_DBD_CAR DNA-binding  99.9 2.7E-24 5.8E-29  144.8   1.6   71   41-111     2-77  (94)
 28 cd07163 NR_DBD_TLX DNA-binding  99.9 2.6E-24 5.7E-29  144.3   1.0   75   38-112     5-86  (92)
 29 cd06962 NR_DBD_FXR DNA-binding  99.9 3.8E-24 8.2E-29  141.4   1.6   69   40-108     2-75  (84)
 30 cd06968 NR_DBD_ROR DNA-binding  99.9 1.1E-23 2.3E-28  142.2   3.8   74   39-112     5-83  (95)
 31 cd07157 2DBD_NR_DBD1 The first  99.9 3.3E-24 7.2E-29  142.2   1.2   71   41-111     2-79  (86)
 32 cd07162 NR_DBD_PXR DNA-binding  99.9 1.7E-23 3.7E-28  139.0   4.4   68   41-108     1-73  (87)
 33 smart00399 ZnF_C4 c4 zinc fing  99.9 1.5E-23 3.1E-28  133.8   3.3   64   41-104     1-69  (70)
 34 cd06955 NR_DBD_VDR DNA-binding  99.9   1E-23 2.2E-28  145.0   2.6   69   38-106     5-78  (107)
 35 cd07154 NR_DBD_PNR_like The DN  99.9 4.7E-24   1E-28  137.3   0.9   66   42-107     1-72  (73)
 36 cd06916 NR_DBD_like DNA-bindin  99.9 4.3E-24 9.3E-29  137.2   0.3   66   42-107     1-71  (72)
 37 PF00105 zf-C4:  Zinc finger, C  99.9 2.4E-23 5.1E-28  132.5   3.7   65   40-104     1-70  (70)
 38 cd07166 NR_DBD_REV_ERB DNA-bin  99.9 7.8E-24 1.7E-28  141.2   1.5   73   40-112     4-82  (89)
 39 cd06957 NR_DBD_PNR_like_2 DNA-  99.9 3.1E-24 6.7E-29  141.1  -0.7   71   42-112     1-77  (82)
 40 KOG4215|consensus               99.9 4.6E-23   1E-27  165.8   4.5   75   38-112    18-97  (432)
 41 cd06965 NR_DBD_Ppar DNA-bindin  99.9 3.8E-23 8.2E-28  136.5   2.2   70   41-112     1-76  (84)
 42 KOG4217|consensus               99.9 3.4E-22 7.3E-27  164.9   4.1   73   38-110   268-345 (605)
 43 KOG4216|consensus               99.8   8E-22 1.7E-26  159.7   3.5   70   39-108    46-120 (479)
 44 KOG4218|consensus               99.8 5.1E-20 1.1E-24  147.8   3.3   74   38-111    14-92  (475)
 45 PF01412 ArfGap:  Putative GTPa  73.3     1.9   4E-05   29.5   1.1   31   38-68     12-45  (116)
 46 smart00105 ArfGap Putative GTP  57.7     7.9 0.00017   26.2   1.8   31   39-69      3-36  (112)
 47 PTZ00218 40S ribosomal protein  48.0      16 0.00035   22.2   1.9   27   36-62     13-40  (54)
 48 PRK00420 hypothetical protein;  39.4      10 0.00023   26.2   0.1   27   39-65     23-49  (112)
 49 smart00401 ZnF_GATA zinc finge  38.3      20 0.00044   21.1   1.3   31   39-69      3-38  (52)
 50 PRK04179 rpl37e 50S ribosomal   37.5      28  0.0006   21.8   1.8   25   37-63     15-39  (62)
 51 PF10013 DUF2256:  Uncharacteri  31.3      31 0.00068   19.9   1.2   14   35-48      4-17  (42)
 52 PF00320 GATA:  GATA zinc finge  29.6      33 0.00072   18.6   1.1   16   54-69     17-33  (36)
 53 KOG3506|consensus               29.5      33 0.00071   21.0   1.2   30   34-63     13-43  (56)
 54 PF03107 C1_2:  C1 domain;  Int  29.1      20 0.00044   18.6   0.2   21   41-63      2-22  (30)
 55 COG2126 RPL37A Ribosomal prote  28.6      31 0.00068   21.4   1.0   35   26-63      4-38  (61)
 56 PF10764 Gin:  Inhibitor of sig  28.2      44 0.00096   19.4   1.5   24   41-64      1-26  (46)
 57 KOG0706|consensus               28.0      28  0.0006   29.6   0.9   31   38-68     22-55  (454)
 58 PF09889 DUF2116:  Uncharacteri  27.0      31 0.00068   21.2   0.8   32   38-72      2-34  (59)
 59 COG5347 GTPase-activating prot  26.5      29 0.00063   28.1   0.7   31   38-68     19-52  (319)
 60 cd00729 rubredoxin_SM Rubredox  25.3      29 0.00063   18.7   0.4   14   38-51     17-30  (34)
 61 PHA03124 dUTPase; Provisional   23.9      44 0.00096   28.1   1.3   15   57-71    191-205 (418)
 62 COG4068 Uncharacterized protei  23.6      53  0.0012   20.5   1.4   14   35-48      4-17  (64)
 63 PF10705 Ycf15:  Chloroplast pr  23.4      25 0.00055   23.4  -0.1    7    1-7      33-39  (93)
 64 PF00357 Integrin_alpha:  Integ  20.3      50  0.0011   15.0   0.6    9   64-72      3-11  (15)
 65 PF11781 RRN7:  RNA polymerase   20.2      43 0.00094   18.4   0.4   24   39-62      8-31  (36)
 66 PF13901 DUF4206:  Domain of un  20.1      35 0.00077   25.4   0.1   34   40-73    153-189 (202)

No 1  
>cd07170 NR_DBD_ERR DNA-binding domain of estrogen related receptors (ERR) is composed of two C4-type zinc fingers. DNA-binding domain of estrogen related receptors (ERRs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. ERR interacts with the palindromic inverted repeat, 5'GGTCAnnnTGACC-3', upstream of the target gene and modulates the rate of transcriptional initiation. The estrogen receptor-related receptors (ERRs) are transcriptional regulators, which are closely related to the estrogen receptor (ER) family.  Although ERRs lack the ability to bind to estrogen and are so-called orphan receptors, they share target genes, co-regulators and promoters with the estrogen receptor (ER) family. By targeting the same set of genes, ERRs seem to interfere with the classic ER-mediated estrogen response in various ways. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription 
Probab=99.91  E-value=2.8e-25  Score=150.36  Aligned_cols=75  Identities=51%  Similarity=0.746  Sum_probs=67.0

Q ss_pred             CCCcceEcCCCCcceeechhcchhhHHHHHHhHhhccceecCCCCCCCC-----CCCcchHHhHhHHhcCCccchhhccC
Q psy11507         38 PRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLRGHEPQK-----KSSQIPKEKYNLAYLMSDSLDTTNRF  112 (113)
Q Consensus        38 ~~~~C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~~C~~~~~c~~-----~~C~~CR~~kcl~~GM~~~~~~~~~~  112 (113)
                      +..+|.||++++.|+||||.+|++|++||||++.....|.|..++.|.+     ..|++|||+|||+|||..+..+..|.
T Consensus         3 ~~~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~v~~~~~~~C~~~~~C~i~~~~r~~Cr~CRl~KCl~vGM~~~~vq~~r~   82 (97)
T cd07170           3 PKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRV   82 (97)
T ss_pred             CCCCCeecCCcCcceEECceeehhhhHHHHHHhccCCceeecCCCccccCcccCccCCccccchhhhcCCCHHHcccccC
Confidence            3456999999999999999999999999999999998999998888853     47999999999999999987777663


No 2  
>cd06956 NR_DBD_RXR DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers. DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. RXR functions as a DNA binding partner by forming heterodimers with other nuclear receptors including CAR, FXR, LXR, PPAR, PXR, RAR, TR, and VDR. All RXR heterodimers preferentially bind response elements composed of direct repeats of two AGGTCA sites with a 1-5 bp spacer.  RXRs can play different roles in these heterodimers. RXR  acts either as a structural component of the heterodimer complex, required for DNA binding but not acting as a receptor, or as both a structural and a functional component of the heterodimer, allowing 9-cis RA to signal through the corresponding heterodimer. In addition, RXR can also form homodimers, functioning as a receptor for 9-cis RA, independently of other nuclear rec
Probab=99.91  E-value=3.5e-25  Score=144.01  Aligned_cols=71  Identities=37%  Similarity=0.598  Sum_probs=64.9

Q ss_pred             cceEcCCCCcceeechhcchhhHHHHHHhHhhccceecCCCCCCCC-----CCCcchHHhHhHHhcCCccchhhcc
Q psy11507         41 LCLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLRGHEPQK-----KSSQIPKEKYNLAYLMSDSLDTTNR  111 (113)
Q Consensus        41 ~C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~~C~~~~~c~~-----~~C~~CR~~kcl~~GM~~~~~~~~~  111 (113)
                      +|.||+++++++||||.+|++|++||||++..+..|.|..++.|.+     ..|++|||+|||++||..+..+..|
T Consensus         2 ~C~VC~~~~~g~hygv~sC~aC~~FFRR~v~~~~~~~C~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~v~~~r   77 (77)
T cd06956           2 ICAICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEER   77 (77)
T ss_pred             CCcccCCcCcceEECceeehhHHHHHHHHhhCCCccccCCCCccccCCCccccCccchhHHHhHhCCCHHHhccCC
Confidence            5999999999999999999999999999999999999998888853     4799999999999999998777655


No 3  
>cd07160 NR_DBD_LXR DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers. DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. LXR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  LXR operates as cholesterol sensor which protects cells from cholesterol overload by stimulating reverse cholesterol transport from peripheral tissues to the liver and its excretion in the bile. Oxidized cholesterol derivatives or oxysterols were identified as specific ligands for LXRs. LXR functions as a heterodimer with the retinoid X receptor (RXR) which may be activated by either LXR agonist or 9-cis retinoic acid, a specific RXR ligand. The LXR/RXR complex binds to a liver X receptor response element (LXRE) in the promoter region of target genes. The ideal LXRE seq
Probab=99.91  E-value=8e-25  Score=149.13  Aligned_cols=74  Identities=35%  Similarity=0.576  Sum_probs=66.1

Q ss_pred             CCCcceEcCCCCcceeechhcchhhHHHHHHhHhhccceecCCCCCCCC-----CCCcchHHhHhHHhcCCccchhhcc
Q psy11507         38 PRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLRGHEPQK-----KSSQIPKEKYNLAYLMSDSLDTTNR  111 (113)
Q Consensus        38 ~~~~C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~~C~~~~~c~~-----~~C~~CR~~kcl~~GM~~~~~~~~~  111 (113)
                      ...+|.||+++++++||||.+|++|++||||++.....|.|..++.|.+     ..|++|||+|||++||+.+..+..|
T Consensus        17 ~~~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~v~~~~~~~C~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~V~~~~   95 (101)
T cd07160          17 GNEVCSVCGDKASGFHYNVLSCEGCKGFFRRSVIKGAQYVCKNGGKCQMDMYMRRKCQECRLRKCREAGMREQCVLSEE   95 (101)
T ss_pred             CCCCCeecCCcCcceEECcceehhhhhhhhhcccccCccccCCCCccccCCcccccCccchhHHHHHhCCCHHHhcChh
Confidence            3567999999999999999999999999999999999999998888853     4799999999999999998765543


No 4  
>cd07168 NR_DBD_DHR4_like DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers. DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. This domain interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Ecdysone-induced orphan receptor DHR4 is a member of the nuclear receptor family. DHR4 is expressed during the early Drosophila larval development and is induced by ecdysone. DHR4 coordinates growth and maturation in Drosophila by mediating endocrine response to the attainment of proper body size during larval development. Mutations in DHR4 result in shorter larval development which translates into smaller and lighter flies. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, DHR4
Probab=99.91  E-value=6.4e-25  Score=146.73  Aligned_cols=76  Identities=29%  Similarity=0.534  Sum_probs=68.0

Q ss_pred             CCCCcceEcCCCCcceeechhcchhhHHHHHHhHhhccceecCCCCCCCC-----CCCcchHHhHhHHhcCCccchhhcc
Q psy11507         37 LPRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLRGHEPQK-----KSSQIPKEKYNLAYLMSDSLDTTNR  111 (113)
Q Consensus        37 ~~~~~C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~~C~~~~~c~~-----~~C~~CR~~kcl~~GM~~~~~~~~~  111 (113)
                      ....+|.||+++++++||||.+|++|++||||++..+..|.|..++.|.+     ..|++|||+|||++||.....+..|
T Consensus         4 ~~~~~C~VCg~~~~g~hyGv~sC~aCk~FFRR~v~~~~~~~C~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~V~~~R   83 (90)
T cd07168           4 ESPKLCSICEDKATGLHYGIITCEGCKGFFKRTVQNKRVYTCVGDGRCEITKAQRNRCQYCRFRKCIRKGMMLAAVREDR   83 (90)
T ss_pred             ccCCCCcccCCcCcceEECceehhhhhHhhhhhhcCCCCccCCCCCCccccccccccccccchhhhhhcCCCHHHhhccc
Confidence            34567999999999999999999999999999999988999998888853     4799999999999999998877776


Q ss_pred             C
Q psy11507        112 F  112 (113)
Q Consensus       112 ~  112 (113)
                      .
T Consensus        84 ~   84 (90)
T cd07168          84 M   84 (90)
T ss_pred             C
Confidence            4


No 5  
>cd07155 NR_DBD_ER_like DNA-binding domain of estrogen receptor (ER) and estrogen related receptors (ERR) is composed of two C4-type zinc fingers. DNA-binding domains of estrogen receptor (ER) and estrogen related receptors (ERR) are composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. ER and ERR interact with the palindromic inverted repeat, 5'GGTCAnnnTGACC-3', upstream of the target gene and modulate the rate of transcriptional initiation. ERR and ER are closely related and share sequence similarity, target genes, co-regulators and promoters. While ER is activated by endogenous estrogen, ERR lacks the ability to bind to estrogen. Estrogen receptor mediates the biological effects of hormone estrogen by the binding of the receptor dimer to estrogen response element of target genes.  However, ERRs seem to interfere with the classic ER-mediated estrogen responsive signaling by targeting the same set of genes. E
Probab=99.91  E-value=9e-25  Score=141.41  Aligned_cols=70  Identities=50%  Similarity=0.723  Sum_probs=63.8

Q ss_pred             ceEcCCCCcceeechhcchhhHHHHHHhHhhccceecCCCCCCCC-----CCCcchHHhHhHHhcCCccchhhcc
Q psy11507         42 CLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLRGHEPQK-----KSSQIPKEKYNLAYLMSDSLDTTNR  111 (113)
Q Consensus        42 C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~~C~~~~~c~~-----~~C~~CR~~kcl~~GM~~~~~~~~~  111 (113)
                      |.||+++++++||||.+|++|++||||++..+..|.|..++.|.+     ..|++|||+|||++||+.+..+.+|
T Consensus         1 C~VC~~~~~g~hygv~sC~aCk~FFRR~~~~~~~~~C~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~v~~~r   75 (75)
T cd07155           1 CLVCGDIASGYHYGVASCEACKAFFKRTIQGNLGYSCPSTSECEVDKKRRKSCQACRLQKCLKVGMLKEGVRLDR   75 (75)
T ss_pred             CcccCccCcceEEChhhhhhhHHHHHHHhhCCCceeCCcCCCcccCCcccccCccchhhhhhHhCCCHHHcccCC
Confidence            789999999999999999999999999999999999998888853     4799999999999999998776655


No 6  
>cd06961 NR_DBD_TR DNA-binding domain of thyroid hormone receptors (TRs) is composed of two C4-type zinc fingers. DNA-binding domain of thyroid hormone receptors (TRs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. TR interacts with the thyroid response element, which is a DNA site with direct repeats of the consensus sequence 5'-AGGTCA-3' separated by one to five base pairs, upstream of target genes and modulates the rate of transcriptional initiation. Thyroid hormone receptor (TR) mediates the actions of thyroid hormones, which play critical roles in growth, development, and homeostasis in mammals. They regulate overall metabolic rate, cholesterol and triglyceride levels, and heart rate, and affect mood. TRs are expressed from two separate genes (alpha and beta) in human and each gene generates two isoforms of the receptor through differential promoter usage or splicing. TRalpha functions in the he
Probab=99.90  E-value=1e-24  Score=144.34  Aligned_cols=72  Identities=35%  Similarity=0.581  Sum_probs=65.3

Q ss_pred             cceEcCCCCcceeechhcchhhHHHHHHhHhhccceecCCCCCCCC-----CCCcchHHhHhHHhcCCccchhhccC
Q psy11507         41 LCLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLRGHEPQK-----KSSQIPKEKYNLAYLMSDSLDTTNRF  112 (113)
Q Consensus        41 ~C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~~C~~~~~c~~-----~~C~~CR~~kcl~~GM~~~~~~~~~~  112 (113)
                      +|.||++.++++||||.+|++|++||||++..+..|.|..++.|.+     ..|++|||+|||++||+++..+..|.
T Consensus         1 ~C~VCg~~~~g~hygv~sC~aC~~FFRR~v~~~~~~~C~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~v~~~r~   77 (85)
T cd06961           1 PCVVCGDKATGYHYRCITCEGCKGFFRRTVQKKLSYSCKGEGKCEIDKVTRNQCQECRFKKCIAVGMAKDLVLDDRK   77 (85)
T ss_pred             CCceeCCcCcceEEChhhhhhhhHhhHhhhccCCccccCCCCccccCccccccCccchhhhhhhccCCHHHcccccC
Confidence            4999999999999999999999999999999999999998888853     47999999999999999987776653


No 7  
>cd06959 NR_DBD_EcR_like The DNA-binding domain of Ecdysone receptor (EcR) like nuclear receptor family is composed of two C4-type zinc fingers. The DNA-binding domain of Ecdysone receptor (EcR) like nuclear receptor family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. EcR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. This family includes three types of nuclear receptors: Ecdysone receptor (EcR), Liver X receptor (LXR) and Farnesoid X receptor (FXR). The DNA binding activity is regulated by their corresponding ligands. The ligands for EcR are ecdysteroids; LXR is regulated by oxidized cholesterol derivatives or oxysterols; and bile acids control FXR's activities. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, EcR-like receptors have  a central well conserved DNA binding domai
Probab=99.90  E-value=1.5e-24  Score=139.70  Aligned_cols=67  Identities=39%  Similarity=0.629  Sum_probs=61.3

Q ss_pred             cceEcCCCCcceeechhcchhhHHHHHHhHhhccceecCCCCCCCC-----CCCcchHHhHhHHhcCCccch
Q psy11507         41 LCLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLRGHEPQK-----KSSQIPKEKYNLAYLMSDSLD  107 (113)
Q Consensus        41 ~C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~~C~~~~~c~~-----~~C~~CR~~kcl~~GM~~~~~  107 (113)
                      +|.||+++++++||||.+|++|++||||++..+..|.|..++.|.+     ..|++|||+|||++||.++..
T Consensus         1 ~C~vCg~~~~~~hygv~sC~aC~~FFRR~v~~~~~~~C~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~v   72 (73)
T cd06959           1 NCVVCGDKASGFHYGVLSCEGCKGFFRRSVTKGAVYACKFGNKCEMDMYMRRKCQECRLRKCKAAGMRPDCL   72 (73)
T ss_pred             CCceeCCcCcceEECceeehhhHHHHHHhhcCCCCccCCCCCcCCcCCcccccCccchhHHHHHhCCChhhc
Confidence            5999999999999999999999999999999889999998888853     479999999999999998753


No 8  
>cd07173 NR_DBD_AR DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers. DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. To regulate gene expression, AR interacts with a palindrome of the core sequence 5'-TGTTCT-3' with a 3-bp spacer. It also binds to the direct repeat  5'-TGTTCT-3' hexamer in some androgen controlled genes. AR is activated by the androgenic hormones, testosterone or dihydrotestosterone, which are responsible for primary and for secondary male characteristics, respectively. The primary mechanism of action of ARs is by direct regulation of gene transcription. The binding of androgen results in a conformational change in the androgen receptor which causes its transport from the cytosol into the cell nucleus, and dimerization. The receptor dimer binds to a hormone response element of AR regulated genes and modul
Probab=99.90  E-value=2.6e-24  Score=141.69  Aligned_cols=70  Identities=29%  Similarity=0.567  Sum_probs=63.1

Q ss_pred             CCcceEcCCCCcceeechhcchhhHHHHHHhHhhccceecCCCCCCCC-----CCCcchHHhHhHHhcCCccchh
Q psy11507         39 RRLCLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLRGHEPQK-----KSSQIPKEKYNLAYLMSDSLDT  108 (113)
Q Consensus        39 ~~~C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~~C~~~~~c~~-----~~C~~CR~~kcl~~GM~~~~~~  108 (113)
                      ..+|.||+++++++||||.+|++|++||||++..+..|.|..++.|.+     ..|++|||+|||++||......
T Consensus         3 ~~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~v~~~~~~~C~~~~~C~i~~~~r~~Cr~CRl~KCl~vGM~~~~~~   77 (82)
T cd07173           3 QKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCFEAGMTLGARK   77 (82)
T ss_pred             CCCCeecCCcCcceEECcchhhhHHHHHHHHhcCCCceecCCCCccccCCCccCcCcchhhhhhhhcCCCcChHH
Confidence            456999999999999999999999999999999999999998888853     4799999999999999987544


No 9  
>cd07172 NR_DBD_GR_PR DNA-binding domain of glucocorticoid receptor (GR) is composed of two C4-type zinc fingers. DNA-binding domains of glucocorticoid receptor (GR) and progesterone receptor (PR) are composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinate  a single zinc atom. The DBD from both receptors interact with the same hormone response element (HRE), which is an imperfect palindrome GGTACAnnnTGTTCT, upstream of target genes and modulates the rate of transcriptional initiation. GR is a transcriptional regulator that mediates the biological effects of glucocorticoids and PR regulates genes controlled by progesterone. GR is expressed in almost every cell in the body and regulates genes controlling a wide variety of processes including the development, metabolism, and immune response of the organism. PR functions in a variety of biological processes including development of the mammary gland, regulating cell cycle progression, p
Probab=99.90  E-value=2.1e-24  Score=140.82  Aligned_cols=67  Identities=33%  Similarity=0.618  Sum_probs=61.4

Q ss_pred             CCcceEcCCCCcceeechhcchhhHHHHHHhHhhccceecCCCCCCCC-----CCCcchHHhHhHHhcCCcc
Q psy11507         39 RRLCLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLRGHEPQK-----KSSQIPKEKYNLAYLMSDS  105 (113)
Q Consensus        39 ~~~C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~~C~~~~~c~~-----~~C~~CR~~kcl~~GM~~~  105 (113)
                      ..+|.||+++++++||||.+|++|++||||++..+..|.|..++.|.+     ..|++|||+|||++||...
T Consensus         2 ~~~C~VCg~~a~g~hyGv~sC~aC~~FFRR~v~~~~~~~C~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~   73 (78)
T cd07172           2 QKICLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRLRKCLQAGMNLG   73 (78)
T ss_pred             CCCCeecCCcCcceEECceeehhhHHhHHHHeeCCCceeCCCCCccccCCcccccCccchhHHHHHhCCCcc
Confidence            457999999999999999999999999999999999999998888853     4799999999999999875


No 10 
>cd07171 NR_DBD_ER DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers. DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. ER interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Estrogen receptor is a transcription regulator that mediates the biological effects of hormone estrogen. The binding of estrogen to the receptor triggers the dimerization and the binding of the receptor dimer to estrogen response element, which is a palindromic inverted repeat: 5'GGTCAnnnTGACC-3', of target genes. Through ER, estrogen regulates development, reproduction and homeostasis. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, ER  has  a central well-conserved DNA binding domain (DBD), a variable N-terminal domain, a non-conserv
Probab=99.90  E-value=1.8e-24  Score=142.35  Aligned_cols=71  Identities=38%  Similarity=0.583  Sum_probs=63.8

Q ss_pred             CCcceEcCCCCcceeechhcchhhHHHHHHhHhhccceecCCCCCCCC-----CCCcchHHhHhHHhcCCccchhh
Q psy11507         39 RRLCLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLRGHEPQK-----KSSQIPKEKYNLAYLMSDSLDTT  109 (113)
Q Consensus        39 ~~~C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~~C~~~~~c~~-----~~C~~CR~~kcl~~GM~~~~~~~  109 (113)
                      ..+|.||+++++++||||.+|++|++||||++.....|.|..++.|.+     ..|++|||+|||++||.++....
T Consensus         3 ~~~C~VCg~~~~g~hyGv~sC~aC~~FFRR~v~~~~~~~C~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~v~~   78 (82)
T cd07171           3 THFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRR   78 (82)
T ss_pred             CCCCeecCCcCcceEECceeehhhHHhHHHHeeCCCceeCCCCCccccCCcccccCccchhHHHhHhcCCHHHHHH
Confidence            356999999999999999999999999999999999999998888853     47999999999999999975544


No 11 
>cd06964 NR_DBD_RAR DNA-binding domain of retinoic acid receptor (RAR) is composed of two C4-type zinc fingers. DNA-binding domain of retinoic acid receptor (RAR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. RAR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. RARs mediate the biological effect of retinoids, including both natural dietary vitamin A (retinol) metabolites and active synthetic analogs. Retinoids play key roles in a wide variety of essential biological processes, such as vertebrate embryonic morphogenesis and organogenesis, differentiation and apoptosis, and homeostasis. RAR function as a heterodimer with retinoic X receptor by binding to specific RAR response elements (RAREs), which are composed of two direct repeats of the consensus sequence 5'-AGGTCA-3' separated by one to five base pair and found in the promoter reg
Probab=99.90  E-value=4e-25  Score=146.34  Aligned_cols=74  Identities=32%  Similarity=0.568  Sum_probs=66.7

Q ss_pred             CCcceEcCCCCcceeechhcchhhHHHHHHhHhhccceecCCCCCCCC-----CCCcchHHhHhHHhcCCccchhhccC
Q psy11507         39 RRLCLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLRGHEPQK-----KSSQIPKEKYNLAYLMSDSLDTTNRF  112 (113)
Q Consensus        39 ~~~C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~~C~~~~~c~~-----~~C~~CR~~kcl~~GM~~~~~~~~~~  112 (113)
                      ..+|.||+++++++||||.+|++|++||||++.....|.|..++.|.+     ..|++|||+|||++||.++..+..|.
T Consensus         4 ~~~C~VCg~~~~g~hyGv~sC~aC~~FFRR~v~~~~~~~C~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~v~~~R~   82 (85)
T cd06964           4 YKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRN   82 (85)
T ss_pred             CCCCcccCCcCcccEECcceeeeeeeEEeeeecCCCCeECCCCCccccCCcccccCccchhhhhhhhCCCHHHhhcccc
Confidence            357999999999999999999999999999999888899998888853     47999999999999999988877764


No 12 
>cd07161 NR_DBD_EcR DNA-binding domain of Ecdysone receptor (ECR) family is composed of two C4-type zinc fingers. DNA-binding domain of Ecdysone receptor (EcR) family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. EcR interacts with highly degenerate pseudo-palindromic response elements, resembling inverted repeats of 5'-AGGTCA-3' separated by 1 bp, upstream of the target gene and modulates the rate of transcriptional initiation. EcR is present only in invertebrates and regulates the expression of a large number of genes during development and reproduction. EcR functions as a heterodimer by partnering with ultraspiracle protein (USP), the ortholog of the vertebrate retinoid X receptor (RXR). The natural ligands of EcR are ecdysteroids, the endogenous steroidal hormones found in invertebrates. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, EcRs h
Probab=99.90  E-value=2.5e-24  Score=144.17  Aligned_cols=71  Identities=35%  Similarity=0.611  Sum_probs=64.1

Q ss_pred             CcceEcCCCCcceeechhcchhhHHHHHHhHhhccceecCCCCCCCC-----CCCcchHHhHhHHhcCCccchhhc
Q psy11507         40 RLCLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLRGHEPQK-----KSSQIPKEKYNLAYLMSDSLDTTN  110 (113)
Q Consensus        40 ~~C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~~C~~~~~c~~-----~~C~~CR~~kcl~~GM~~~~~~~~  110 (113)
                      .+|.||+++++++||||.+|++|++||||++.....|.|..++.|.+     ..|++|||+|||++||++...+..
T Consensus         2 ~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~v~~~~~~~C~~~~~C~i~~~~r~~Cr~CRl~KCl~vGM~~~~v~~~   77 (91)
T cd07161           2 ELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKSAVYHCKYGRACEMDMYMRRKCQECRLKKCLSVGMRPECVVPE   77 (91)
T ss_pred             CCCeeCCCcCcceEECceeehhhHHHHHHHhccCCceecCCCCccccCccccccCccchhhHHhHcCCCHHHcCch
Confidence            35999999999999999999999999999999999999998888853     479999999999999999866554


No 13 
>cd06970 NR_DBD_PNR DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) is composed of two C4-type zinc fingers. DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. PNR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  PNR is a member of the nuclear receptor superfamily of the ligand-activated transcription factors. PNR is expressed only in the outer layer of retinal photoreceptor cells. It may be involved in the signaling pathway regulating photoreceptor differentiation and/or maintenance. It most likely binds to DNA as a homodimer. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, PNR  has  a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hing
Probab=99.90  E-value=5.2e-25  Score=147.81  Aligned_cols=76  Identities=32%  Similarity=0.518  Sum_probs=66.9

Q ss_pred             CCCCcceEcCCCCcceeechhcchhhHHHHHHhHhhccceecCCC-CCCCC-----CCCcchHHhHhHHhcCCccchhhc
Q psy11507         37 LPRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLRG-HEPQK-----KSSQIPKEKYNLAYLMSDSLDTTN  110 (113)
Q Consensus        37 ~~~~~C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~~C~~~-~~c~~-----~~C~~CR~~kcl~~GM~~~~~~~~  110 (113)
                      .+..+|.||+++++++|||+.+|++|++||||++..+..|.|..+ +.|.+     ..|++|||+|||++||..+..+..
T Consensus         4 ~p~~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~v~~~~~~~C~~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~V~~~   83 (92)
T cd06970           4 NPGLLCRVCGDTSSGKHYGIYACNGCSGFFKRSVRRKLIYRCQAGTGMCPVDKAHRNQCQACRLKKCLQAGMNKDAVQNE   83 (92)
T ss_pred             CCCCCCeecCCcCcccEECccEEeeeeeEeeeeeecCCCceeecCCCcCccCCCccccCccchhhHhhHhCCCHHHcccc
Confidence            345579999999999999999999999999999999999999885 67753     479999999999999999877766


Q ss_pred             cC
Q psy11507        111 RF  112 (113)
Q Consensus       111 ~~  112 (113)
                      |+
T Consensus        84 R~   85 (92)
T cd06970          84 RQ   85 (92)
T ss_pred             cC
Confidence            64


No 14 
>cd06967 NR_DBD_TR2_like DNA-binding domain of the TR2 and TR4 (human testicular receptor 2 and 4) is composed of two C4-type zinc fingers. DNA-binding domain of the TR2 and TR4 (human testicular receptor 2 and 4) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. TR2 and TR4 interact with specific DNA sites upstream of the target gene and modulate the rate of transcriptional initiation. TR4 and TR2 are orphan nuclear receptors; the physiological ligand is as yet unidentified. TR2 is abundantly expressed in the androgen-sensitive prostate. TR4 transcripts are expressed in many tissues, including central nervous system, adrenal gland, spleen, thyroid gland, and prostate. It has been shown that human TR2 binds to a wide spectrum of natural hormone response elements (HREs) with distinct affinities suggesting that TR2 may cross-talk with other gene expression regulation systems. The genes responding to TR2 or
Probab=99.90  E-value=5.7e-25  Score=146.14  Aligned_cols=75  Identities=37%  Similarity=0.584  Sum_probs=67.7

Q ss_pred             CCCcceEcCCCCcceeechhcchhhHHHHHHhHhhccceecCCCCCCCC-----CCCcchHHhHhHHhcCCccchhhccC
Q psy11507         38 PRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLRGHEPQK-----KSSQIPKEKYNLAYLMSDSLDTTNRF  112 (113)
Q Consensus        38 ~~~~C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~~C~~~~~c~~-----~~C~~CR~~kcl~~GM~~~~~~~~~~  112 (113)
                      |..+|.||++.+.++||||.+|++|++||||++..+..|.|..++.|.+     ..|++|||+|||++||+....+..|+
T Consensus         2 ~~~~C~VCg~~~~g~hyGv~sC~aC~~FFRR~v~~~~~~~C~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~Vq~~R~   81 (87)
T cd06967           2 PVELCVVCGDKASGRHYGAVSCEGCKGFFKRSIRKNLGYSCRGSKDCVINKHHRNRCQYCRLQKCLAMGMKSDSVQCERK   81 (87)
T ss_pred             CCCCCeecCCcCCcCEeCcceEeeeeeEeeeeeeCCCCcccCCCCccccCccccccCccchhhhhhHcCCCHHHhccccC
Confidence            4567999999999999999999999999999999888999998888853     47999999999999999988877764


No 15 
>cd07164 NR_DBD_PNR_like_1 DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like proteins is composed of two C4-type zinc fingers. DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like proteins is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. PNR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  PNR is a member of nuclear receptor superfamily of the ligand-activated transcription factors. PNR is expressed only in the outer layer of retinal photoreceptor cells. It may be involved in the signaling pathway regulating photoreceptor differentiation and/or maintenance. It most likely binds to DNA as a homodimer. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, PNR  has  a central well conserved DNA binding domain (DBD), a variable N-t
Probab=99.89  E-value=3.5e-24  Score=139.58  Aligned_cols=71  Identities=37%  Similarity=0.575  Sum_probs=64.9

Q ss_pred             ceEcCCCCcceeechhcchhhHHHHHHhHhhccceecCCCCCCCC-----CCCcchHHhHhHHhcCCccchhhccC
Q psy11507         42 CLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLRGHEPQK-----KSSQIPKEKYNLAYLMSDSLDTTNRF  112 (113)
Q Consensus        42 C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~~C~~~~~c~~-----~~C~~CR~~kcl~~GM~~~~~~~~~~  112 (113)
                      |.||+++++++||||.+|++|++||||++..+..|.|..++.|.+     ..|++|||+|||+|||.....+..|.
T Consensus         1 C~VCg~~~~g~hyG~~~C~~C~~FFRR~~~~~~~~~C~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~v~~~r~   76 (78)
T cd07164           1 CRVCGDRASGKHYGVPSCDGCRGFFKRSIRRNLAYVCKENGSCVVDVARRNQCQACRFKKCLQVNMNRDAVQHERA   76 (78)
T ss_pred             CcccCccCcceEECcchhhhhhhhhhhhccCCCCccCCCCCcccccCcccccCccchhhhhhHhcCCHHHhccCCC
Confidence            789999999999999999999999999999889999998888853     47999999999999999988777664


No 16 
>cd06969 NR_DBD_NGFI-B DNA-binding domain of the orphan nuclear receptor, nerve growth factor-induced-B. DNA-binding domain (DBD) of the orphan nuclear receptor, nerve growth factor-induced-B (NGFI-B) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. NGFI-B interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. NGFI-B is a member of the nuclear-steroid receptor superfamily. NGFI-B is classified as an orphan receptor because no ligand has yet been identified. NGFI-B is an early immediate gene product of embryo development that is rapidly produced in response to a variety of cellular signals including nerve growth factor. It is involved in T-cell-mediated apoptosis, as well as neuronal differentiation and function. NGFI-B regulates transcription by binding to a specific DNA target upstream of its target genes and regulating the rate of transcrip
Probab=99.89  E-value=1.3e-24  Score=140.79  Aligned_cols=69  Identities=39%  Similarity=0.605  Sum_probs=62.2

Q ss_pred             CcceEcCCCCcceeechhcchhhHHHHHHhHhhccceecCCCCCCCC-----CCCcchHHhHhHHhcCCccchh
Q psy11507         40 RLCLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLRGHEPQK-----KSSQIPKEKYNLAYLMSDSLDT  108 (113)
Q Consensus        40 ~~C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~~C~~~~~c~~-----~~C~~CR~~kcl~~GM~~~~~~  108 (113)
                      ++|.||++++.++||||.+|++|++||||++..+..|.|..++.|.+     ..|++|||+|||++||+++..+
T Consensus         1 ~~C~VCg~~~~g~hyGv~sC~aC~~FFRR~v~~~~~~~C~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~V~   74 (75)
T cd06969           1 GLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLQVGMVKEVVR   74 (75)
T ss_pred             CCCeecCCcCcceEECcceeeeeeeeeeeeeecCCcccCCcCCccccCCcccccCcccHhHHHHHhCCCHHHcc
Confidence            36999999999999999999999999999999888999998877753     4799999999999999987543


No 17 
>cd07179 2DBD_NR_DBD2 The second DNA-binding domain (DBD) of the 2DBD nuclear receptor is composed of two C4-type zinc fingers. The second DNA-binding domain (DBD) of the 2DBD nuclear receptor (NR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. NRs interact with specific DNA sites upstream of the target gene and modulate the rate of transcriptional initiation. The proteins contain two DBDs in tandem, probably resulting from an ancient recombination event.  The 2DBD-NRs are found only in flatworm species, mollusks and arthropods.  Their biological function is unknown.
Probab=99.89  E-value=6.2e-24  Score=137.23  Aligned_cols=66  Identities=36%  Similarity=0.621  Sum_probs=60.6

Q ss_pred             ceEcCCCCcceeechhcchhhHHHHHHhHhhccceecCCCCCCCC-----CCCcchHHhHhHHhcCCccch
Q psy11507         42 CLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLRGHEPQK-----KSSQIPKEKYNLAYLMSDSLD  107 (113)
Q Consensus        42 C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~~C~~~~~c~~-----~~C~~CR~~kcl~~GM~~~~~  107 (113)
                      |.||+++++++||||.+|++|++||||++..+..|.|..++.|.+     ..|++|||+|||++||+++..
T Consensus         1 C~VCg~~~~g~hygv~sC~aC~~FFRR~~~~~~~~~C~~~~~C~i~~~~r~~C~~CR~~KCl~vGM~~~~v   71 (74)
T cd07179           1 CRVCGGKSSGFHFGALTCEGCKGFFRRTELSSNSYVCPGGQNCAITPATRNACKSCRFRRCLAVGMSKTGS   71 (74)
T ss_pred             CcccCccCcceEECceeehhHHHHHHHHhhCCCcccCCCCCccccCCcccccCccchhHHHHHhCCCHhHe
Confidence            789999999999999999999999999999999999998888853     479999999999999998754


No 18 
>cd07165 NR_DBD_DmE78_like DNA-binding domain of Drosophila ecdysone-induced protein 78 (E78) like is composed of two C4-type zinc fingers. DNA-binding domain of proteins similar to Drosophila ecdysone-induced protein 78 (E78) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. E78 interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Drosophila ecdysone-induced protein 78 (E78) is a transcription factor belonging to the nuclear receptor superfamily.  E78 is a product of the ecdysone-inducible gene found in an early late puff locus at position 78C during the onset of Drosophila metamorphosis. An E78 orthologue from the Platyhelminth Schistosoma mansoni (SmE78) has also been identified. It is the first E78 orthologue known outside of the molting animals--the Ecdysozoa. The SmE78 may be involved in transduction of an ecdysone signal in S. mansoni,
Probab=99.89  E-value=4.9e-24  Score=139.82  Aligned_cols=71  Identities=44%  Similarity=0.680  Sum_probs=64.9

Q ss_pred             ceEcCCCCcceeechhcchhhHHHHHHhHhhccceecCCCCCCCC-----CCCcchHHhHhHHhcCCccchhhccC
Q psy11507         42 CLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLRGHEPQK-----KSSQIPKEKYNLAYLMSDSLDTTNRF  112 (113)
Q Consensus        42 C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~~C~~~~~c~~-----~~C~~CR~~kcl~~GM~~~~~~~~~~  112 (113)
                      |.||+++++++||||.+|++|++||||++.....|.|..++.|.+     ..|++|||+|||++||.+...+..|.
T Consensus         1 C~VCg~~~~g~hyG~~sC~aC~~FFRR~~~~~~~~~C~~~~~C~i~~~~r~~C~~CR~~KCl~vGM~~~~V~~~r~   76 (81)
T cd07165           1 CKVCGDKASGYHYGVTSCEGCKGFFRRSIQKQIEYRCLRDGKCEIIRLNRNRCQYCRFKKCLAAGMSKDSVRYGRI   76 (81)
T ss_pred             CCccCccCcceEECchhhhhHHHHHHhHhccCCceeCCCCCCccccccccccccchhhhhcccccCCHHHcccCCC
Confidence            789999999999999999999999999999899999998888853     47999999999999999988777764


No 19 
>cd06963 NR_DBD_GR_like The DNA binding domain of GR_like nuclear receptors is composed of two C4-type zinc fingers. The DNA binding domain of GR_like nuclear receptors is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. It interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. This family of NRs includes four types of nuclear hormone receptors: glucocorticoid receptor (GR), mineralocorticoid receptor (MR), progesterone receptor (PR), and androgen receptor (AR). The receptors bind to common DNA elements containing a partial palindrome of the core sequence 5'-TGTTCT-3' with a 3bp spacer. These four receptors regulate some of the most fundamental physiological functions such as the stress response, metabolism, electrolyte homeostasis, immune function, growth, development, and reproduction. The NRs in this family have high sequence homology and sha
Probab=99.89  E-value=6.8e-24  Score=136.76  Aligned_cols=64  Identities=33%  Similarity=0.604  Sum_probs=59.5

Q ss_pred             ceEcCCCCcceeechhcchhhHHHHHHhHhhccceecCCCCCCCC-----CCCcchHHhHhHHhcCCcc
Q psy11507         42 CLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLRGHEPQK-----KSSQIPKEKYNLAYLMSDS  105 (113)
Q Consensus        42 C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~~C~~~~~c~~-----~~C~~CR~~kcl~~GM~~~  105 (113)
                      |.||+++++++||||.+|++|++||||++..+..|.|..++.|.+     ..|++|||+|||++||..+
T Consensus         1 C~VCg~~a~~~hygv~sC~aCk~FFRR~~~~~~~~~C~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~   69 (73)
T cd06963           1 CLICGDEASGCHYGVLTCGSCKVFFKRAAEGQHNYLCAGRNDCIIDKIRRKNCPACRLRKCYQAGMTLG   69 (73)
T ss_pred             CcccCccCcceEECceeehhhhHhHHHhhcCCCceeCCCCCccccCCcccccCccchhhHHHHcCCChh
Confidence            789999999999999999999999999999999999998888853     4799999999999999876


No 20 
>cd07169 NR_DBD_GCNF_like DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers. DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. This domain interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. GCNF is a transcription factor expressed in post-meiotic stages of developing male germ cells. In vitro, GCNF has the ability to bind to direct repeat elements of  5'-AGGTCA.AGGTCA-3', as well as to an extended half-site sequence 5'-TCA.AGGTCA-3'. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, GCNF has  a central well conserved DNA-binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Probab=99.89  E-value=6.7e-24  Score=141.83  Aligned_cols=73  Identities=34%  Similarity=0.586  Sum_probs=65.2

Q ss_pred             CCcceEcCCCCcceeechhcchhhHHHHHHhHhhccceecCCCCCCCC-----CCCcchHHhHhHHhcCCccchhhcc
Q psy11507         39 RRLCLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLRGHEPQK-----KSSQIPKEKYNLAYLMSDSLDTTNR  111 (113)
Q Consensus        39 ~~~C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~~C~~~~~c~~-----~~C~~CR~~kcl~~GM~~~~~~~~~  111 (113)
                      ..+|.||+++++++||||.+|++|++||||++..+..|.|..++.|.+     ..|++|||+|||++||.++..+..|
T Consensus         6 ~~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~v~~~~~~~C~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~v~~~r   83 (90)
T cd07169           6 QRTCLICGDRATGLHYGIISCEGCKGFFKRSICNKRVYRCSRDKNCVMSRKQRNRCQYCRLLKCLQMGMNRKAIREDG   83 (90)
T ss_pred             CCCCeecCCcCcceEECcceehhhHHHHHHHhcCCCceecCCCCcccccccccccccccchhhhccccCCHHHhcccc
Confidence            456999999999999999999999999999999999999998888853     4799999999999999998665544


No 21 
>cd06958 NR_DBD_COUP_TF DNA-binding domain of chicken ovalbumin upstream promoter transcription factors (COUP-TFs) is composed of two C4-type zinc fingers. DNA-binding domain of chicken ovalbumin upstream promoter transcription factors (COUP-TFs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. COUP-TFs are orphan members of the steroid/thyroid hormone receptor superfamily. They are expressed in many tissues and are involved in the regulation of several important biological processes, such as neurogenesis, organogenesis, cell fate determination, and metabolic homeostasis. COUP-TFs homodimerize or heterodimerize with retinoid X receptor (RXR) and a few other nuclear receptors and bind to a variety of response elements that are composed of imperfect AGGTCA direct or inverted repeats with various spacings. COUP-TFs are generally considered to be repressors of transcription for other nuclear hormone recept
Probab=99.89  E-value=6e-24  Score=136.90  Aligned_cols=66  Identities=33%  Similarity=0.569  Sum_probs=60.5

Q ss_pred             ceEcCCCCcceeechhcchhhHHHHHHhHhhccceecCCCCCCCC-----CCCcchHHhHhHHhcCCccch
Q psy11507         42 CLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLRGHEPQK-----KSSQIPKEKYNLAYLMSDSLD  107 (113)
Q Consensus        42 C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~~C~~~~~c~~-----~~C~~CR~~kcl~~GM~~~~~  107 (113)
                      |.||++++.++||||.+|++|++||||++..+..|.|..++.|.+     ..|++|||+|||++||+++..
T Consensus         1 C~VCg~~~~g~hygv~sC~aC~~FFRR~v~~~~~~~C~~~~~C~i~~~~r~~C~~CR~~KCl~vGM~~~~v   71 (73)
T cd06958           1 CVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRGNRNCPIDQHHRNQCQYCRLKKCLKVGMRREAV   71 (73)
T ss_pred             CCccCccCcceEEChhhhhhhhhhhhhhhcCCCceeCCCCCcCccCCcccccCccchhhHhhHhCCCHHHc
Confidence            789999999999999999999999999999998999998888853     479999999999999998754


No 22 
>cd07156 NR_DBD_VDR_like The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers. The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. This domain interacts with specific DNA site upstream of the target gene and modulates the rate of transcriptional initiation. This family includes three types of nuclear receptors: vitamin D receptors (VDR), constitutive androstane receptor (CAR) and pregnane X receptor (PXR). VDR regulates calcium metabolism, cellular proliferation and differentiation.  PXR and CAR function as sensors of toxic byproducts of cell metabolism and of exogenous chemicals, to facilitate their elimination. The DNA binding activity is regulated by their corresponding ligands. VDR is activated by Vitamin D; CAR and PXR respond to a diverse array of chemi
Probab=99.89  E-value=4.1e-24  Score=137.33  Aligned_cols=65  Identities=31%  Similarity=0.632  Sum_probs=59.9

Q ss_pred             ceEcCCCCcceeechhcchhhHHHHHHhHhhccceecCCCCCCCC-----CCCcchHHhHhHHhcCCccc
Q psy11507         42 CLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLRGHEPQK-----KSSQIPKEKYNLAYLMSDSL  106 (113)
Q Consensus        42 C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~~C~~~~~c~~-----~~C~~CR~~kcl~~GM~~~~  106 (113)
                      |.||+++++++||||.+|++|++||||++..+..|.|..++.|.+     ..|++|||+|||++||+++.
T Consensus         1 C~VC~~~~~g~hygv~sC~aC~~FFRR~v~~~~~~~C~~~~~C~i~~~~r~~C~~CR~~KCl~vGM~~~~   70 (72)
T cd07156           1 CGVCGDRATGYHFNAMTCEGCKGFFRRSMKRKARFTCPFNGDCEITKDNRRHCQACRLKKCLDIGMKKEM   70 (72)
T ss_pred             CCccCccCcccEECcceehhhhhhhchhccCcCccccCCCCccccCCcccccCccchhHHHHHhCCCHHH
Confidence            789999999999999999999999999999888899998888853     47999999999999999864


No 23 
>KOG4846|consensus
Probab=99.89  E-value=2.6e-24  Score=175.20  Aligned_cols=69  Identities=43%  Similarity=0.693  Sum_probs=63.3

Q ss_pred             CcceEcCCCCcceeechhcchhhHHHHHHhHhhccce-ecCCCCCCCCC-----CCcchHHhHhHHhcCCccchh
Q psy11507         40 RLCLVCGDVASGFHYGVASCEACKAFFKRTIQARASL-VSLRGHEPQKK-----SSQIPKEKYNLAYLMSDSLDT  108 (113)
Q Consensus        40 ~~C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~-~C~~~~~c~~~-----~C~~CR~~kcl~~GM~~~~~~  108 (113)
                      .+|.||||.++||||||.+|+|||+||||+|+.+..| .|-+..+|.+.     .|+.|||+|||+|||+...++
T Consensus       133 ~lCkVCgDkASGfHYGV~aCEGCKGFFRRSIQqkI~YrrClk~e~C~I~R~nRNRCQ~CRfKKCL~vGMSrDaVR  207 (538)
T KOG4846|consen  133 SLCKVCGDKASGFHYGVTACEGCKGFFRRSIQQKIDYRRCLKQEVCEIKRENRNRCQYCRFKKCLDVGMSRDAVR  207 (538)
T ss_pred             EeehhhccccccceeceeecccchHHHHHHHHHhhhHHHHhhhhceehhhhccchhhhhhHHHHHhcccchhhhh
Confidence            5799999999999999999999999999999999999 59999888544     699999999999999998665


No 24 
>cd06960 NR_DBD_HNF4A DNA-binding domain of heptocyte nuclear factor 4 (HNF4) is composed of two C4-type zinc fingers. DNA-binding domain of hepatocyte nuclear factor 4 (HNF4) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. HNF4 interacts with a DNA site, composed of two direct repeats of AGTTCA with 1 bp spacer, which is upstream of target genes and modulates the rate of transcriptional initiation. HNF4 is a member of the nuclear receptor superfamily. HNF4 plays a key role in establishing and maintenance of hepatocyte differentiation in the liver. It is also expressed in gut, kidney, and pancreatic beta cells. HNF4 was originally classified as an orphan receptor, but later it is found that HNF4 binds with very high affinity to a variety of fatty acids. However, unlike other nuclear receptors, the ligands do not act as a molecular switch for HNF4. They seem to constantly bind to the receptor, which is
Probab=99.89  E-value=2.5e-24  Score=139.46  Aligned_cols=71  Identities=32%  Similarity=0.543  Sum_probs=64.6

Q ss_pred             ceEcCCCCcceeechhcchhhHHHHHHhHhhccceecCCCCCCCC-----CCCcchHHhHhHHhcCCccchhhccC
Q psy11507         42 CLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLRGHEPQK-----KSSQIPKEKYNLAYLMSDSLDTTNRF  112 (113)
Q Consensus        42 C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~~C~~~~~c~~-----~~C~~CR~~kcl~~GM~~~~~~~~~~  112 (113)
                      |.||+++++++||||.+|++|++||||++..+..|.|..++.|.+     ..|++|||+|||++||.+...+..|+
T Consensus         1 C~vCg~~~~~~hygv~~C~aC~~FFrR~~~~~~~~~C~~~~~C~i~~~~r~~C~~CR~~KCl~vGM~~~~v~~~r~   76 (76)
T cd06960           1 CAVCGDRATGKHYGVLSCNGCKGFFRRSVRKNRTYTCRFGGNCVVDKDKRNACRYCRFKKCLEVGMDPEAVQNERD   76 (76)
T ss_pred             CCccCccCcccEECcceeeeehheeCccccCCCceeCCCCCcccccCcccccCccchhhhhhhcCCCHHHcccCCC
Confidence            789999999999999999999999999999888999998888853     47999999999999999987776664


No 25 
>cd07158 NR_DBD_Ppar_like The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family. The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. These domains interact with specific DNA sites upstream of the target gene and modulate the rate of transcriptional initiation. This family includes three known types of nuclear receptors: peroxisome proliferator-activated receptors (PPAR), REV-ERB receptors and Drosophila ecdysone-induced protein 78 (E78). Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, PPAR-like receptors have a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a non-conserved hinge and a C-terminal ligand binding domain (LBD).
Probab=99.89  E-value=9.5e-24  Score=135.83  Aligned_cols=65  Identities=48%  Similarity=0.737  Sum_probs=59.8

Q ss_pred             ceEcCCCCcceeechhcchhhHHHHHHhHhhccce-ecCCCCCCCC-----CCCcchHHhHhHHhcCCccc
Q psy11507         42 CLVCGDVASGFHYGVASCEACKAFFKRTIQARASL-VSLRGHEPQK-----KSSQIPKEKYNLAYLMSDSL  106 (113)
Q Consensus        42 C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~-~C~~~~~c~~-----~~C~~CR~~kcl~~GM~~~~  106 (113)
                      |.||+++++++||||.+|++|++||||++..+..| .|..++.|.+     ..|++|||+|||++||++..
T Consensus         1 C~VCg~~~~g~hyGv~~C~aC~~FFRR~v~~~~~~~~C~~~~~C~i~~~~r~~C~~CR~~KCl~vGM~~~~   71 (73)
T cd07158           1 CKVCGDKASGFHYGVHSCEGCKGFFRRTIQHNLTYRRCLNGGKCVIQRKNRNRCQYCRFKKCLSVGMSRNA   71 (73)
T ss_pred             CcccCccCcceEECcchhhHHHHHHhhhhcCCCCcccCCCCCCcCCCccccccCccchhhhhhHccCChHH
Confidence            78999999999999999999999999999999888 7998888853     47999999999999999864


No 26 
>cd07167 NR_DBD_Lrh-1_like The DNA-binding domain of Lrh-1 like nuclear receptor family like is composed of two C4-type zinc fingers. The DNA-binding domain of Lrh-1 like nuclear receptor family like is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. This domain interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. This nuclear receptor family includes at least three subgroups of receptors that function in embryo development and differentiation, and other processes. FTZ-F1 interacts with the cis-acting DNA motif of ftz gene, which is required at several stages of development. Particularly, FTZ-F1 regulated genes are strongly linked to steroid biosynthesis and sex-determination; LRH-1 is a regulator of bile-acid homeostasis, steroidogenesis, reverse cholesterol transport and the initial stages of embryonic development; SF-1 is an essential regu
Probab=99.89  E-value=6.9e-24  Score=142.62  Aligned_cols=70  Identities=36%  Similarity=0.647  Sum_probs=63.9

Q ss_pred             ceEcCCCCcceeechhcchhhHHHHHHhHhhccceecCCCCCCCC-----CCCcchHHhHhHHhcCCccchhhcc
Q psy11507         42 CLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLRGHEPQK-----KSSQIPKEKYNLAYLMSDSLDTTNR  111 (113)
Q Consensus        42 C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~~C~~~~~c~~-----~~C~~CR~~kcl~~GM~~~~~~~~~  111 (113)
                      |.||+++++++||||.+|++|++||||++..+..|.|..++.|.+     ..|++|||+|||++||..+..+..|
T Consensus         1 C~VCg~~a~g~hyGv~sC~aCk~FFRRsv~~~~~~~C~~~~~C~i~~~~r~~Cr~CRl~KCl~vGM~~~~Vq~~r   75 (93)
T cd07167           1 CPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKRYTCIENQNCQIDKTQRKRCPYCRFQKCLSVGMKLEAVRADR   75 (93)
T ss_pred             CcccCccCcceEECchhhhhHHHHHHHHeeCCCccccCCCCccccCccccCcCCCcccchhhhccCCHHHhhhcc
Confidence            789999999999999999999999999999999999999888853     4799999999999999998766655


No 27 
>cd06966 NR_DBD_CAR DNA-binding domain of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers. DNA-binding domain (DBD) of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. CAR DBD interacts with CAR response element, a perfect repeat of two AGTTCA motifs with a 4 bp spacer upstream of the target gene, and modulates the rate of transcriptional initiation. The constitutive androstane receptor (CAR) is a ligand-regulated transcription factor that responds to a diverse array of chemically distinct ligands, including many endogenous compounds and clinical drugs. It functions as a heterodimer with RXR. The CAR/RXR heterodimer binds many common response elements in the promoter regions of a diverse set of target genes involved in the metabolism, transport, and ultimately, elimination of these molecules from the body. CAR is a closest mammalian 
Probab=99.89  E-value=2.7e-24  Score=144.76  Aligned_cols=71  Identities=25%  Similarity=0.446  Sum_probs=64.7

Q ss_pred             cceEcCCCCcceeechhcchhhHHHHHHhHhhccceecCCCCCCCC-----CCCcchHHhHhHHhcCCccchhhcc
Q psy11507         41 LCLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLRGHEPQK-----KSSQIPKEKYNLAYLMSDSLDTTNR  111 (113)
Q Consensus        41 ~C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~~C~~~~~c~~-----~~C~~CR~~kcl~~GM~~~~~~~~~  111 (113)
                      +|.||+++++++||||.+|.+|++||||++.....|.|..++.|.+     ..|++|||+|||++||.++.....|
T Consensus         2 ~C~VCg~~a~g~hyGv~sC~aC~~FFRR~v~~~~~~~C~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~V~~~r   77 (94)
T cd06966           2 ICGVCGDKALGYNFNAITCESCKAFFRRNALKNKEFKCPFNESCEINVVTRRFCQKCRLDKCFAIGMKKEWIMSEE   77 (94)
T ss_pred             CCeeCCCcCcceEECcceeeeehheehhcccCCCccccCCCCccccCccccccCccchhhhCcccCCCHHHccchh
Confidence            6999999999999999999999999999999888999998888853     4799999999999999998776654


No 28 
>cd07163 NR_DBD_TLX DNA-binding domain of Tailless (TLX) is composed of two C4-type zinc fingers. DNA-binding domain of Tailless (TLX) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. TLX interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  TLX is an orphan receptor that is expressed by neural stem/progenitor cells in the adult brain of the subventricular zone (SVZ) and the dentate gyrus (DG). It plays a key role in neural development by promoting cell cycle progression and preventing apoptosis in the developing brain. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, TLX has a central well conserved DNA-binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Probab=99.88  E-value=2.6e-24  Score=144.27  Aligned_cols=75  Identities=28%  Similarity=0.464  Sum_probs=66.0

Q ss_pred             CCCcceEcCCCCcceeechhcchhhHHHHHHhHhhccceecCCC--CCCC-----CCCCcchHHhHhHHhcCCccchhhc
Q psy11507         38 PRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLRG--HEPQ-----KKSSQIPKEKYNLAYLMSDSLDTTN  110 (113)
Q Consensus        38 ~~~~C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~~C~~~--~~c~-----~~~C~~CR~~kcl~~GM~~~~~~~~  110 (113)
                      ...+|.||+++++++||||.+|++|++||||++..+..|.|..+  +.|.     ...|++|||+|||++||++...+..
T Consensus         5 ~~~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~v~~~~~~~C~~~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~Vq~~   84 (92)
T cd07163           5 LDIPCKVCGDRSSGKHYGIYACDGCSGFFKRSIRRNRQYVCKSKGQGGCPVDKTHRNQCRACRLKKCFEVGMNKDAVQHE   84 (92)
T ss_pred             cCCCCcccCCcCcccEECceeeeeeeeEEeeeecCCCCcCCCCCCCCCCccCCCccccCccchhhhhhhhcCCHHHhhcc
Confidence            35679999999999999999999999999999998999999873  5664     3479999999999999999887776


Q ss_pred             cC
Q psy11507        111 RF  112 (113)
Q Consensus       111 ~~  112 (113)
                      |.
T Consensus        85 r~   86 (92)
T cd07163          85 RG   86 (92)
T ss_pred             cC
Confidence            63


No 29 
>cd06962 NR_DBD_FXR DNA-binding domain of Farnesoid X receptor (FXR) family is composed of two C4-type zinc fingers. DNA-binding domain of Farnesoid X receptor (FXR) family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. FXR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  FXR is a member of the nuclear receptor family of ligand activated transcription factors. Bile acids are endogenous ligands for FXRs. Upon binding of a ligand, FXR binds to FXR response element (FXRE), which is an inverted repeat of TGACCT spaced by one nucleotide, either as a monomer or as a heterodimer with retinoid X receptor (RXR), to regulate the expression of various genes involved in bile acid, lipid, and glucose metabolism. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, FXR has a central well conserved 
Probab=99.88  E-value=3.8e-24  Score=141.42  Aligned_cols=69  Identities=33%  Similarity=0.596  Sum_probs=62.6

Q ss_pred             CcceEcCCCCcceeechhcchhhHHHHHHhHhhccceecCCCCCCC-----CCCCcchHHhHhHHhcCCccchh
Q psy11507         40 RLCLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLRGHEPQ-----KKSSQIPKEKYNLAYLMSDSLDT  108 (113)
Q Consensus        40 ~~C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~~C~~~~~c~-----~~~C~~CR~~kcl~~GM~~~~~~  108 (113)
                      .+|.||+++++++||||.+|++|++||||++..+..|.|..++.|.     ...|++|||+|||++||......
T Consensus         2 ~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~v~~~~~~~C~~~~~C~i~~~~r~~Cr~CRl~KCl~vGM~~~~v~   75 (84)
T cd06962           2 ELCVVCGDKASGYHYNALTCEGCKGFFRRSITKNAVYKCKNGGNCEMDMYMRRKCQECRLRKCKEMGMLAECLL   75 (84)
T ss_pred             CCCeecCCcCcceEECcceeecceeeeeeeeccCCceecCCCCcCccCccccccCccchhhHHHHhCCChHHcc
Confidence            4599999999999999999999999999999988999999888885     34799999999999999987544


No 30 
>cd06968 NR_DBD_ROR DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers. DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. ROR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  RORS are key regulators of many physiological processes during embryonic development. RORs bind as monomers to specific ROR response elements (ROREs) consisting of the consensus core motif AGGTCA preceded by a 5-bp A/T-rich sequence. There are three subtypes of retinoid-related orphan receptors (RORs), alpha, beta, and gamma, which differ only in N-terminal sequence and are distributed in distinct tissues. RORalpha plays a key role in the development of the cerebellum particularly in the regulation of the maturation and survival of Purkinje cells. RORbe
Probab=99.88  E-value=1.1e-23  Score=142.16  Aligned_cols=74  Identities=35%  Similarity=0.537  Sum_probs=65.9

Q ss_pred             CCcceEcCCCCcceeechhcchhhHHHHHHhHhhccceecCCCCCCCC-----CCCcchHHhHhHHhcCCccchhhccC
Q psy11507         39 RRLCLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLRGHEPQK-----KSSQIPKEKYNLAYLMSDSLDTTNRF  112 (113)
Q Consensus        39 ~~~C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~~C~~~~~c~~-----~~C~~CR~~kcl~~GM~~~~~~~~~~  112 (113)
                      ..+|.|||+++.++|||+.+|++|++||||++..+..|.|..++.|..     ..|++|||+|||++||.....+..|.
T Consensus         5 ~~~C~VCg~~~~g~hyGv~sC~aC~~FFRR~v~~~~~~~C~~~~~C~i~~~~r~~Cr~CRl~KCl~vGM~~~~V~~~r~   83 (95)
T cd06968           5 VIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNVSYSCPRQKNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGRM   83 (95)
T ss_pred             ccCCcccCCcCcceEECceeehhhHHhhHHheeCCCceecCCCcccccccCCceeccccchhhcccccCChhhcccCcC
Confidence            457999999999999999999999999999999888999998888853     47999999999999999987665553


No 31 
>cd07157 2DBD_NR_DBD1 The first DNA-binding domain (DBD) of the 2DBD nuclear receptors is composed of two C4-type zinc fingers. The first DNA-binding domain (DBD) of the 2DBD nuclear receptors(NRs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. NRs interact with specific DNA sites upstream of the target gene and modulate the rate of transcriptional initiation. Theses proteins contain two DBDs in tandem, probably resulted from an ancient recombination event. The 2DBD-NRs are found only in flatworm species, mollusks and arthropods.  Their biological function is unknown.
Probab=99.88  E-value=3.3e-24  Score=142.19  Aligned_cols=71  Identities=34%  Similarity=0.445  Sum_probs=63.1

Q ss_pred             cceEcCCCCcceeechhcchhhHHHHHHhHhhcc--ceecCCCCCCCC-----CCCcchHHhHhHHhcCCccchhhcc
Q psy11507         41 LCLVCGDVASGFHYGVASCEACKAFFKRTIQARA--SLVSLRGHEPQK-----KSSQIPKEKYNLAYLMSDSLDTTNR  111 (113)
Q Consensus        41 ~C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~--~~~C~~~~~c~~-----~~C~~CR~~kcl~~GM~~~~~~~~~  111 (113)
                      +|.||+++++++||||.+|++|++||||++....  .|.|..++.|.+     ..|++|||+|||+|||.......+|
T Consensus         2 ~C~VCg~~a~g~hyGv~sC~aCk~FFRR~~~~~~~~~~~C~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~~~~~~   79 (86)
T cd07157           2 TCQVCGEPAAGFHHGAYVCEACKKFFMRSSNAISFTISECPNGGKCIIDKKNRTKCQACRYRKCLNVGMSLGGPRYGR   79 (86)
T ss_pred             CCcccCCcCcccEECcceeeEeeeEEecceecCCCccccCCCCCccccCccccccCccchhhHHhHcCCCcccccccc
Confidence            5999999999999999999999999999998664  788998888853     4799999999999999988766665


No 32 
>cd07162 NR_DBD_PXR DNA-binding domain of pregnane X receptor (PXRs) is composed of two C4-type zinc fingers. DNA-binding domain (DBD)of pregnane X receptor (PXR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. PXR DBD interacts with the PXR response element, a perfect repeat of two AGTTCA motifs with a 4 bp spacer upstream of the target gene, and modulates the rate of transcriptional initiation. The pregnane X receptor (PXR) is a ligand-regulated transcription factor that responds to a diverse array of chemically distinct ligands, including many endogenous compounds and clinical drugs. PXR functions as a heterodimer with retinoic X receptor-alpha (RXRa) and binds to a variety of promoter regions of a diverse set of target genes involved in the metabolism, transport, and ultimately, elimination of these molecules from the body. Like other nuclear receptors, PXR has a central well conserved DNA-binding
Probab=99.88  E-value=1.7e-23  Score=138.96  Aligned_cols=68  Identities=31%  Similarity=0.607  Sum_probs=61.7

Q ss_pred             cceEcCCCCcceeechhcchhhHHHHHHhHhhccceecCCCCCCC-----CCCCcchHHhHhHHhcCCccchh
Q psy11507         41 LCLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLRGHEPQ-----KKSSQIPKEKYNLAYLMSDSLDT  108 (113)
Q Consensus        41 ~C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~~C~~~~~c~-----~~~C~~CR~~kcl~~GM~~~~~~  108 (113)
                      +|.||+++++++||||.+|++|++||||++.....|.|..++.|.     ...|++|||+|||++||.++...
T Consensus         1 ~C~VCg~~~~g~hygv~sC~aC~~FFRR~v~~~~~~~C~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~V~   73 (87)
T cd07162           1 ICRVCGDRATGYHFNAMTCEGCKGFFRRAMKRNARLCCPFQKGCVITKSNRRQCQACRLRKCLSIGMKKELIM   73 (87)
T ss_pred             CCcccCCcCcceEECcceehhhHHHHHhhhccCceeEcCCCCceecCCcccccCccchhhHHhHhCCCHHHcc
Confidence            499999999999999999999999999999998999999888885     34799999999999999997543


No 33 
>smart00399 ZnF_C4 c4 zinc finger in nuclear hormone receptors.
Probab=99.88  E-value=1.5e-23  Score=133.83  Aligned_cols=64  Identities=44%  Similarity=0.715  Sum_probs=59.2

Q ss_pred             cceEcCCCCcceeechhcchhhHHHHHHhHhhccceecCCCCCCC-----CCCCcchHHhHhHHhcCCc
Q psy11507         41 LCLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLRGHEPQ-----KKSSQIPKEKYNLAYLMSD  104 (113)
Q Consensus        41 ~C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~~C~~~~~c~-----~~~C~~CR~~kcl~~GM~~  104 (113)
                      +|.||+++++++||||.+|++|++||||++..+..|.|..++.|.     ...|++|||+|||++||..
T Consensus         1 ~C~vC~~~~~~~hygv~~C~aC~~FFRR~v~~~~~~~C~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~   69 (70)
T smart00399        1 LCCVCGDHASGFHFGVCSCRACKAFFRRTVNLRYKYRCDRKNNCSINKRYRCRCRACRLKKCLGVGMDP   69 (70)
T ss_pred             CCeEeCCcCcccEeCCcEechhhhhhhhheeCCCCeecCCCcccccCCCccccCccCcChhHhhccCcC
Confidence            499999999999999999999999999999989889999888785     3479999999999999986


No 34 
>cd06955 NR_DBD_VDR DNA-binding domain of vitamin D receptors (VDR) is composed of two C4-type zinc fingers. DNA-binding domain of vitamin D receptors (VDR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. VDR interacts with a VDR response element, a direct repeat of GGTTCA DNA site with 3 bp spacer upstream of the target gene, and modulates the rate of transcriptional initiation.  VDR is a member of the nuclear receptor (NR) superfamily that functions as classical endocrine receptors. VDR controls a wide range of biological activities including calcium metabolism, cell proliferation and differentiation, and immunomodulation. VDR is a high-affinity receptor for the biologically most active Vitamin D metabolite, 1alpha,25-dihydroxyvitamin D3 (1alpha,25(OH)2D3). The binding of the ligand to the receptor induces a conformational change of the ligand binding domain (LBD) with consequent dissociation of core
Probab=99.88  E-value=1e-23  Score=145.03  Aligned_cols=69  Identities=30%  Similarity=0.598  Sum_probs=62.6

Q ss_pred             CCCcceEcCCCCcceeechhcchhhHHHHHHhHhhccceecCCCCCCCC-----CCCcchHHhHhHHhcCCccc
Q psy11507         38 PRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLRGHEPQK-----KSSQIPKEKYNLAYLMSDSL  106 (113)
Q Consensus        38 ~~~~C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~~C~~~~~c~~-----~~C~~CR~~kcl~~GM~~~~  106 (113)
                      .+.+|.||++.++++||||.+|++|++||||++..+..|.|..++.|.+     ..|++|||+|||++||..+.
T Consensus         5 ~~~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~v~~~~~~~C~~~~~C~i~~~~r~~Cr~CRl~KCl~vGM~~~~   78 (107)
T cd06955           5 VPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTCPFNGDCRITKDNRRHCQACRLKRCVDIGMMKEF   78 (107)
T ss_pred             CCCCCeecCCcCcccEECcceeeeecceecceeccCCccccCCCCccccccCCccccccchhHHHHHcCCCchh
Confidence            4567999999999999999999999999999999999999998888853     47999999999999998854


No 35 
>cd07154 NR_DBD_PNR_like The DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) nuclear receptor-like family. The DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) nuclear receptor-like family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. PNR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. This family includes nuclear receptor Tailless (TLX), photoreceptor cell-specific nuclear receptor (PNR) and related receptors. TLX is an orphan receptor that plays a key role in neural development by regulating cell cycle progression and exit of neural stem cells in the developing brain. PNR is expressed only in the outer layer of retinal photoreceptor cells. It may be involved in the signaling pathway regulating photoreceptor differentiation and/or maintenance. Like other members of the nuclear
Probab=99.88  E-value=4.7e-24  Score=137.32  Aligned_cols=66  Identities=33%  Similarity=0.563  Sum_probs=59.4

Q ss_pred             ceEcCCCCcceeechhcchhhHHHHHHhHhhccceecC-CCCCCC-----CCCCcchHHhHhHHhcCCccch
Q psy11507         42 CLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSL-RGHEPQ-----KKSSQIPKEKYNLAYLMSDSLD  107 (113)
Q Consensus        42 C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~~C~-~~~~c~-----~~~C~~CR~~kcl~~GM~~~~~  107 (113)
                      |.||+++++++||||.+|++|++||||++..+..|.|. .++.|.     ...|++|||+|||++||+++..
T Consensus         1 C~vCg~~~~~~hyGv~sC~aC~~FFRR~v~~~~~~~C~~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~v   72 (73)
T cd07154           1 CKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNLLYTCKAGNGSCVVDKARRNQCQACRLKKCLEVSMNKDAV   72 (73)
T ss_pred             CcccCccCcceEECcceeeeeeeEeeeeecCCCCcccCCCCCCCccCCcccccCccchhhHhhHhCCChHHC
Confidence            78999999999999999999999999999999999998 566674     3479999999999999998753


No 36 
>cd06916 NR_DBD_like DNA-binding domain of nuclear receptors is composed of two C4-type zinc fingers. DNA-binding domain of nuclear receptors is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. It interacts with a specific DNA site upstream of the target gene and modulates the rate of transcriptional initiation. Nuclear receptors form a superfamily of ligand-activated transcription regulators, which regulate various physiological functions, from development, reproduction, to homeostasis and metabolism in animals (metazoans). The family contains not only receptors for known ligands but also orphan receptors for which ligands do not exist or have not been identified. NRs share a common structural organization with a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).  Most nuclear receptors bind as homodimers or hetero
Probab=99.88  E-value=4.3e-24  Score=137.18  Aligned_cols=66  Identities=38%  Similarity=0.652  Sum_probs=60.4

Q ss_pred             ceEcCCCCcceeechhcchhhHHHHHHhHhhccceecCCCCCCCC-----CCCcchHHhHhHHhcCCccch
Q psy11507         42 CLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLRGHEPQK-----KSSQIPKEKYNLAYLMSDSLD  107 (113)
Q Consensus        42 C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~~C~~~~~c~~-----~~C~~CR~~kcl~~GM~~~~~  107 (113)
                      |.||+++++++||||.+|++|++||||++..+..|.|..++.|.+     ..|++|||+|||++||.++..
T Consensus         1 C~vC~~~~~~~hygv~sC~aC~~FFRR~~~~~~~~~C~~~~~C~i~~~~r~~C~~CR~~KCl~vGM~~~~v   71 (72)
T cd06916           1 CAVCGDKASGYHYGVLTCEGCKGFFRRSVRRNLEYTCPAGGNCVIDKRNRNRCQACRLKKCLAVGMRKEAV   71 (72)
T ss_pred             CCccCccCcccEECcceeeeeeeeEeEeecCCCCccCCCCCccccCCcccccCccchhhHhhHhCCChHHc
Confidence            789999999999999999999999999999998999998888853     479999999999999998643


No 37 
>PF00105 zf-C4:  Zinc finger, C4 type (two domains);  InterPro: IPR001628 Steroid or nuclear hormone receptors constitute an important superfamily of transcription regulators that are involved in widely diverse physiological functions, including control of embryonic development, cell differentiation and homeostasis. The receptors function as dimeric molecules in nuclei to regulate the transcription of target genes in a ligand-responsive manner. Nuclear hormone receptors consist of a highly conserved DNA-binding domain that recognises specific sequences, connected via a linker region to a C-terminal ligand-binding domain (IPR000536 from INTERPRO). In addition, certain nuclear hormone receptors have an N-terminal modulatory domain (IPR001292 from INTERPRO). The DNA-binding domain can elicit either an activating or repressing effect by binding to specific regions of the DNA known as hormone-response elements [, ]. These response elements position the receptors, and the complexes recruited by them, close to the genes of which transcription is affected. The DNA-binding domains of nuclear receptors consist of two zinc-nucleated modules and a C-terminal extension, where residues in the first zinc module determine the specificity of the DNA recognition and residues in the second zinc module are involved in dimerisation. The DNA-binding domain is furthermore involved in several other functions including nuclear localisation, and interaction with transcription factors and co-activators []. Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the two C4-type zinc finger modules involved in DNA-binding. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0008270 zinc ion binding, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 1DSZ_A 1LO1_A 3M9E_F 2EBL_A 1GA5_B 1A6Y_B 1HLZ_B 1HRA_A 1KB6_B 1KB4_B ....
Probab=99.88  E-value=2.4e-23  Score=132.46  Aligned_cols=65  Identities=34%  Similarity=0.660  Sum_probs=56.3

Q ss_pred             CcceEcCCCCcceeechhcchhhHHHHHHhHhhccceecCCCCCCCC-----CCCcchHHhHhHHhcCCc
Q psy11507         40 RLCLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLRGHEPQK-----KSSQIPKEKYNLAYLMSD  104 (113)
Q Consensus        40 ~~C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~~C~~~~~c~~-----~~C~~CR~~kcl~~GM~~  104 (113)
                      +.|.||++++.+.||||.+|++|++||||++.....+.|..++.|.+     ..|++|||+|||++||..
T Consensus         1 ~~C~VCg~~~~~~~ygv~sC~~C~~FFrR~~~~~~~~~C~~~~~C~i~~~~~~~C~~CRf~KCl~~GM~k   70 (70)
T PF00105_consen    1 KKCKVCGDPASGYHYGVLSCNACKMFFRRSVKKKKPYKCKKNGNCKIDKDNRRKCRSCRFQKCLEVGMKK   70 (70)
T ss_dssp             -BSTTTSSBESEEETTEEEEHHHHHHHHHHHHTTCG-STSSSST---STTTTTTSHHHHHHHHHHTTBSG
T ss_pred             CCCeECCCccCcccccccccccceeeeeecccccccccccccccccccccCCCEeCcchHHHHHHHCCcC
Confidence            36999999999999999999999999999999998899998877743     479999999999999973


No 38 
>cd07166 NR_DBD_REV_ERB DNA-binding domain of REV-ERB receptor-like is composed of two C4-type zinc fingers. DNA-binding domain of REV-ERB receptor- like is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. This domain interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. REV-ERB receptors are transcriptional regulators belonging to the nuclear receptor superfamily. They regulate a number of physiological functions including the circadian rhythm, lipid metabolism, and cellular differentiation. REV-ERB receptors bind as a monomer to a (A/G)GGTCA half-site with a 5' AT-rich extension or as a homodimer to a direct repeat 2 element (AGGTCA sequence with a 2-bp spacer), indicating functional diversity. When bound to the DNA, they recruit corepressors (NcoR/histone deacetylase 3) to the promoter, resulting in repression of the target genes. The porphyr
Probab=99.88  E-value=7.8e-24  Score=141.20  Aligned_cols=73  Identities=41%  Similarity=0.644  Sum_probs=65.3

Q ss_pred             CcceEcCCCCcceeechhcchhhHHHHHHhHhhccce-ecCCCCCCCC-----CCCcchHHhHhHHhcCCccchhhccC
Q psy11507         40 RLCLVCGDVASGFHYGVASCEACKAFFKRTIQARASL-VSLRGHEPQK-----KSSQIPKEKYNLAYLMSDSLDTTNRF  112 (113)
Q Consensus        40 ~~C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~-~C~~~~~c~~-----~~C~~CR~~kcl~~GM~~~~~~~~~~  112 (113)
                      .+|.||++++.++|||+.+|++|++||||++..+..| .|..++.|.+     ..|++|||+|||++||.++..+..|.
T Consensus         4 ~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~v~~~~~~~~C~~~~~C~i~~~~r~~Cr~CRl~KCl~vGM~~~~v~~~r~   82 (89)
T cd07166           4 VLCKVCGDKASGFHYGVHACEGCKGFFRRSIQQKIQYRKCTKNETCSIMRINRNRCQYCRFKKCLAVGMSRDAVRFGRI   82 (89)
T ss_pred             CCCcccCccCcceEEChhhhhhHhhEecceeEcCCcchhhccCCcccccccccccccchhhhhcccccCCHHHhcCCCC
Confidence            4699999999999999999999999999999988888 5988888853     47999999999999999988777663


No 39 
>cd06957 NR_DBD_PNR_like_2 DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like is composed of two C4-type zinc fingers. The DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) nuclear receptor-like family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. PNR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. This family includes nuclear receptor Tailless (TLX), photoreceptor cell-specific nuclear receptor (PNR) and related receptors. TLX is an orphan receptor that plays a key role in neural development by regulating cell cycle progression and exit of neural stem cells in the developing brain. PNR is expressed only in the outer layer of retinal photoreceptor cells. It may be involved in the signaling pathway regulating photoreceptor differentiation and/or maintenance. Like other members 
Probab=99.88  E-value=3.1e-24  Score=141.12  Aligned_cols=71  Identities=27%  Similarity=0.464  Sum_probs=63.3

Q ss_pred             ceEcCCCCcceeechhcchhhHHHHHHhHhhccceecCC-CCCCCC-----CCCcchHHhHhHHhcCCccchhhccC
Q psy11507         42 CLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLR-GHEPQK-----KSSQIPKEKYNLAYLMSDSLDTTNRF  112 (113)
Q Consensus        42 C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~~C~~-~~~c~~-----~~C~~CR~~kcl~~GM~~~~~~~~~~  112 (113)
                      |.||+++++++||||.+|++|++||||++.....|.|.. ++.|.+     ..|++|||+|||++||..+..+..|.
T Consensus         1 C~VCg~~~~g~hyGv~sC~aCk~FFRR~v~~~~~~~C~~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~v~~~r~   77 (82)
T cd06957           1 CKVCGDKSYGKHYGVYCCDGCSCFFKRSVRKGIIYTCIAGNGNCVVDKARRNWCPFCRLQKCFAVGMNRAAVQEERG   77 (82)
T ss_pred             CCccCccCcceEECcceEeeeeeEEEEeecCCCceEccCccCCCccCCCccCcccCcchhhcccccCCHHHhccccC
Confidence            789999999999999999999999999999999999984 566743     47999999999999999987776663


No 40 
>KOG4215|consensus
Probab=99.87  E-value=4.6e-23  Score=165.75  Aligned_cols=75  Identities=24%  Similarity=0.459  Sum_probs=68.0

Q ss_pred             CCCcceEcCCCCcceeechhcchhhHHHHHHhHhhccceecCCCCCCCC-----CCCcchHHhHhHHhcCCccchhhccC
Q psy11507         38 PRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLRGHEPQK-----KSSQIPKEKYNLAYLMSDSLDTTNRF  112 (113)
Q Consensus        38 ~~~~C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~~C~~~~~c~~-----~~C~~CR~~kcl~~GM~~~~~~~~~~  112 (113)
                      ....|.||||++.|.|||+.+|+|||+||||+|.++..|+|+-+++|..     +.||+|||+||+++||..+..+.-|+
T Consensus        18 ~~~~CaICGDkaTGKHYGA~SCdGCKGFFRRSVrk~~~YtCRF~k~C~VDKdkRNaCRyCRfqKC~~aGMK~eAiQnERD   97 (432)
T KOG4215|consen   18 VAEFCAICGDKATGKHYGAISCDGCKGFFRRSVRKNHQYTCRFNKQCVVDKDKRNACRYCRFQKCVRAGMKREAIQNERD   97 (432)
T ss_pred             ccchhheeCCcccccccceeecCcchHHHHHHHHhcceeeeeccccccccchhhhhhhHhhHHHHHHhcccHHhhhcccc
Confidence            3567999999999999999999999999999999999999999988853     26999999999999999987777664


No 41 
>cd06965 NR_DBD_Ppar DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers. DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. PPAR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Peroxisome proliferator-activated receptors (PPARs) are members of the nuclear receptor superfamily of ligand-activated transcription factors. PPARs play important roles in regulating cellular differentiation, development and lipid metabolism. Activated PPAR forms a heterodimer with the retinoid X receptor (RXR) that binds to the hormone response elements, which are composed of two direct repeats of the consensus sequence 5'-AGGTCA-3' separated by one to five base pair located upstream of the peroxisome proliferator responsive gene
Probab=99.87  E-value=3.8e-23  Score=136.54  Aligned_cols=70  Identities=39%  Similarity=0.610  Sum_probs=61.3

Q ss_pred             cceEcCCCCcceeechhcchhhHHHHHHhHhhcccee-cCCCCCCC-----CCCCcchHHhHhHHhcCCccchhhccC
Q psy11507         41 LCLVCGDVASGFHYGVASCEACKAFFKRTIQARASLV-SLRGHEPQ-----KKSSQIPKEKYNLAYLMSDSLDTTNRF  112 (113)
Q Consensus        41 ~C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~~-C~~~~~c~-----~~~C~~CR~~kcl~~GM~~~~~~~~~~  112 (113)
                      +|.||++.++++||||.+|++|++||||++..+..|. |...  |.     ...|++|||+|||++||..+..+..|.
T Consensus         1 ~C~VCg~~~~g~hyGv~sC~aCk~FFRR~v~~~~~~~~C~~~--C~i~~~~r~~Cr~CRl~KCl~vGM~~~~v~~~r~   76 (84)
T cd06965           1 ECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLVYKPCDLS--CKIHKKSRNKCQYCRFQKCLNVGMSHNAIRFGRM   76 (84)
T ss_pred             CCcccCccCcceEEChhhhhhhhhheeeeeecCCCccccccC--CCcCccccccccchhhhhhhhccCCHHHcccCCC
Confidence            4999999999999999999999999999999888885 8754  53     347999999999999999987776663


No 42 
>KOG4217|consensus
Probab=99.85  E-value=3.4e-22  Score=164.86  Aligned_cols=73  Identities=40%  Similarity=0.628  Sum_probs=66.5

Q ss_pred             CCCcceEcCCCCcceeechhcchhhHHHHHHhHhhccceecCCCCCCC-----CCCCcchHHhHhHHhcCCccchhhc
Q psy11507         38 PRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLRGHEPQ-----KKSSQIPKEKYNLAYLMSDSLDTTN  110 (113)
Q Consensus        38 ~~~~C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~~C~~~~~c~-----~~~C~~CR~~kcl~~GM~~~~~~~~  110 (113)
                      ..+.|.||||.+..-||||.+|+|||+||+|+|+++.+|+|..+++|-     .+.|++|||+|||+|||..+++++.
T Consensus       268 ~e~~CAVCgDnAaCqHYGvRTCEGCKGFFKRTVQKnaKYvClanKnCPVDKRrRnRCQyCRfQKCL~VGMVKEVVRtd  345 (605)
T KOG4217|consen  268 AEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTD  345 (605)
T ss_pred             ccceeeecCChHHhhhcCccccccchHHHHHHHhcCCeeEeecCCCCCcchhhhhhchhhhHhHHHHhhhhhhheecc
Confidence            367899999999999999999999999999999999999999999883     2369999999999999999877653


No 43 
>KOG4216|consensus
Probab=99.84  E-value=8e-22  Score=159.67  Aligned_cols=70  Identities=36%  Similarity=0.579  Sum_probs=63.9

Q ss_pred             CCcceEcCCCCcceeechhcchhhHHHHHHhHhhccceecCCCCCCC-----CCCCcchHHhHhHHhcCCccchh
Q psy11507         39 RRLCLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLRGHEPQ-----KKSSQIPKEKYNLAYLMSDSLDT  108 (113)
Q Consensus        39 ~~~C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~~C~~~~~c~-----~~~C~~CR~~kcl~~GM~~~~~~  108 (113)
                      -.+|.||||.++|.||||.+|+|||+||||+...+..|.|.+.++|.     .+.|++||++|||++||++..+-
T Consensus        46 vIPCKiCGDKSSGiHYGVITCEGCKGFFRRSQ~s~a~YsCpRqknC~iDRtnRNRCQ~CRLqKClaLGMSRDAVK  120 (479)
T KOG4216|consen   46 IIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNANYSCPRQKNCLIDRTNRNRCQHCRLQKCLALGMSRDAVK  120 (479)
T ss_pred             EEeeeeccCCCCcceeeeEeeccchHhhhhhhhccccccCCcccCCcccccccchhhHHHHHHHHHhccchhhHH
Confidence            35799999999999999999999999999999999999999999994     34799999999999999997543


No 44 
>KOG4218|consensus
Probab=99.78  E-value=5.1e-20  Score=147.82  Aligned_cols=74  Identities=34%  Similarity=0.588  Sum_probs=67.3

Q ss_pred             CCCcceEcCCCCcceeechhcchhhHHHHHHhHhhccceecCCCCCCC-----CCCCcchHHhHhHHhcCCccchhhcc
Q psy11507         38 PRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLRGHEPQ-----KKSSQIPKEKYNLAYLMSDSLDTTNR  111 (113)
Q Consensus        38 ~~~~C~VC~~~~~g~hyGv~~C~~C~~FFRRsv~~~~~~~C~~~~~c~-----~~~C~~CR~~kcl~~GM~~~~~~~~~  111 (113)
                      ..+.|.||||+.+|+|||..+|+.|++||+|+|+.+..|+|....+|.     .+.|-+|||+|||.|||.-+.+++.|
T Consensus        14 l~ElCPVCGDkVSGYHYGLLTCESCKGFFKRTVQNnK~YtC~e~qnC~iDkTqRKRCP~CRFQKCLtvGMklEAVRADR   92 (475)
T KOG4218|consen   14 LGELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKQYTCSEEQNCHIDKTQRKRCPSCRFQKCLTVGMKLEAVRADR   92 (475)
T ss_pred             cccccccccCccccceeeeeehhhhhhHHHHHhhcCcceecccccccccchHhhccCCchhHHHHhhhhhhHHHHHHhh
Confidence            356899999999999999999999999999999999999999998884     44799999999999999988777655


No 45 
>PF01412 ArfGap:  Putative GTPase activating protein for Arf;  InterPro: IPR001164  This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins []. The GTP-bound form of ARF is essential for the maintenance of normal Golgi morphology, it participates in recruitment of coat proteins which are required for budding and fission of membranes. Before the fusion with an acceptor compartment the membrane must be uncoated. This step required the hydrolysis of GTP associated to ARF. These proteins contain a characteristic zinc finger motif (Cys-x2-Cys-x(16,17)-x2-Cys) which displays some similarity to the C4-type GATA zinc finger. The ARFGAP domain display no obvious similarity to other GAP proteins.  The 3D structure of the ARFGAP domain of the PYK2-associated protein beta has been solved []. It consists of a three-stranded beta-sheet surrounded by 5 alpha helices. The domain is organised around a central zinc atom which is coordinated by 4 cysteines. The ARFGAP domain is clearly unrelated to the other GAP proteins structures which are exclusively helical. Classical GAP proteins accelerate GTPase activity by supplying an arginine finger to the active site. The crystal structure of ARFGAP bound to ARF revealed that the ARFGAP domain does not supply an arginine to the active site which suggests a more indirect role of the ARFGAP domain in the GTPase hydrolysis []. The Rev protein of human immunodeficiency virus type 1 (HIV-1) facilitates nuclear export of unspliced and partly-spliced viral RNAs []. Rev contains an RNA-binding domain and an effector domain; the latter is believed to interact with a cellular cofactor required for the Rev response and hence HIV-1 replication. Human Rev interacting protein (hRIP) specifically interacts with the Rev effector. The amino acid sequence of hRIP is characterised by an N-terminal, C-4 class zinc finger motif.; GO: 0008060 ARF GTPase activator activity, 0008270 zinc ion binding, 0032312 regulation of ARF GTPase activity; PDB: 2P57_A 2CRR_A 2OWA_B 3O47_B 3DWD_A 1DCQ_A 2CRW_A 3MDB_D 3FEH_A 3LJU_X ....
Probab=73.35  E-value=1.9  Score=29.47  Aligned_cols=31  Identities=23%  Similarity=0.705  Sum_probs=21.1

Q ss_pred             CCCcceEcCCCCcc---eeechhcchhhHHHHHH
Q psy11507         38 PRRLCLVCGDVASG---FHYGVASCEACKAFFKR   68 (113)
Q Consensus        38 ~~~~C~VC~~~~~g---~hyGv~~C~~C~~FFRR   68 (113)
                      ....|.-|+.+...   ..||+..|..|++..|.
T Consensus        12 ~N~~CaDCg~~~p~w~s~~~GiflC~~Cag~HR~   45 (116)
T PF01412_consen   12 GNKVCADCGAPNPTWASLNYGIFLCLECAGIHRS   45 (116)
T ss_dssp             TCTB-TTT-SBS--EEETTTTEEE-HHHHHHHHH
T ss_pred             CcCcCCCCCCCCCCEEEeecChhhhHHHHHHHHH
Confidence            35679999976533   58999999999999654


No 46 
>smart00105 ArfGap Putative GTP-ase activating proteins for the small GTPase, ARF. Putative zinc fingers with GTPase activating proteins (GAPs) towards the small GTPase, Arf. The GAP of ARD1 stimulates GTPase hydrolysis for ARD1 but not ARFs.
Probab=57.68  E-value=7.9  Score=26.19  Aligned_cols=31  Identities=23%  Similarity=0.630  Sum_probs=24.4

Q ss_pred             CCcceEcCCCC---cceeechhcchhhHHHHHHh
Q psy11507         39 RRLCLVCGDVA---SGFHYGVASCEACKAFFKRT   69 (113)
Q Consensus        39 ~~~C~VC~~~~---~g~hyGv~~C~~C~~FFRRs   69 (113)
                      ...|.-|+.+.   ....||+..|..|.+..|..
T Consensus         3 N~~CaDC~~~~p~w~s~~~GifvC~~CsgiHR~l   36 (112)
T smart00105        3 NKKCFDCGAPNPTWASVNLGVFLCIECSGIHRSL   36 (112)
T ss_pred             CCcccCCCCCCCCcEEeccceeEhHHhHHHHHhc
Confidence            45688898654   33699999999999998653


No 47 
>PTZ00218 40S ribosomal protein S29; Provisional
Probab=48.02  E-value=16  Score=22.24  Aligned_cols=27  Identities=30%  Similarity=0.650  Sum_probs=20.7

Q ss_pred             CCCCCcceEcCCC-Ccceeechhcchhh
Q psy11507         36 ELPRRLCLVCGDV-ASGFHYGVASCEAC   62 (113)
Q Consensus        36 ~~~~~~C~VC~~~-~~g~hyGv~~C~~C   62 (113)
                      ..-...|.||+.+ +.-..||...|.-|
T Consensus        13 GkGsr~C~vCg~~~gliRkygL~~CRqC   40 (54)
T PTZ00218         13 GKGSRQCRVCSNRHGLIRKYGLNVCRQC   40 (54)
T ss_pred             CCCCCeeecCCCcchhhhhcCcchhhHH
Confidence            4445789999986 44468999888887


No 48 
>PRK00420 hypothetical protein; Validated
Probab=39.36  E-value=10  Score=26.23  Aligned_cols=27  Identities=22%  Similarity=0.405  Sum_probs=23.2

Q ss_pred             CCcceEcCCCCcceeechhcchhhHHH
Q psy11507         39 RRLCLVCGDVASGFHYGVASCEACKAF   65 (113)
Q Consensus        39 ~~~C~VC~~~~~g~hyGv~~C~~C~~F   65 (113)
                      ...|.+||.+-...+-|...|..|..+
T Consensus        23 ~~~CP~Cg~pLf~lk~g~~~Cp~Cg~~   49 (112)
T PRK00420         23 SKHCPVCGLPLFELKDGEVVCPVHGKV   49 (112)
T ss_pred             cCCCCCCCCcceecCCCceECCCCCCe
Confidence            367999999998888999999999754


No 49 
>smart00401 ZnF_GATA zinc finger binding to DNA consensus sequence [AT]GATA[AG].
Probab=38.30  E-value=20  Score=21.12  Aligned_cols=31  Identities=29%  Similarity=0.754  Sum_probs=21.2

Q ss_pred             CCcceEcCCCCcc-e---eech-hcchhhHHHHHHh
Q psy11507         39 RRLCLVCGDVASG-F---HYGV-ASCEACKAFFKRT   69 (113)
Q Consensus        39 ~~~C~VC~~~~~g-~---hyGv-~~C~~C~~FFRRs   69 (113)
                      ...|..|+...+. .   -.|. ..|++|..+|+..
T Consensus         3 ~~~C~~C~~~~T~~WR~g~~g~~~LCnaCgl~~~k~   38 (52)
T smart00401        3 GRSCSNCGTTETPLWRRGPSGNKTLCNACGLYYKKH   38 (52)
T ss_pred             CCCcCCCCCCCCCccccCCCCCCcEeecccHHHHHc
Confidence            4568888854332 2   3443 7899999999764


No 50 
>PRK04179 rpl37e 50S ribosomal protein L37e; Reviewed
Probab=37.46  E-value=28  Score=21.78  Aligned_cols=25  Identities=24%  Similarity=0.570  Sum_probs=20.7

Q ss_pred             CCCCcceEcCCCCcceeechhcchhhH
Q psy11507         37 LPRRLCLVCGDVASGFHYGVASCEACK   63 (113)
Q Consensus        37 ~~~~~C~VC~~~~~g~hyGv~~C~~C~   63 (113)
                      .++.+|..||..+  +|.--..|.+|.
T Consensus        15 ~tHt~CrRCG~~s--yh~qK~~CasCG   39 (62)
T PRK04179         15 KTHIRCRRCGRHS--YNVRKKYCAACG   39 (62)
T ss_pred             cccchhcccCccc--ccccccchhhcC
Confidence            3688999999885  888888898885


No 51 
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=31.33  E-value=31  Score=19.92  Aligned_cols=14  Identities=43%  Similarity=1.108  Sum_probs=10.4

Q ss_pred             CCCCCCcceEcCCC
Q psy11507         35 EELPRRLCLVCGDV   48 (113)
Q Consensus        35 ~~~~~~~C~VC~~~   48 (113)
                      ...+..+|.||+.+
T Consensus         4 ~~lp~K~C~~C~rp   17 (42)
T PF10013_consen    4 SNLPSKICPVCGRP   17 (42)
T ss_pred             ccCCCCcCcccCCc
Confidence            35567889999875


No 52 
>PF00320 GATA:  GATA zinc finger;  InterPro: IPR000679 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents GATA-type zinc fingers (Znf). A number of transcription factors (including erythroid-specific transcription factor and nitrogen regulatory proteins), specifically bind the DNA sequence (A/T)GATA(A/G) [] in the regulatory regions of genes. They are consequently termed GATA-binding transcription factors. The interactions occur via highly-conserved Znf domains in which the zinc ion is coordinated by 4 cysteine residues [, ]. NMR studies have shown the core of the Znf to comprise 2 irregular anti-parallel beta-sheets and an alpha-helix, followed by a long loop to the C-terminal end of the finger. The N-terminal part, which includes the helix, is similar in structure, but not sequence, to the N-terminal zinc module of the glucocorticoid receptor DNA-binding domain. The helix and the loop connecting the 2 beta-sheets interact with the major groove of the DNA, while the C-terminal tail wraps around into the minor groove. It is this tail that is the essential determinant of specific binding. Interactions between the Znf and DNA are mainly hydrophobic, explaining the preponderance of thymines in the binding site; a large number of interactions with the phosphate backbone have also been observed []. Two GATA zinc fingers are found in the GATA transcription factors. However there are several proteins which only contains a single copy of the domain. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0008270 zinc ion binding, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 3GAT_A 2GAT_A 1GAU_A 1GAT_A 1Y0J_A 1GNF_A 2L6Z_A 2L6Y_A 3DFV_D 3DFX_B ....
Probab=29.63  E-value=33  Score=18.57  Aligned_cols=16  Identities=31%  Similarity=0.802  Sum_probs=12.1

Q ss_pred             echh-cchhhHHHHHHh
Q psy11507         54 YGVA-SCEACKAFFKRT   69 (113)
Q Consensus        54 yGv~-~C~~C~~FFRRs   69 (113)
                      .|.. .|++|-.+|++.
T Consensus        17 ~g~~~LCn~Cg~~~kk~   33 (36)
T PF00320_consen   17 NGNRTLCNACGLYYKKY   33 (36)
T ss_dssp             TSEE-EEHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHh
Confidence            3444 899999999764


No 53 
>KOG3506|consensus
Probab=29.49  E-value=33  Score=21.00  Aligned_cols=30  Identities=27%  Similarity=0.504  Sum_probs=22.0

Q ss_pred             CCCCCCCcceEcCCCC-cceeechhcchhhH
Q psy11507         34 EEELPRRLCLVCGDVA-SGFHYGVASCEACK   63 (113)
Q Consensus        34 ~~~~~~~~C~VC~~~~-~g~hyGv~~C~~C~   63 (113)
                      +-.+-...|.||.+.. ---.||...|.-|-
T Consensus        13 kfg~GsrsC~vCsn~~gLIrKYGL~vcr~cf   43 (56)
T KOG3506|consen   13 KFGQGSRSCRVCSNRHGLIRKYGLNVCRQCF   43 (56)
T ss_pred             ccCCCCcceeeeccchhHHHHhhhHHhHHHH
Confidence            3344567899999764 44689999888774


No 54 
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=29.14  E-value=20  Score=18.59  Aligned_cols=21  Identities=33%  Similarity=0.760  Sum_probs=14.6

Q ss_pred             cceEcCCCCcceeechhcchhhH
Q psy11507         41 LCLVCGDVASGFHYGVASCEACK   63 (113)
Q Consensus        41 ~C~VC~~~~~g~hyGv~~C~~C~   63 (113)
                      .|.||++...++.  ...|..|.
T Consensus         2 ~C~~C~~~~~~~~--~Y~C~~c~   22 (30)
T PF03107_consen    2 WCDVCRRKIDGFY--FYHCSECC   22 (30)
T ss_pred             CCCCCCCCcCCCE--eEEeCCCC
Confidence            4889988888873  34666654


No 55 
>COG2126 RPL37A Ribosomal protein L37E [Translation, ribosomal structure and biogenesis]
Probab=28.64  E-value=31  Score=21.42  Aligned_cols=35  Identities=23%  Similarity=0.497  Sum_probs=23.6

Q ss_pred             CCCCCCCCCCCCCCCcceEcCCCCcceeechhcchhhH
Q psy11507         26 RGSTDGIKEEELPRRLCLVCGDVASGFHYGVASCEACK   63 (113)
Q Consensus        26 ~~s~~~~~~~~~~~~~C~VC~~~~~g~hyGv~~C~~C~   63 (113)
                      ++++-..... .++..|.-||..+  +|---..|.+|.
T Consensus         4 GT~S~GKrnk-~tH~~CRRCGr~s--yhv~k~~CaaCG   38 (61)
T COG2126           4 GTPSFGKRNK-KTHIRCRRCGRRS--YHVRKKYCAACG   38 (61)
T ss_pred             CCccccccCC-cceehhhhccchh--eeeccceecccC
Confidence            3344343333 6678899999887  676677888885


No 56 
>PF10764 Gin:  Inhibitor of sigma-G Gin;  InterPro: IPR019700  Gin allows sigma-F to delay late forespore transcription by preventing sigma-G to take over before the cell has reached a critical stage of development. Gin is also known as CsfB []. 
Probab=28.22  E-value=44  Score=19.40  Aligned_cols=24  Identities=33%  Similarity=0.955  Sum_probs=18.5

Q ss_pred             cceEcCCC-Ccc-eeechhcchhhHH
Q psy11507         41 LCLVCGDV-ASG-FHYGVASCEACKA   64 (113)
Q Consensus        41 ~C~VC~~~-~~g-~hyGv~~C~~C~~   64 (113)
                      .|.||++. ..| .-+|...|..|-.
T Consensus         1 ~CiiC~~~~~~GI~I~~~fIC~~CE~   26 (46)
T PF10764_consen    1 KCIICGKEKEEGIHIYGKFICSDCEK   26 (46)
T ss_pred             CeEeCCCcCCCCEEEECeEehHHHHH
Confidence            38999975 446 4689999999963


No 57 
>KOG0706|consensus
Probab=28.02  E-value=28  Score=29.63  Aligned_cols=31  Identities=26%  Similarity=0.759  Sum_probs=25.4

Q ss_pred             CCCcceEcCCCC---cceeechhcchhhHHHHHH
Q psy11507         38 PRRLCLVCGDVA---SGFHYGVASCEACKAFFKR   68 (113)
Q Consensus        38 ~~~~C~VC~~~~---~g~hyGv~~C~~C~~FFRR   68 (113)
                      ..+.|.-|+.+.   ....||+..|--|.+-+|.
T Consensus        22 ~NKvCFDCgAknPtWaSVTYGIFLCiDCSAvHRn   55 (454)
T KOG0706|consen   22 ENKVCFDCGAKNPTWASVTYGIFLCIDCSAVHRN   55 (454)
T ss_pred             CCceecccCCCCCCceeecceEEEEEecchhhhc
Confidence            467899999764   4579999999999998754


No 58 
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=26.96  E-value=31  Score=21.20  Aligned_cols=32  Identities=22%  Similarity=0.658  Sum_probs=20.8

Q ss_pred             CCCcceEcCCCCcceeechhcc-hhhHHHHHHhHhh
Q psy11507         38 PRRLCLVCGDVASGFHYGVASC-EACKAFFKRTIQA   72 (113)
Q Consensus        38 ~~~~C~VC~~~~~g~hyGv~~C-~~C~~FFRRsv~~   72 (113)
                      +++.|.+||.+--.   .-..| ..|+.-+++...+
T Consensus         2 ~HkHC~~CG~~Ip~---~~~fCS~~C~~~~~k~qk~   34 (59)
T PF09889_consen    2 PHKHCPVCGKPIPP---DESFCSPKCREEYRKRQKR   34 (59)
T ss_pred             CCCcCCcCCCcCCc---chhhhCHHHHHHHHHHHHH
Confidence            57899999976432   23345 5788777655443


No 59 
>COG5347 GTPase-activating protein that regulates ARFs (ADP-ribosylation factors), involved in ARF-mediated vesicular transport [Intracellular trafficking and secretion]
Probab=26.49  E-value=29  Score=28.13  Aligned_cols=31  Identities=23%  Similarity=0.596  Sum_probs=25.1

Q ss_pred             CCCcceEcCCCC---cceeechhcchhhHHHHHH
Q psy11507         38 PRRLCLVCGDVA---SGFHYGVASCEACKAFFKR   68 (113)
Q Consensus        38 ~~~~C~VC~~~~---~g~hyGv~~C~~C~~FFRR   68 (113)
                      ....|.-|+.+.   ....|||+.|--|++-.|-
T Consensus        19 ~Nk~CaDCga~~P~W~S~nlGvfiCi~CagvHRs   52 (319)
T COG5347          19 SNKKCADCGAPNPTWASVNLGVFLCIDCAGVHRS   52 (319)
T ss_pred             ccCccccCCCCCCceEecccCeEEEeecchhhhc
Confidence            356799999876   3479999999999998654


No 60 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=25.29  E-value=29  Score=18.69  Aligned_cols=14  Identities=21%  Similarity=0.589  Sum_probs=9.4

Q ss_pred             CCCcceEcCCCCcc
Q psy11507         38 PRRLCLVCGDVASG   51 (113)
Q Consensus        38 ~~~~C~VC~~~~~g   51 (113)
                      ++..|.||+.+...
T Consensus        17 ~p~~CP~Cg~~~~~   30 (34)
T cd00729          17 APEKCPICGAPKEK   30 (34)
T ss_pred             CCCcCcCCCCchHH
Confidence            35578888876543


No 61 
>PHA03124 dUTPase; Provisional
Probab=23.92  E-value=44  Score=28.08  Aligned_cols=15  Identities=40%  Similarity=1.023  Sum_probs=12.6

Q ss_pred             hcchhhHHHHHHhHh
Q psy11507         57 ASCEACKAFFKRTIQ   71 (113)
Q Consensus        57 ~~C~~C~~FFRRsv~   71 (113)
                      .-|.+|++||||...
T Consensus       191 ~~~~~~~~~~~~~~~  205 (418)
T PHA03124        191 FGCMGCKAFYRRLFE  205 (418)
T ss_pred             ccccchHHHHHHHHH
Confidence            359999999999865


No 62 
>COG4068 Uncharacterized protein containing a Zn-ribbon [Function unknown]
Probab=23.62  E-value=53  Score=20.47  Aligned_cols=14  Identities=43%  Similarity=1.082  Sum_probs=11.0

Q ss_pred             CCCCCCcceEcCCC
Q psy11507         35 EELPRRLCLVCGDV   48 (113)
Q Consensus        35 ~~~~~~~C~VC~~~   48 (113)
                      ...+++.|.|||+.
T Consensus         4 ~v~PH~HC~VCg~a   17 (64)
T COG4068           4 GVVPHRHCVVCGKA   17 (64)
T ss_pred             CCCCCccccccCCc
Confidence            34578899999975


No 63 
>PF10705 Ycf15:  Chloroplast protein precursor Ycf15 putative;  InterPro: IPR019645  In some species of plants the ycf15 gene is probably not a protein-coding gene because the protein in these species has premature stop codons. Most of the members of the family are hypothetical or uncharacterised []. 
Probab=23.40  E-value=25  Score=23.44  Aligned_cols=7  Identities=29%  Similarity=0.653  Sum_probs=5.8

Q ss_pred             CCCCCCc
Q psy11507          1 MLRWSSK    7 (113)
Q Consensus         1 ~~~~~~~    7 (113)
                      ||.|||-
T Consensus        33 mygwyel   39 (93)
T PF10705_consen   33 MYGWYEL   39 (93)
T ss_pred             chhhhhc
Confidence            8999974


No 64 
>PF00357 Integrin_alpha:  Integrin alpha cytoplasmic region;  InterPro: IPR018184 Some alpha subunits are cleaved post- translationally to produce a heavy and a light chain linked by a disulphide bond [, ]. Integrin alpha chains share a conserved sequence which is found at the beginning of the cytoplasmic domain, just after the end of the transmembrane region. Within the N-terminal domain of alpha subunits, seven sequence repeats, each of approximately 60 amino acids, have been found []. It has been predicted that these repeats assume the beta-propeller fold. The domains contain seven four-stranded beta-sheets arranged in a torus around a pseudosymmetry axis []. Integrin ligands and a putative Mg2+ ion are predicted to bind to the upper face of the propeller, in a manner analogous to the way in which the trimeric G-protein beta subunit (G beta) (which also has a beta-propeller fold) binds the G protein alpha subunit []. Integrin cytoplasmic domains are normally less than 50 amino acids in length, with the beta-subunit sequences exhibiting greater homology to each other than the alpha-subunit sequences []. This is consistent with current evidence that the beta subunit is the principal site for binding of cytoskeletal and signalling molecules, whereas the alpha subunit has a regulatory role. The first ten residues of the alpha-subunit cytoplasmic domain appear to form an alpha helix that is terminated by a proline residue. The remainder of the domain is highly acidic in nature and this loops back to contact the membrane-proximal lysine anchor residue. This entry represents the conserved site of the C-terminal integrin alpha chain. ; PDB: 2LKJ_A 2LKE_A 2K8O_A 1DPK_A 2K9J_A 1DPQ_A 1S4W_A 1M8O_A 2K1A_A 2KNC_A ....
Probab=20.34  E-value=50  Score=14.96  Aligned_cols=9  Identities=44%  Similarity=0.744  Sum_probs=6.5

Q ss_pred             HHHHHhHhh
Q psy11507         64 AFFKRTIQA   72 (113)
Q Consensus        64 ~FFRRsv~~   72 (113)
                      +||+|....
T Consensus         3 GFFKR~~~~   11 (15)
T PF00357_consen    3 GFFKRQRPP   11 (15)
T ss_dssp             CHHHHHHHH
T ss_pred             ccccccCcc
Confidence            589987654


No 65 
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=20.21  E-value=43  Score=18.36  Aligned_cols=24  Identities=29%  Similarity=0.552  Sum_probs=13.4

Q ss_pred             CCcceEcCCCCcceeechhcchhh
Q psy11507         39 RRLCLVCGDVASGFHYGVASCEAC   62 (113)
Q Consensus        39 ~~~C~VC~~~~~g~hyGv~~C~~C   62 (113)
                      ..+|.+|+..-....=|-..|..|
T Consensus         8 ~~~C~~C~~~~~~~~dG~~yC~~c   31 (36)
T PF11781_consen    8 NEPCPVCGSRWFYSDDGFYYCDRC   31 (36)
T ss_pred             CCcCCCCCCeEeEccCCEEEhhhC
Confidence            456999987633334444445444


No 66 
>PF13901 DUF4206:  Domain of unknown function (DUF4206)
Probab=20.14  E-value=35  Score=25.45  Aligned_cols=34  Identities=21%  Similarity=0.562  Sum_probs=24.9

Q ss_pred             CcceEcCCCCcc--eee-chhcchhhHHHHHHhHhhc
Q psy11507         40 RLCLVCGDVASG--FHY-GVASCEACKAFFKRTIQAR   73 (113)
Q Consensus        40 ~~C~VC~~~~~g--~hy-Gv~~C~~C~~FFRRsv~~~   73 (113)
                      ..|.+|.+...-  +.. ++.-|..|.+.|.+....+
T Consensus       153 fiCe~C~~~~~IfPF~~~~~~~C~~C~~v~H~~C~~~  189 (202)
T PF13901_consen  153 FICEICNSDDIIFPFQIDTTVRCPKCKSVFHKSCFRK  189 (202)
T ss_pred             CCCccCCCCCCCCCCCCCCeeeCCcCccccchhhcCC
Confidence            469999866544  444 6788999999998765543


Done!