RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy11507
         (113 letters)



>gnl|CDD|143544 cd07170, NR_DBD_ERR, DNA-binding domain of estrogen related
          receptors (ERR) is composed of two C4-type zinc
          fingers.  DNA-binding domain of estrogen related
          receptors (ERRs) is composed of two C4-type zinc
          fingers. Each zinc finger contains a group of four Cys
          residues which coordinates a single zinc atom. ERR
          interacts with the palindromic inverted repeat,
          5'GGTCAnnnTGACC-3', upstream of the target gene and
          modulates the rate of transcriptional initiation. The
          estrogen receptor-related receptors (ERRs) are
          transcriptional regulators, which are closely related
          to the estrogen receptor (ER) family.  Although ERRs
          lack the ability to bind to estrogen and are so-called
          orphan receptors, they share target genes,
          co-regulators and promoters with the estrogen receptor
          (ER) family. By targeting the same set of genes, ERRs
          seem to interfere with the classic ER-mediated estrogen
          response in various ways. Like other members of the
          nuclear receptor (NR) superfamily of ligand-activated
          transcription factors, ERR has a central well conserved
          DNA binding domain (DBD), a variable N-terminal domain,
          a non-conserved hinge and a C-terminal ligand binding
          domain (LBD).
          Length = 97

 Score = 77.6 bits (191), Expect = 4e-20
 Identities = 31/34 (91%), Positives = 34/34 (100%)

Query: 38 PRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQ 71
          P+RLCLVCGD+ASG+HYGVASCEACKAFFKRTIQ
Sbjct: 3  PKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQ 36


>gnl|CDD|143530 cd07155, NR_DBD_ER_like, DNA-binding domain of estrogen receptor
          (ER) and estrogen related receptors (ERR) is composed
          of two C4-type zinc fingers.  DNA-binding domains of
          estrogen receptor (ER) and estrogen related receptors
          (ERR) are composed of two C4-type zinc fingers. Each
          zinc finger contains a group of four Cys residues which
          co-ordinates a single zinc atom. ER and ERR interact
          with the palindromic inverted repeat,
          5'GGTCAnnnTGACC-3', upstream of the target gene and
          modulate the rate of transcriptional initiation. ERR
          and ER are closely related and share sequence
          similarity, target genes, co-regulators and promoters.
          While ER is activated by endogenous estrogen, ERR lacks
          the ability to bind to estrogen. Estrogen receptor
          mediates the biological effects of hormone estrogen by
          the binding of the receptor dimer to estrogen response
          element of target genes.  However, ERRs seem to
          interfere with the classic ER-mediated estrogen
          responsive signaling by targeting the same set of
          genes. ERRs and ERs exhibit the common modular
          structure with other nuclear receptors. They have a
          central highly conserved DNA binding domain (DBD), a
          non-conserved N-terminal domain, a flexible hinge and a
          C-terminal ligand binding domain (LBD).
          Length = 75

 Score = 72.5 bits (178), Expect = 2e-18
 Identities = 28/30 (93%), Positives = 30/30 (100%)

Query: 42 CLVCGDVASGFHYGVASCEACKAFFKRTIQ 71
          CLVCGD+ASG+HYGVASCEACKAFFKRTIQ
Sbjct: 1  CLVCGDIASGYHYGVASCEACKAFFKRTIQ 30


>gnl|CDD|201004 pfam00105, zf-C4, Zinc finger, C4 type (two domains).  In nearly
          all cases, this is the DNA binding domain of a nuclear
          hormone receptor. The alignment contains two Zinc
          finger domains that are too dissimilar to be aligned
          with each other.
          Length = 70

 Score = 70.7 bits (174), Expect = 1e-17
 Identities = 22/32 (68%), Positives = 26/32 (81%)

Query: 40 RLCLVCGDVASGFHYGVASCEACKAFFKRTIQ 71
           LC VCGD ASG+HYGV +CE CK FF+R+IQ
Sbjct: 1  ELCKVCGDKASGYHYGVLTCEGCKGFFRRSIQ 32


>gnl|CDD|143512 cd06916, NR_DBD_like, DNA-binding domain of nuclear receptors is
          composed of two C4-type zinc fingers.  DNA-binding
          domain of nuclear receptors is composed of two C4-type
          zinc fingers. Each zinc finger contains a group of four
          Cys residues which co-ordinates a single zinc atom. It
          interacts with a specific DNA site upstream of the
          target gene and modulates the rate of transcriptional
          initiation. Nuclear receptors form a superfamily of
          ligand-activated transcription regulators, which
          regulate various physiological functions, from
          development, reproduction, to homeostasis and
          metabolism in animals (metazoans). The family contains
          not only receptors for known ligands but also orphan
          receptors for which ligands do not exist or have not
          been identified. NRs share a common structural
          organization with a central well conserved DNA binding
          domain (DBD), a variable N-terminal domain, a flexible
          hinge and a C-terminal ligand binding domain (LBD).
          Most nuclear receptors bind as homodimers or
          heterodimers to their target sites, which consist of
          two hexameric half-sites. Specificity is determined by
          the half-site sequence, the relative orientation of the
          half-sites and the number of spacer nucleotides between
          the half-sites. However, a growing number of nuclear
          receptors have been reported to bind to DNA as
          monomers.
          Length = 72

 Score = 70.7 bits (174), Expect = 1e-17
 Identities = 19/36 (52%), Positives = 25/36 (69%)

Query: 42 CLVCGDVASGFHYGVASCEACKAFFKRTIQARASLV 77
          C VCGD ASG+HYGV +CE CK FF+R+++      
Sbjct: 1  CAVCGDKASGYHYGVLTCEGCKGFFRRSVRRNLEYT 36


>gnl|CDD|197701 smart00399, ZnF_C4, c4 zinc finger in nuclear hormone receptors. 
          Length = 70

 Score = 65.2 bits (160), Expect = 1e-15
 Identities = 24/33 (72%), Positives = 27/33 (81%)

Query: 41 LCLVCGDVASGFHYGVASCEACKAFFKRTIQAR 73
          LC VCGD ASGFH+GV SC ACKAFF+RT+  R
Sbjct: 1  LCCVCGDHASGFHFGVCSCRACKAFFRRTVNLR 33


>gnl|CDD|143545 cd07171, NR_DBD_ER, DNA-binding domain of estrogen receptors (ER)
          is composed of two C4-type zinc fingers.  DNA-binding
          domain of estrogen receptors (ER) is composed of two
          C4-type zinc fingers. Each zinc finger contains a group
          of four Cys residues which coordinates a single zinc
          atom. ER interacts with specific DNA sites upstream of
          the target gene and modulates the rate of
          transcriptional initiation. Estrogen receptor is a
          transcription regulator that mediates the biological
          effects of hormone estrogen. The binding of estrogen to
          the receptor triggers the dimerization and the binding
          of the receptor dimer to estrogen response element,
          which is a palindromic inverted repeat:
          5'GGTCAnnnTGACC-3', of target genes. Through ER,
          estrogen regulates development, reproduction and
          homeostasis. Like other members of the nuclear receptor
          (NR) superfamily of ligand-activated transcription
          factors, ER  has  a central well-conserved DNA binding
          domain (DBD), a variable N-terminal domain, a
          non-conserved hinge and a C-terminal ligand binding
          domain (LBD).
          Length = 82

 Score = 64.5 bits (157), Expect = 4e-15
 Identities = 23/34 (67%), Positives = 25/34 (73%)

Query: 38 PRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQ 71
              C VC D ASG+HYGV SCE CKAFFKR+IQ
Sbjct: 2  DTHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQ 35


>gnl|CDD|143518 cd06960, NR_DBD_HNF4A, DNA-binding domain of heptocyte nuclear
          factor 4 (HNF4) is composed of two C4-type zinc
          fingers.  DNA-binding domain of hepatocyte nuclear
          factor 4 (HNF4) is composed of two C4-type zinc
          fingers. Each zinc finger contains a group of four Cys
          residues which co-ordinates a single zinc atom. HNF4
          interacts with a DNA site, composed of two direct
          repeats of AGTTCA with 1 bp spacer, which is upstream
          of target genes and modulates the rate of
          transcriptional initiation. HNF4 is a member of the
          nuclear receptor superfamily. HNF4 plays a key role in
          establishing and maintenance of hepatocyte
          differentiation in the liver. It is also expressed in
          gut, kidney, and pancreatic beta cells. HNF4 was
          originally classified as an orphan receptor, but later
          it is found that HNF4 binds with very high affinity to
          a variety of fatty acids. However, unlike other nuclear
          receptors, the ligands do not act as a molecular switch
          for HNF4. They seem to constantly bind to the receptor,
          which is constitutively active as a transcription
          activator. Like other members of the nuclear receptor
          (NR) superfamily of ligand-activated transcription
          factors, HNF4  has a central well conserved DNA binding
          domain (DBD), a variable N-terminal domain, a flexible
          hinge and a C-terminal ligand binding domain (LBD).
          Length = 76

 Score = 61.1 bits (149), Expect = 7e-14
 Identities = 18/29 (62%), Positives = 22/29 (75%)

Query: 42 CLVCGDVASGFHYGVASCEACKAFFKRTI 70
          C VCGD A+G HYGV SC  CK FF+R++
Sbjct: 1  CAVCGDRATGKHYGVLSCNGCKGFFRRSV 29


>gnl|CDD|143540 cd07166, NR_DBD_REV_ERB, DNA-binding domain of REV-ERB
          receptor-like is composed of two C4-type zinc fingers. 
          DNA-binding domain of REV-ERB receptor- like is
          composed of two C4-type zinc fingers. Each zinc finger
          contains a group of four Cys residues which coordinates
          a single zinc atom. This domain interacts with specific
          DNA sites upstream of the target gene and modulates the
          rate of transcriptional initiation. REV-ERB receptors
          are transcriptional regulators belonging to the nuclear
          receptor superfamily. They regulate a number of
          physiological functions including the circadian rhythm,
          lipid metabolism, and cellular differentiation. REV-ERB
          receptors bind as a monomer to a (A/G)GGTCA half-site
          with a 5' AT-rich extension or as a homodimer to a
          direct repeat 2 element (AGGTCA sequence with a 2-bp
          spacer), indicating functional diversity. When bound to
          the DNA, they recruit corepressors (NcoR/histone
          deacetylase 3) to the promoter, resulting in repression
          of the target genes. The porphyrin heme has been
          demonstrated to function as a ligand for REV-ERB
          receptor. Like other members of the nuclear receptor
          (NR) superfamily of ligand-activated transcription
          factors, REV-ERB receptors have a central well
          conserved DNA binding domain (DBD), a variable
          N-terminal domain, a non-conserved hinge and a
          C-terminal ligand binding domain (LBD).
          Length = 89

 Score = 61.4 bits (149), Expect = 8e-14
 Identities = 23/31 (74%), Positives = 26/31 (83%)

Query: 41 LCLVCGDVASGFHYGVASCEACKAFFKRTIQ 71
          LC VCGD ASGFHYGV +CE CK FF+R+IQ
Sbjct: 5  LCKVCGDKASGFHYGVHACEGCKGFFRRSIQ 35


>gnl|CDD|143533 cd07158, NR_DBD_Ppar_like, The DNA-binding domain of peroxisome
          proliferator-activated receptors (PPAR) like nuclear
          receptor family.  The DNA-binding domain of peroxisome
          proliferator-activated receptors (PPAR) like nuclear
          receptor family is composed of two C4-type zinc
          fingers. Each zinc finger contains a group of four Cys
          residues which co-ordinates a single zinc atom. These
          domains interact with specific DNA sites upstream of
          the target gene and modulate the rate of
          transcriptional initiation. This family includes three
          known types of nuclear receptors: peroxisome
          proliferator-activated receptors (PPAR), REV-ERB
          receptors and Drosophila ecdysone-induced protein 78
          (E78). Like other members of the nuclear receptor (NR)
          superfamily of ligand-activated transcription factors,
          PPAR-like receptors have a central well conserved DNA
          binding domain (DBD), a variable N-terminal domain, a
          non-conserved hinge and a C-terminal ligand binding
          domain (LBD).
          Length = 73

 Score = 60.7 bits (147), Expect = 9e-14
 Identities = 24/30 (80%), Positives = 25/30 (83%)

Query: 42 CLVCGDVASGFHYGVASCEACKAFFKRTIQ 71
          C VCGD ASGFHYGV SCE CK FF+RTIQ
Sbjct: 1  CKVCGDKASGFHYGVHSCEGCKGFFRRTIQ 30


>gnl|CDD|143519 cd06961, NR_DBD_TR, DNA-binding domain of thyroid hormone
          receptors (TRs) is composed of two C4-type zinc
          fingers.  DNA-binding domain of thyroid hormone
          receptors (TRs) is composed of two C4-type zinc
          fingers. Each zinc finger contains a group of four Cys
          residues which co-ordinates a single zinc atom. TR
          interacts with the thyroid response element, which is a
          DNA site with direct repeats of the consensus sequence
          5'-AGGTCA-3' separated by one to five base pairs,
          upstream of target genes and modulates the rate of
          transcriptional initiation. Thyroid hormone receptor
          (TR) mediates the actions of thyroid hormones, which
          play critical roles in growth, development, and
          homeostasis in mammals. They regulate overall metabolic
          rate, cholesterol and triglyceride levels, and heart
          rate, and affect mood. TRs are expressed from two
          separate genes (alpha and beta) in human and each gene
          generates two isoforms of the receptor through
          differential promoter usage or splicing. TRalpha
          functions in the heart to regulate heart rate and
          rhythm and TRbeta is active in the liver and other
          tissues. The unliganded TRs function as transcription
          repressors, by binding to thyroid hormone response
          elements (TRE) predominantly as homodimers, or as
          heterodimers with retinoid X-receptors (RXR), and being
          associated with a complex of proteins containing
          corepressor proteins. Ligand binding promotes
          corepressor dissociation and binding of a coactivator
          to activate transcription. Like other members of the
          nuclear receptor (NR) superfamily of ligand-activated
          transcription factors, TR has a central well conserved
          DNA binding domain (DBD), a variable N-terminal domain,
          a flexible hinge and a C-terminal ligand binding domain
          (LBD).
          Length = 85

 Score = 59.7 bits (145), Expect = 3e-13
 Identities = 18/31 (58%), Positives = 24/31 (77%)

Query: 41 LCLVCGDVASGFHYGVASCEACKAFFKRTIQ 71
           C+VCGD A+G+HY   +CE CK FF+RT+Q
Sbjct: 1  PCVVCGDKATGYHYRCITCEGCKGFFRRTVQ 31


>gnl|CDD|143517 cd06959, NR_DBD_EcR_like, The DNA-binding domain of Ecdysone
          receptor (EcR) like nuclear receptor family is composed
          of two C4-type zinc fingers.  The DNA-binding domain of
          Ecdysone receptor (EcR) like nuclear receptor family is
          composed of two C4-type zinc fingers. Each zinc finger
          contains a group of four Cys residues which
          co-ordinates a single zinc atom. EcR interacts with
          specific DNA sites upstream of the target gene and
          modulates the rate of transcriptional initiation. This
          family includes three types of nuclear receptors:
          Ecdysone receptor (EcR), Liver X receptor (LXR) and
          Farnesoid X receptor (FXR). The DNA binding activity is
          regulated by their corresponding ligands. The ligands
          for EcR are ecdysteroids; LXR is regulated by oxidized
          cholesterol derivatives or oxysterols; and bile acids
          control FXR's activities. Like other members of the
          nuclear receptor (NR) superfamily of ligand-activated
          transcription factors, EcR-like receptors have  a
          central well conserved DNA binding domain (DBD), a
          variable N-terminal domain, a flexible hinge and a
          C-terminal ligand binding domain (LBD).
          Length = 73

 Score = 58.6 bits (142), Expect = 6e-13
 Identities = 21/31 (67%), Positives = 25/31 (80%)

Query: 41 LCLVCGDVASGFHYGVASCEACKAFFKRTIQ 71
           C+VCGD ASGFHYGV SCE CK FF+R++ 
Sbjct: 1  NCVVCGDKASGFHYGVLSCEGCKGFFRRSVT 31


>gnl|CDD|143523 cd06965, NR_DBD_Ppar, DNA-binding domain of peroxisome
          proliferator-activated receptors (PPAR) is composed of
          two C4-type zinc fingers.  DNA-binding domain of
          peroxisome proliferator-activated receptors (PPAR) is
          composed of two C4-type zinc fingers. Each zinc finger
          contains a group of four Cys residues which
          co-ordinates a single zinc atom. PPAR interacts with
          specific DNA sites upstream of the target gene and
          modulates the rate of transcriptional initiation.
          Peroxisome proliferator-activated receptors (PPARs) are
          members of the nuclear receptor superfamily of
          ligand-activated transcription factors. PPARs play
          important roles in regulating cellular differentiation,
          development and lipid metabolism. Activated PPAR forms
          a heterodimer with the retinoid X receptor (RXR) that
          binds to the hormone response elements, which are
          composed of two direct repeats of the consensus
          sequence 5'-AGGTCA-3' separated by one to five base
          pair located upstream of the peroxisome proliferator
          responsive genes, and interacts with co-activators.
          Several essential fatty acids, oxidized lipids and
          prostaglandin J derivatives can bind and activate PPAR.
           Like other members of the nuclear receptor (NR)
          superfamily of ligand-activated transcription factors,
          PPAR has a central well conserved DNA binding domain
          (DBD), a variable N-terminal regulatory domain, a
          flexible hinge and a C-terminal ligand binding domain
          (LBD).
          Length = 84

 Score = 58.6 bits (142), Expect = 9e-13
 Identities = 22/31 (70%), Positives = 25/31 (80%)

Query: 41 LCLVCGDVASGFHYGVASCEACKAFFKRTIQ 71
           C VCGD ASGFHYGV +CE CK FF+RTI+
Sbjct: 1  ECRVCGDKASGFHYGVHACEGCKGFFRRTIR 31


>gnl|CDD|143539 cd07165, NR_DBD_DmE78_like, DNA-binding domain of Drosophila
          ecdysone-induced protein 78 (E78) like is composed of
          two C4-type zinc fingers.  DNA-binding domain of
          proteins similar to Drosophila ecdysone-induced protein
          78 (E78) is composed of two C4-type zinc fingers. Each
          zinc finger contains a group of four Cys residues which
          coordinates a single zinc atom. E78 interacts with
          specific DNA sites upstream of the target gene and
          modulates the rate of transcriptional initiation.
          Drosophila ecdysone-induced protein 78 (E78) is a
          transcription factor belonging to the nuclear receptor
          superfamily.  E78 is a product of the
          ecdysone-inducible gene found in an early late puff
          locus at position 78C during the onset of Drosophila
          metamorphosis. An E78 orthologue from the Platyhelminth
          Schistosoma mansoni (SmE78) has also been identified.
          It is the first E78 orthologue known outside of the
          molting animals--the Ecdysozoa. The SmE78 may be
          involved in transduction of an ecdysone signal in S.
          mansoni, consistent with its function in Drosophila.
          Like other members of the nuclear receptor (NR)
          superfamily of ligand-activated transcription factors,
          E78-like receptors have a central well conserved
          DNA-binding domain (DBD), a variable N-terminal domain,
          a non-conserved hinge and a C-terminal ligand binding
          domain (LBD).
          Length = 81

 Score = 58.3 bits (141), Expect = 1e-12
 Identities = 24/40 (60%), Positives = 28/40 (70%)

Query: 42 CLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLRG 81
          C VCGD ASG+HYGV SCE CK FF+R+IQ +     LR 
Sbjct: 1  CKVCGDKASGYHYGVTSCEGCKGFFRRSIQKQIEYRCLRD 40


>gnl|CDD|143542 cd07168, NR_DBD_DHR4_like, DNA-binding domain of ecdysone-induced
          DHR4 orphan nuclear receptor is composed of two C4-type
          zinc fingers.  DNA-binding domain of ecdysone-induced
          DHR4 orphan nuclear receptor is composed of two C4-type
          zinc fingers. Each zinc finger contains a group of four
          Cys residues which coordinates a single zinc atom. This
          domain interacts with specific DNA sites upstream of
          the target gene and modulates the rate of
          transcriptional initiation. Ecdysone-induced orphan
          receptor DHR4 is a member of the nuclear receptor
          family. DHR4 is expressed during the early Drosophila
          larval development and is induced by ecdysone. DHR4
          coordinates growth and maturation in Drosophila by
          mediating endocrine response to the attainment of
          proper body size during larval development. Mutations
          in DHR4 result in shorter larval development which
          translates into smaller and lighter flies. Like other
          members of the nuclear receptor (NR) superfamily of
          ligand-activated transcription factors, DHR4  has a
          central well conserved DNA binding domain (DBD), a
          variable N-terminal domain, a flexible hinge and a
          C-terminal ligand binding domain (LBD).
          Length = 90

 Score = 58.3 bits (141), Expect = 1e-12
 Identities = 20/40 (50%), Positives = 29/40 (72%)

Query: 34 EEELPRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQAR 73
          +E+   +LC +C D A+G HYG+ +CE CK FFKRT+Q +
Sbjct: 1  DEDESPKLCSICEDKATGLHYGIITCEGCKGFFKRTVQNK 40


>gnl|CDD|143541 cd07167, NR_DBD_Lrh-1_like, The DNA-binding domain of Lrh-1 like
          nuclear receptor family like is composed of two C4-type
          zinc fingers.  The DNA-binding domain of Lrh-1 like
          nuclear receptor family like is composed of two C4-type
          zinc fingers. Each zinc finger contains a group of four
          Cys residues which co-ordinates a single zinc atom.
          This domain interacts with specific DNA sites upstream
          of the target gene and modulates the rate of
          transcriptional initiation. This nuclear receptor
          family includes at least three subgroups of receptors
          that function in embryo development and
          differentiation, and other processes. FTZ-F1 interacts
          with the cis-acting DNA motif of ftz gene, which is
          required at several stages of development.
          Particularly, FTZ-F1 regulated genes are strongly
          linked to steroid biosynthesis and sex-determination;
          LRH-1 is a regulator of bile-acid homeostasis,
          steroidogenesis, reverse cholesterol transport and the
          initial stages of embryonic development; SF-1 is an
          essential regulator of endocrine development and
          function and is considered a master regulator of
          reproduction; SF-1 functions cooperatively with other
          transcription factors to modulate gene expression.
          Phospholipids have been identified as potential ligand
          for LRH-1 and steroidogenic factor-1 (SF-1). However,
          the ligand for FTZ-F1 has not yet been identified. Most
          nuclear receptors function as homodimer or
          heterodimers. However, LRH-1 and SF-1 bind to DNA as
          monomers. Like other members of the nuclear receptor
          (NR) superfamily of ligand-activated transcription
          factors, receptors in this family  have  a central well
          conserved DNA-binding domain (DBD), a variable
          N-terminal domain, a flexible hinge and a C-terminal
          ligand binding domain (LBD).
          Length = 93

 Score = 58.2 bits (141), Expect = 2e-12
 Identities = 20/30 (66%), Positives = 25/30 (83%)

Query: 42 CLVCGDVASGFHYGVASCEACKAFFKRTIQ 71
          C VCGD  SG+HYG+ +CE+CK FFKRT+Q
Sbjct: 1  CPVCGDKVSGYHYGLLTCESCKGFFKRTVQ 30


>gnl|CDD|143527 cd06969, NR_DBD_NGFI-B, DNA-binding domain of the orphan nuclear
          receptor, nerve growth factor-induced-B.  DNA-binding
          domain (DBD) of the orphan nuclear receptor, nerve
          growth factor-induced-B (NGFI-B) is composed of two
          C4-type zinc fingers. Each zinc finger contains a group
          of four Cys residues which co-ordinates a single zinc
          atom. NGFI-B interacts with specific DNA sites upstream
          of the target gene and modulates the rate of
          transcriptional initiation. NGFI-B is a member of the
          nuclear-steroid receptor superfamily. NGFI-B is
          classified as an orphan receptor because no ligand has
          yet been identified. NGFI-B is an early immediate gene
          product of embryo development that is rapidly produced
          in response to a variety of cellular signals including
          nerve growth factor. It is involved in T-cell-mediated
          apoptosis, as well as neuronal differentiation and
          function. NGFI-B regulates transcription by binding to
          a specific DNA target upstream of its target genes and
          regulating the rate of transcriptional initiation.
          NGFI-B binds to the NGFI-B response element (NBRE)
          5'-(A/T)AAAGGTCA as a monomer. Like other members of
          the nuclear receptor (NR) superfamily of
          ligand-activated transcription factors, NGFI-B has  a
          central well-conserved DNA binding domain (DBD), a
          variable N-terminal domain, a flexible hinge and a
          C-terminal ligand binding domain (LBD).
          Length = 75

 Score = 57.5 bits (139), Expect = 2e-12
 Identities = 24/39 (61%), Positives = 27/39 (69%)

Query: 41 LCLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSL 79
          LC VCGD A+  HYGV +CE CK FFKRT+Q  A  V L
Sbjct: 2  LCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCL 40


>gnl|CDD|143522 cd06964, NR_DBD_RAR, DNA-binding domain of retinoic acid receptor
          (RAR) is composed of two C4-type zinc fingers.
          DNA-binding domain of retinoic acid receptor (RAR) is
          composed of two C4-type zinc fingers. Each zinc finger
          contains a group of four Cys residues which
          co-ordinates a single zinc atom. RAR interacts with
          specific DNA sites upstream of the target gene and
          modulates the rate of transcriptional initiation. RARs
          mediate the biological effect of retinoids, including
          both natural dietary vitamin A (retinol) metabolites
          and active synthetic analogs. Retinoids play key roles
          in a wide variety of essential biological processes,
          such as vertebrate embryonic morphogenesis and
          organogenesis, differentiation and apoptosis, and
          homeostasis. RAR function as a heterodimer with
          retinoic X receptor by binding to specific RAR response
          elements (RAREs), which are composed of two direct
          repeats of the consensus sequence 5'-AGGTCA-3'
          separated by one to five base pair and found in the
          promoter regions of retinoid target genes. Like other
          members of the nuclear receptor (NR) superfamily of
          ligand-activated transcription factors, retinoic acid
          receptors have a central well conserved DNA binding
          domain (DBD), a variable N-terminal domain, a
          non-conserved hinge and a C-terminal ligand binding
          domain (LBD).
          Length = 85

 Score = 57.6 bits (139), Expect = 2e-12
 Identities = 19/32 (59%), Positives = 26/32 (81%)

Query: 40 RLCLVCGDVASGFHYGVASCEACKAFFKRTIQ 71
          + C VC D +SG+HYGV++CE CK FF+R+IQ
Sbjct: 5  KPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQ 36


>gnl|CDD|143525 cd06967, NR_DBD_TR2_like, DNA-binding domain of the TR2 and TR4
          (human testicular receptor 2 and 4) is composed of two
          C4-type zinc fingers.  DNA-binding domain of the TR2
          and TR4 (human testicular receptor 2 and 4) is composed
          of two C4-type zinc fingers. Each zinc finger contains
          a group of four Cys residues which coordinates a single
          zinc atom. TR2 and TR4 interact with specific DNA sites
          upstream of the target gene and modulate the rate of
          transcriptional initiation. TR4 and TR2 are orphan
          nuclear receptors; the physiological ligand is as yet
          unidentified. TR2 is abundantly expressed in the
          androgen-sensitive prostate. TR4 transcripts are
          expressed in many tissues, including central nervous
          system, adrenal gland, spleen, thyroid gland, and
          prostate. It has been shown that human TR2 binds to a
          wide spectrum of natural hormone response elements
          (HREs) with distinct affinities suggesting that TR2 may
          cross-talk with other gene expression regulation
          systems. The genes responding to TR2 or TR4 include
          genes that are regulated by retinoic acid receptor,
          vitamin D receptor, and peroxisome
          proliferator-activated receptor. TR4/2 binds to HREs as
          dimers. Like other members of the nuclear receptor (NR)
          superfamily of ligand-activated transcription factors,
          TR2-like receptors  have  a central well conserved DNA
          binding domain (DBD), a variable N-terminal domain, a
          flexible hinge and a C-terminal ligand binding domain
          (LBD).
          Length = 87

 Score = 57.5 bits (139), Expect = 2e-12
 Identities = 23/37 (62%), Positives = 26/37 (70%)

Query: 37 LPRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQAR 73
           P  LC+VCGD ASG HYG  SCE CK FFKR+I+  
Sbjct: 1  QPVELCVVCGDKASGRHYGAVSCEGCKGFFKRSIRKN 37


>gnl|CDD|143543 cd07169, NR_DBD_GCNF_like, DNA-binding domain of Germ cell
          nuclear factor (GCNF) F1 is composed of two C4-type
          zinc fingers.  DNA-binding domain of Germ cell nuclear
          factor (GCNF) F1 is composed of two C4-type zinc
          fingers. Each zinc finger contains a group of four Cys
          residues which coordinates a single zinc atom. This
          domain interacts with specific DNA sites upstream of
          the target gene and modulates the rate of
          transcriptional initiation. GCNF is a transcription
          factor expressed in post-meiotic stages of developing
          male germ cells. In vitro, GCNF has the ability to bind
          to direct repeat elements of  5'-AGGTCA.AGGTCA-3', as
          well as to an extended half-site sequence
          5'-TCA.AGGTCA-3'. Like other members of the nuclear
          receptor (NR) superfamily of ligand-activated
          transcription factors, GCNF has  a central well
          conserved DNA-binding domain (DBD), a variable
          N-terminal domain, a flexible hinge and a C-terminal
          ligand binding domain (LBD).
          Length = 90

 Score = 56.0 bits (135), Expect = 1e-11
 Identities = 21/31 (67%), Positives = 25/31 (80%)

Query: 40 RLCLVCGDVASGFHYGVASCEACKAFFKRTI 70
          R CL+CGD A+G HYG+ SCE CK FFKR+I
Sbjct: 7  RTCLICGDRATGLHYGIISCEGCKGFFKRSI 37


>gnl|CDD|143534 cd07160, NR_DBD_LXR, DNA-binding domain of Liver X receptors
          (LXRs) family is composed of two C4-type zinc fingers. 
          DNA-binding domain of Liver X receptors (LXRs) family
          is composed of two C4-type zinc fingers. Each zinc
          finger contains a group of four Cys residues which
          co-ordinates a single zinc atom. LXR interacts with
          specific DNA sites upstream of the target gene and
          modulates the rate of transcriptional initiation.  LXR
          operates as cholesterol sensor which protects cells
          from cholesterol overload by stimulating reverse
          cholesterol transport from peripheral tissues to the
          liver and its excretion in the bile. Oxidized
          cholesterol derivatives or oxysterols were identified
          as specific ligands for LXRs. LXR functions as a
          heterodimer with the retinoid X receptor (RXR) which
          may be activated by either LXR agonist or 9-cis
          retinoic acid, a specific RXR ligand. The LXR/RXR
          complex binds to a liver X receptor response element
          (LXRE) in the promoter region of target genes. The
          ideal LXRE sequence is a direct repeat-4 (DR-4) DNA
          fragment consisting of two AGGTCA hexameric half-sites
          separated by a 4-nucleotide spacer. LXR has typical NR
          modular structure with a central well conserved DNA
          binding domain (DBD), a variable N-terminal domain, a
          flexible hinge and the ligand binding domain (LBD) at
          the C-terminal.
          Length = 101

 Score = 56.0 bits (135), Expect = 1e-11
 Identities = 20/30 (66%), Positives = 24/30 (80%)

Query: 41 LCLVCGDVASGFHYGVASCEACKAFFKRTI 70
          +C VCGD ASGFHY V SCE CK FF+R++
Sbjct: 20 VCSVCGDKASGFHYNVLSCEGCKGFFRRSV 49


>gnl|CDD|143546 cd07172, NR_DBD_GR_PR, DNA-binding domain of glucocorticoid
          receptor (GR) is composed of two C4-type zinc fingers. 
          DNA-binding domains of glucocorticoid receptor (GR) and
          progesterone receptor (PR) are composed of two C4-type
          zinc fingers. Each zinc finger contains a group of four
          Cys residues which co-ordinate  a single zinc atom. The
          DBD from both receptors interact with the same hormone
          response element (HRE), which is an imperfect
          palindrome GGTACAnnnTGTTCT, upstream of target genes
          and modulates the rate of transcriptional initiation.
          GR is a transcriptional regulator that mediates the
          biological effects of glucocorticoids and PR regulates
          genes controlled by progesterone. GR is expressed in
          almost every cell in the body and regulates genes
          controlling a wide variety of processes including the
          development, metabolism, and immune response of the
          organism. PR functions in a variety of biological
          processes including development of the mammary gland,
          regulating cell cycle progression, protein processing,
          and metabolism. Like other members of the nuclear
          receptor (NR) superfamily of ligand-activated
          transcription factors, GR and PR have  a central well
          conserved DNA binding domain (DBD), a variable
          N-terminal domain, a non-conserved hinge and a
          C-terminal ligand binding domain (LBD).
          Length = 78

 Score = 55.6 bits (134), Expect = 1e-11
 Identities = 20/34 (58%), Positives = 27/34 (79%)

Query: 38 PRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQ 71
          P+++CLVC D ASG HYGV +C +CK FFKR ++
Sbjct: 1  PQKICLVCSDEASGCHYGVLTCGSCKVFFKRAVE 34


>gnl|CDD|143514 cd06956, NR_DBD_RXR, DNA-binding domain of retinoid X receptor
          (RXR) is composed of two C4-type zinc fingers.
          DNA-binding domain of retinoid X receptor (RXR) is
          composed of two C4-type zinc fingers. Each zinc finger
          contains a group of four Cys residues which
          co-ordinates a single zinc atom. RXR functions as a DNA
          binding partner by forming heterodimers with other
          nuclear receptors including CAR, FXR, LXR, PPAR, PXR,
          RAR, TR, and VDR. All RXR heterodimers preferentially
          bind response elements composed of direct repeats of
          two AGGTCA sites with a 1-5 bp spacer.  RXRs can play
          different roles in these heterodimers. RXR  acts either
          as a structural component of the heterodimer complex,
          required for DNA binding but not acting as a receptor,
          or as both a structural and a functional component of
          the heterodimer, allowing 9-cis RA to signal through
          the corresponding heterodimer. In addition, RXR can
          also form homodimers, functioning as a receptor for
          9-cis RA, independently of other nuclear receptors.
          Like other members of the nuclear receptor (NR)
          superfamily of ligand-activated transcription factors,
          RXR has a central well conserved DNA binding domain
          (DBD), a variable N-terminal domain, a flexible hinge
          and a C-terminal ligand binding domain (LBD).
          Length = 77

 Score = 53.7 bits (129), Expect = 5e-11
 Identities = 21/31 (67%), Positives = 25/31 (80%)

Query: 41 LCLVCGDVASGFHYGVASCEACKAFFKRTIQ 71
          +C +CGD ASG HYGV SCE CK FFKRT++
Sbjct: 2  ICAICGDRASGKHYGVYSCEGCKGFFKRTVR 32


>gnl|CDD|143531 cd07156, NR_DBD_VDR_like, The DNA-binding domain of vitamin D
          receptors (VDR) like nuclear receptor family is
          composed of two C4-type zinc fingers.  The DNA-binding
          domain of vitamin D receptors (VDR) like nuclear
          receptor family is composed of two C4-type zinc
          fingers. Each zinc finger contains a group of four Cys
          residues which co-ordinates a single zinc atom. This
          domain interacts with specific DNA site upstream of the
          target gene and modulates the rate of transcriptional
          initiation. This family includes three types of nuclear
          receptors: vitamin D receptors (VDR), constitutive
          androstane receptor (CAR) and pregnane X receptor
          (PXR). VDR regulates calcium metabolism, cellular
          proliferation and differentiation.  PXR and CAR
          function as sensors of toxic byproducts of cell
          metabolism and of exogenous chemicals, to facilitate
          their elimination. The DNA binding activity is
          regulated by their corresponding ligands. VDR is
          activated by Vitamin D; CAR and PXR respond to a
          diverse array of chemically distinct ligands, including
          many endogenous compounds and clinical drugs. Like
          other nuclear receptors, xenobiotic receptors have a
          central well conserved DNA binding domain (DBD), a
          variable N-terminal domain, a flexible hinge and a
          C-terminal ligand binding domain (LBD).
          Length = 72

 Score = 53.2 bits (128), Expect = 8e-11
 Identities = 16/35 (45%), Positives = 25/35 (71%)

Query: 42 CLVCGDVASGFHYGVASCEACKAFFKRTIQARASL 76
          C VCGD A+G+H+   +CE CK FF+R+++ +A  
Sbjct: 1  CGVCGDRATGYHFNAMTCEGCKGFFRRSMKRKARF 35


>gnl|CDD|143538 cd07164, NR_DBD_PNR_like_1, DNA-binding domain of the
          photoreceptor cell-specific nuclear receptor (PNR) like
          proteins is composed of two C4-type zinc fingers.
          DNA-binding domain of the photoreceptor cell-specific
          nuclear receptor (PNR) like proteins is composed of two
          C4-type zinc fingers. Each zinc finger contains a group
          of four Cys residues which co-ordinates a single zinc
          atom. PNR interacts with specific DNA sites upstream of
          the target gene and modulates the rate of
          transcriptional initiation.  PNR is a member of nuclear
          receptor superfamily of the ligand-activated
          transcription factors. PNR is expressed only in the
          outer layer of retinal photoreceptor cells. It may be
          involved in the signaling pathway regulating
          photoreceptor differentiation and/or maintenance. It
          most likely binds to DNA as a homodimer. Like other
          members of the nuclear receptor (NR) superfamily of
          ligand-activated transcription factors, PNR  has  a
          central well conserved DNA binding domain (DBD), a
          variable N-terminal domain, a flexible hinge and a
          C-terminal ligand binding domain (LBD).
          Length = 78

 Score = 52.5 bits (126), Expect = 2e-10
 Identities = 20/30 (66%), Positives = 24/30 (80%)

Query: 42 CLVCGDVASGFHYGVASCEACKAFFKRTIQ 71
          C VCGD ASG HYGV SC+ C+ FFKR+I+
Sbjct: 1  CRVCGDRASGKHYGVPSCDGCRGFFKRSIR 30


>gnl|CDD|143520 cd06962, NR_DBD_FXR, DNA-binding domain of Farnesoid X receptor
          (FXR) family is composed of two C4-type zinc fingers.
          DNA-binding domain of Farnesoid X receptor (FXR) family
          is composed of two C4-type zinc fingers. Each zinc
          finger contains a group of four Cys residues which
          co-ordinates a single zinc atom. FXR interacts with
          specific DNA sites upstream of the target gene and
          modulates the rate of transcriptional initiation.  FXR
          is a member of the nuclear receptor family of ligand
          activated transcription factors. Bile acids are
          endogenous ligands for FXRs. Upon binding of a ligand,
          FXR binds to FXR response element (FXRE), which is an
          inverted repeat of TGACCT spaced by one nucleotide,
          either as a monomer or as a heterodimer with retinoid X
          receptor (RXR), to regulate the expression of various
          genes involved in bile acid, lipid, and glucose
          metabolism. Like other members of the nuclear receptor
          (NR) superfamily of ligand-activated transcription
          factors, FXR has a central well conserved DNA binding
          domain (DBD), a variable N-terminal domain, a flexible
          hinge and a C-terminal ligand binding domain (LBD).
          Length = 84

 Score = 52.3 bits (125), Expect = 3e-10
 Identities = 20/34 (58%), Positives = 25/34 (73%)

Query: 41 LCLVCGDVASGFHYGVASCEACKAFFKRTIQARA 74
          LC+VCGD ASG+HY   +CE CK FF+R+I   A
Sbjct: 3  LCVVCGDKASGYHYNALTCEGCKGFFRRSITKNA 36


>gnl|CDD|143548 cd07179, 2DBD_NR_DBD2, The second DNA-binding domain (DBD) of the
          2DBD nuclear receptor is composed of two C4-type zinc
          fingers.  The second DNA-binding domain (DBD) of the
          2DBD nuclear receptor (NR) is composed of two C4-type
          zinc fingers. Each zinc finger contains a group of four
          Cys residues which co-ordinates a single zinc atom. NRs
          interact with specific DNA sites upstream of the target
          gene and modulate the rate of transcriptional
          initiation. The proteins contain two DBDs in tandem,
          probably resulting from an ancient recombination event.
           The 2DBD-NRs are found only in flatworm species,
          mollusks and arthropods.  Their biological function is
          unknown.
          Length = 74

 Score = 51.7 bits (124), Expect = 3e-10
 Identities = 19/36 (52%), Positives = 24/36 (66%)

Query: 42 CLVCGDVASGFHYGVASCEACKAFFKRTIQARASLV 77
          C VCG  +SGFH+G  +CE CK FF+RT  +  S V
Sbjct: 1  CRVCGGKSSGFHFGALTCEGCKGFFRRTELSSNSYV 36


>gnl|CDD|143535 cd07161, NR_DBD_EcR, DNA-binding domain of Ecdysone receptor
          (ECR) family is composed of two C4-type zinc fingers.
          DNA-binding domain of Ecdysone receptor (EcR) family is
          composed of two C4-type zinc fingers. Each zinc finger
          contains a group of four Cys residues which
          co-ordinates a single zinc atom. EcR interacts with
          highly degenerate pseudo-palindromic response elements,
          resembling inverted repeats of 5'-AGGTCA-3' separated
          by 1 bp, upstream of the target gene and modulates the
          rate of transcriptional initiation. EcR is present only
          in invertebrates and regulates the expression of a
          large number of genes during development and
          reproduction. EcR functions as a heterodimer by
          partnering with ultraspiracle protein (USP), the
          ortholog of the vertebrate retinoid X receptor (RXR).
          The natural ligands of EcR are ecdysteroids, the
          endogenous steroidal hormones found in invertebrates.
          Like other members of the nuclear receptor (NR)
          superfamily of ligand-activated transcription factors,
          EcRs have a central well conserved DNA binding domain
          (DBD), a variable N-terminal domain, a non-conserved
          hinge and a C-terminal ligand binding domain (LBD).
          Length = 91

 Score = 52.2 bits (125), Expect = 3e-10
 Identities = 20/34 (58%), Positives = 25/34 (73%)

Query: 41 LCLVCGDVASGFHYGVASCEACKAFFKRTIQARA 74
          LCLVCGD ASG+HY   +CE CK FF+R++   A
Sbjct: 3  LCLVCGDRASGYHYNALTCEGCKGFFRRSVTKSA 36


>gnl|CDD|143547 cd07173, NR_DBD_AR, DNA-binding domain of androgen receptor (AR)
          is composed of two C4-type zinc fingers.  DNA-binding
          domain of androgen receptor (AR) is composed of two
          C4-type zinc fingers. Each zinc finger contains a group
          of four Cys residues which co-ordinates a single zinc
          atom. To regulate gene expression, AR interacts with a
          palindrome of the core sequence 5'-TGTTCT-3' with a
          3-bp spacer. It also binds to the direct repeat
          5'-TGTTCT-3' hexamer in some androgen controlled genes.
          AR is activated by the androgenic hormones,
          testosterone or dihydrotestosterone, which are
          responsible for primary and for secondary male
          characteristics, respectively. The primary mechanism of
          action of ARs is by direct regulation of gene
          transcription. The binding of androgen results in a
          conformational change in the androgen receptor which
          causes its transport from the cytosol into the cell
          nucleus, and dimerization. The receptor dimer binds to
          a hormone response element of AR regulated genes and
          modulates their expression. Another mode of action of
          androgen receptor is independent of their interactions
          with DNA. The receptor interacts directly with signal
          transduction proteins in the cytoplasm, causing rapid
          changes in cell function, such as ion transport. Like
          other members of the nuclear receptor (NR) superfamily
          of ligand-activated transcription factors, AR has  a
          central well conserved DNA binding domain (DBD), a
          variable N-terminal domain, a flexible hinge and a
          C-terminal ligand binding domain (LBD).
          Length = 82

 Score = 51.5 bits (123), Expect = 4e-10
 Identities = 19/36 (52%), Positives = 26/36 (72%)

Query: 38 PRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQAR 73
          P++ CL+CGD ASG HYG  +C +CK FFKR  + +
Sbjct: 2  PQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGK 37


>gnl|CDD|143516 cd06958, NR_DBD_COUP_TF, DNA-binding domain of chicken ovalbumin
          upstream promoter transcription factors (COUP-TFs) is
          composed of two C4-type zinc fingers.  DNA-binding
          domain of chicken ovalbumin upstream promoter
          transcription factors (COUP-TFs) is composed of two
          C4-type zinc fingers. Each zinc finger contains a group
          of four Cys residues which co-ordinates a single zinc
          atom. COUP-TFs are orphan members of the
          steroid/thyroid hormone receptor superfamily. They are
          expressed in many tissues and are involved in the
          regulation of several important biological processes,
          such as neurogenesis, organogenesis, cell fate
          determination, and metabolic homeostasis. COUP-TFs
          homodimerize or heterodimerize with retinoid X receptor
          (RXR) and a few other nuclear receptors and bind to a
          variety of response elements that are composed of
          imperfect AGGTCA direct or inverted repeats with
          various spacings. COUP-TFs are generally considered to
          be repressors of transcription for other nuclear
          hormone receptors such as retinoic acid receptor (RAR),
          thyroid hormone receptor (TR), vitamin D receptor
          (VDR), peroxisome proliferator activated receptor
          (PPAR), and hepatocyte nuclear factor 4 (HNF4). Like
          other members of the nuclear receptor (NR) superfamily
          of ligand-activated transcription factors, COUP-TFs
          have a central well conserved DNA binding domain (DBD),
          a variable N-terminal domain, a flexible hinge and a
          C-terminal ligand binding domain (LBD).
          Length = 73

 Score = 51.0 bits (122), Expect = 7e-10
 Identities = 18/30 (60%), Positives = 25/30 (83%)

Query: 42 CLVCGDVASGFHYGVASCEACKAFFKRTIQ 71
          C+VCGD +SG HYG  +CE CK+FFKR+++
Sbjct: 1  CVVCGDKSSGKHYGQFTCEGCKSFFKRSVR 30


>gnl|CDD|143513 cd06955, NR_DBD_VDR, DNA-binding domain of vitamin D receptors
          (VDR) is composed of two C4-type zinc fingers.
          DNA-binding domain of vitamin D receptors (VDR) is
          composed of two C4-type zinc fingers. Each zinc finger
          contains a group of four Cys residues which coordinates
          a single zinc atom. VDR interacts with a VDR response
          element, a direct repeat of GGTTCA DNA site with 3 bp
          spacer upstream of the target gene, and modulates the
          rate of transcriptional initiation.  VDR is a member of
          the nuclear receptor (NR) superfamily that functions as
          classical endocrine receptors. VDR controls a wide
          range of biological activities including calcium
          metabolism, cell proliferation and differentiation, and
          immunomodulation. VDR is a high-affinity receptor for
          the biologically most active Vitamin D metabolite,
          1alpha,25-dihydroxyvitamin D3 (1alpha,25(OH)2D3). The
          binding of the ligand to the receptor induces a
          conformational change of the ligand binding domain
          (LBD) with consequent dissociation of corepressors.
          Upon ligand binding, VDR forms a heterodimer with the
          retinoid X receptor (RXR) that binds to vitamin D
          response elements (VDREs), recruits coactivators. This
          leads to the expression of a large number of genes.
          Approximately 200 human genes are considered to be
          primary targets of VDR and even more genes are
          regulated indirectly. Like other members of the nuclear
          receptor (NR) superfamily of ligand-activated
          transcription factors, VDR has a central well conserved
          DNA binding domain (DBD), a variable N-terminal domain,
          a flexible hinge and a C-terminal ligand binding domain
          (LBD).
          Length = 107

 Score = 50.7 bits (121), Expect = 2e-09
 Identities = 18/37 (48%), Positives = 27/37 (72%)

Query: 40 RLCLVCGDVASGFHYGVASCEACKAFFKRTIQARASL 76
          R+C VCGD A+GFH+   +CE CK FF+R+++ +A  
Sbjct: 7  RICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALF 43


>gnl|CDD|143526 cd06968, NR_DBD_ROR, DNA-binding domain of Retinoid-related
          orphan receptors (RORs) is composed of two C4-type zinc
          fingers.  DNA-binding domain of Retinoid-related orphan
          receptors (RORs) is composed of two C4-type zinc
          fingers. Each zinc finger contains a group of four Cys
          residues which coordinates a single zinc atom. ROR
          interacts with specific DNA sites upstream of the
          target gene and modulates the rate of transcriptional
          initiation.  RORS are key regulators of many
          physiological processes during embryonic development.
          RORs bind as monomers to specific ROR response elements
          (ROREs) consisting of the consensus core motif AGGTCA
          preceded by a 5-bp A/T-rich sequence. There are three
          subtypes of retinoid-related orphan receptors (RORs),
          alpha, beta, and gamma, which differ only in N-terminal
          sequence and are distributed in distinct tissues.
          RORalpha plays a key role in the development of the
          cerebellum particularly in the regulation of the
          maturation and survival of Purkinje cells. RORbeta
          expression is largely restricted to several regions of
          the brain, the retina, and pineal gland. RORgamma is
          essential for lymph node organogenesis. Recently, it
          has been suggested that cholesterol or a cholesterol
          derivative are the natural ligands of RORalpha. Like
          other members of the nuclear receptor (NR) superfamily
          of ligand-activated transcription factors,
          retinoid-related orphan receptors have a central well
          conserved DNA binding domain (DBD), a variable
          N-terminal domain, a non-conserved hinge and a
          C-terminal ligand binding domain (LBD).
          Length = 95

 Score = 50.2 bits (120), Expect = 2e-09
 Identities = 19/34 (55%), Positives = 24/34 (70%)

Query: 42 CLVCGDVASGFHYGVASCEACKAFFKRTIQARAS 75
          C +CGD +SG HYGV +CE CK FF+R+ Q   S
Sbjct: 8  CKICGDKSSGIHYGVITCEGCKGFFRRSQQNNVS 41


>gnl|CDD|143521 cd06963, NR_DBD_GR_like, The DNA binding domain of GR_like
          nuclear receptors is composed of two C4-type zinc
          fingers.  The DNA binding domain of GR_like nuclear
          receptors is composed of two C4-type zinc fingers. Each
          zinc finger contains a group of four Cys residues which
          co-ordinates a single zinc atom. It interacts with
          specific DNA sites upstream of the target gene and
          modulates the rate of transcriptional initiation. This
          family of NRs includes four types of nuclear hormone
          receptors: glucocorticoid receptor (GR),
          mineralocorticoid receptor (MR), progesterone receptor
          (PR), and androgen receptor (AR). The receptors bind to
          common DNA elements containing a partial palindrome of
          the core sequence 5'-TGTTCT-3' with a 3bp spacer. These
          four receptors regulate some of the most fundamental
          physiological functions such as the stress response,
          metabolism, electrolyte homeostasis, immune function,
          growth, development, and reproduction. The NRs in this
          family have high sequence homology and share similar
          functional mechanisms.  The dominant mechanism of
          function is by direct DNA binding and transcriptional
          regulation of target genes . The GR, MR, PR, and AR
          exhibit same modular structure. They have a central
          highly conserved DNA binding domain (DBD), a
          non-conserved N-terminal domain, a flexible hinge and a
          C-terminal ligand binding domain (LBD).
          Length = 73

 Score = 49.2 bits (117), Expect = 3e-09
 Identities = 19/32 (59%), Positives = 24/32 (75%)

Query: 42 CLVCGDVASGFHYGVASCEACKAFFKRTIQAR 73
          CL+CGD ASG HYGV +C +CK FFKR  + +
Sbjct: 1  CLICGDEASGCHYGVLTCGSCKVFFKRAAEGQ 32


>gnl|CDD|143528 cd06970, NR_DBD_PNR, DNA-binding domain of the photoreceptor
          cell-specific nuclear receptor (PNR) is composed of two
          C4-type zinc fingers.  DNA-binding domain of the
          photoreceptor cell-specific nuclear receptor (PNR) is
          composed of two C4-type zinc fingers. Each zinc finger
          contains a group of four Cys residues which
          co-ordinates a single zinc atom. PNR interacts with
          specific DNA sites upstream of the target gene and
          modulates the rate of transcriptional initiation.  PNR
          is a member of the nuclear receptor superfamily of the
          ligand-activated transcription factors. PNR is
          expressed only in the outer layer of retinal
          photoreceptor cells. It may be involved in the
          signaling pathway regulating photoreceptor
          differentiation and/or maintenance. It most likely
          binds to DNA as a homodimer. Like other members of the
          nuclear receptor (NR) superfamily of ligand-activated
          transcription factors, PNR  has  a central well
          conserved DNA binding domain (DBD), a variable
          N-terminal domain, a flexible hinge and a C-terminal
          ligand binding domain (LBD).
          Length = 92

 Score = 49.6 bits (118), Expect = 4e-09
 Identities = 18/36 (50%), Positives = 25/36 (69%)

Query: 38 PRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQAR 73
          P  LC VCGD +SG HYG+ +C  C  FFKR+++ +
Sbjct: 5  PGLLCRVCGDTSSGKHYGIYACNGCSGFFKRSVRRK 40


>gnl|CDD|143532 cd07157, 2DBD_NR_DBD1, The first DNA-binding domain (DBD) of the
          2DBD nuclear receptors is composed of two C4-type zinc
          fingers.  The first DNA-binding domain (DBD) of the
          2DBD nuclear receptors(NRs) is composed of two C4-type
          zinc fingers. Each zinc finger contains a group of four
          Cys residues which co-ordinates a single zinc atom. NRs
          interact with specific DNA sites upstream of the target
          gene and modulate the rate of transcriptional
          initiation. Theses proteins contain two DBDs in tandem,
          probably resulted from an ancient recombination event.
          The 2DBD-NRs are found only in flatworm species,
          mollusks and arthropods.  Their biological function is
          unknown.
          Length = 86

 Score = 49.0 bits (117), Expect = 5e-09
 Identities = 18/32 (56%), Positives = 22/32 (68%)

Query: 42 CLVCGDVASGFHYGVASCEACKAFFKRTIQAR 73
          C VCG+ A+GFH+G   CEACK FF R+  A 
Sbjct: 3  CQVCGEPAAGFHHGAYVCEACKKFFMRSSNAI 34


>gnl|CDD|143529 cd07154, NR_DBD_PNR_like, The DNA-binding domain of the
          photoreceptor cell-specific nuclear receptor (PNR)
          nuclear receptor-like family.  The DNA-binding domain
          of the photoreceptor cell-specific nuclear receptor
          (PNR) nuclear receptor-like family is composed of two
          C4-type zinc fingers. Each zinc finger contains a group
          of four Cys residues which coordinates a single zinc
          atom. PNR interacts with specific DNA sites upstream of
          the target gene and modulates the rate of
          transcriptional initiation. This family includes
          nuclear receptor Tailless (TLX), photoreceptor
          cell-specific nuclear receptor (PNR) and related
          receptors. TLX is an orphan receptor that plays a key
          role in neural development by regulating cell cycle
          progression and exit of neural stem cells in the
          developing brain. PNR is expressed only in the outer
          layer of retinal photoreceptor cells. It may be
          involved in the signaling pathway regulating
          photoreceptor differentiation and/or maintenance. Like
          other members of the nuclear receptor (NR) superfamily
          of ligand-activated transcription factors, PNR-like
          receptors have a central well-conserved DNA-binding
          domain (DBD), a variable N-terminal domain, a flexible
          hinge and a C-terminal ligand binding domain (LBD).
          Length = 73

 Score = 47.9 bits (114), Expect = 1e-08
 Identities = 18/30 (60%), Positives = 23/30 (76%)

Query: 42 CLVCGDVASGFHYGVASCEACKAFFKRTIQ 71
          C VCGD +SG HYGV +C+ C  FFKR+I+
Sbjct: 1  CKVCGDRSSGKHYGVYACDGCSGFFKRSIR 30


>gnl|CDD|143537 cd07163, NR_DBD_TLX, DNA-binding domain of Tailless (TLX) is
          composed of two C4-type zinc fingers.  DNA-binding
          domain of Tailless (TLX) is composed of two C4-type
          zinc fingers. Each zinc finger contains a group of four
          Cys residues which co-ordinates a single zinc atom. TLX
          interacts with specific DNA sites upstream of the
          target gene and modulates the rate of transcriptional
          initiation.  TLX is an orphan receptor that is
          expressed by neural stem/progenitor cells in the adult
          brain of the subventricular zone (SVZ) and the dentate
          gyrus (DG). It plays a key role in neural development
          by promoting cell cycle progression and preventing
          apoptosis in the developing brain. Like other members
          of the nuclear receptor (NR) superfamily of
          ligand-activated transcription factors, TLX has a
          central well conserved DNA-binding domain (DBD), a
          variable N-terminal domain, a flexible hinge and a
          C-terminal ligand binding domain (LBD).
          Length = 92

 Score = 47.9 bits (114), Expect = 2e-08
 Identities = 17/30 (56%), Positives = 23/30 (76%)

Query: 42 CLVCGDVASGFHYGVASCEACKAFFKRTIQ 71
          C VCGD +SG HYG+ +C+ C  FFKR+I+
Sbjct: 9  CKVCGDRSSGKHYGIYACDGCSGFFKRSIR 38


>gnl|CDD|143515 cd06957, NR_DBD_PNR_like_2, DNA-binding domain of the
          photoreceptor cell-specific nuclear receptor (PNR) like
          is composed of two C4-type zinc fingers.  The
          DNA-binding domain of the photoreceptor cell-specific
          nuclear receptor (PNR) nuclear receptor-like family is
          composed of two C4-type zinc fingers. Each zinc finger
          contains a group of four Cys residues which coordinates
          a single zinc atom. PNR interacts with specific DNA
          sites upstream of the target gene and modulates the
          rate of transcriptional initiation. This family
          includes nuclear receptor Tailless (TLX), photoreceptor
          cell-specific nuclear receptor (PNR) and related
          receptors. TLX is an orphan receptor that plays a key
          role in neural development by regulating cell cycle
          progression and exit of neural stem cells in the
          developing brain. PNR is expressed only in the outer
          layer of retinal photoreceptor cells. It may be
          involved in the signaling pathway regulating
          photoreceptor differentiation and/or maintenance. Like
          other members of the nuclear receptor (NR) superfamily
          of ligand-activated transcription factors, PNR-like
          receptors have a central well-conserved DNA-binding
          domain (DBD), a variable N-terminal domain, a flexible
          hinge and a C-terminal ligand binding domain (LBD).
          Length = 82

 Score = 47.5 bits (113), Expect = 2e-08
 Identities = 17/40 (42%), Positives = 23/40 (57%)

Query: 42 CLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLRG 81
          C VCGD + G HYGV  C+ C  FFKR+++       + G
Sbjct: 1  CKVCGDKSYGKHYGVYCCDGCSCFFKRSVRKGIIYTCIAG 40


>gnl|CDD|143524 cd06966, NR_DBD_CAR, DNA-binding domain of constitutive
          androstane receptor (CAR) is composed of two C4-type
          zinc fingers.  DNA-binding domain (DBD) of constitutive
          androstane receptor (CAR) is composed of two C4-type
          zinc fingers. Each zinc finger contains a group of four
          Cys residues which co-ordinates a single zinc atom. CAR
          DBD interacts with CAR response element, a perfect
          repeat of two AGTTCA motifs with a 4 bp spacer upstream
          of the target gene, and modulates the rate of
          transcriptional initiation. The constitutive androstane
          receptor (CAR) is a ligand-regulated transcription
          factor that responds to a diverse array of chemically
          distinct ligands, including many endogenous compounds
          and clinical drugs. It functions as a heterodimer with
          RXR. The CAR/RXR heterodimer binds many common response
          elements in the promoter regions of a diverse set of
          target genes involved in the metabolism, transport, and
          ultimately, elimination of these molecules from the
          body. CAR is a closest mammalian relative of PXR and is
          activated by some of the same ligands as PXR and
          regulates a subset of common genes. The sequence
          homology and functional similarity suggests that the
          CAR gene arose from a duplication of an ancestral PXR
          gene. Like other nuclear receptors, CAR has a central
          well conserved DNA binding domain, a variable
          N-terminal domain, a flexible hinge and a C-terminal
          ligand binding domain.
          Length = 94

 Score = 46.3 bits (110), Expect = 6e-08
 Identities = 15/29 (51%), Positives = 23/29 (79%)

Query: 40 RLCLVCGDVASGFHYGVASCEACKAFFKR 68
          ++C VCGD A G+++   +CE+CKAFF+R
Sbjct: 1  KICGVCGDKALGYNFNAITCESCKAFFRR 29


>gnl|CDD|143536 cd07162, NR_DBD_PXR, DNA-binding domain of pregnane X receptor
          (PXRs) is composed of two C4-type zinc fingers.
          DNA-binding domain (DBD)of pregnane X receptor (PXR) is
          composed of two C4-type zinc fingers. Each zinc finger
          contains a group of four Cys residues which
          co-ordinates a single zinc atom. PXR DBD interacts with
          the PXR response element, a perfect repeat of two
          AGTTCA motifs with a 4 bp spacer upstream of the target
          gene, and modulates the rate of transcriptional
          initiation. The pregnane X receptor (PXR) is a
          ligand-regulated transcription factor that responds to
          a diverse array of chemically distinct ligands,
          including many endogenous compounds and clinical drugs.
          PXR functions as a heterodimer with retinoic X
          receptor-alpha (RXRa) and binds to a variety of
          promoter regions of a diverse set of target genes
          involved in the metabolism, transport, and ultimately,
          elimination of these molecules from the body. Like
          other nuclear receptors, PXR has a central well
          conserved DNA-binding domain, a variable N-terminal
          domain, a flexible hinge and a C-terminal ligand
          binding domain.
          Length = 87

 Score = 44.9 bits (106), Expect = 2e-07
 Identities = 17/36 (47%), Positives = 25/36 (69%)

Query: 41 LCLVCGDVASGFHYGVASCEACKAFFKRTIQARASL 76
          +C VCGD A+G+H+   +CE CK FF+R ++  A L
Sbjct: 1  ICRVCGDRATGYHFNAMTCEGCKGFFRRAMKRNARL 36


>gnl|CDD|188625 cd09905, H3TH_GEN1, H3TH domain of Gap Endonuclease 1, a
          structure-specific, divalent-metal-ion dependent, 5'
          nuclease.  Gap Endonuclease 1 (GEN1): Holliday junction
          resolvase reported to symmetrically cleave Holliday
          junctions and allow religation without additional
          processing. GEN1 is a member of the structure-specific,
          5' nuclease family that catalyzes hydrolysis of DNA
          duplex-containing nucleic acid structures during DNA
          replication, repair, and recombination. Members of this
          subgroup include the H3TH (helix-3-turn-helix) domains
          of GEN1 and other similar eukaryotic 5' nucleases.
          These nucleases contain a PIN (PilT N terminus) domain
          with a helical arch/clamp region/I domain (not included
          here) and inserted within the PIN domain is an atypical
          helix-hairpin-helix-2 (HhH2)-like region. This atypical
          HhH2 region, the H3TH domain, has an extended loop with
          at least three turns between the first two helices, and
          only three of the four helices appear to be conserved.
          Both the H3TH domain and the helical arch/clamp region
          are involved in DNA binding. Studies suggest that a
          glycine-rich loop in the H3TH domain contacts the
          phosphate backbone of the template strand in the
          downstream DNA duplex. These nucleases have a
          carboxylate rich active site that is involved in
          binding essential divalent metal ion cofactors (Mg2+ or
          Mn2+) required for nuclease activity. The first metal
          binding site is composed entirely of Asp/Glu residues
          from the PIN domain, whereas, the second metal binding
          site is composed generally of two Asp residues from the
          PIN domain and one Asp residue from the H3TH domain.
          Together with the helical arch and network of amino
          acids interacting with metal binding ions, the H3TH
          region defines a positively charged active-site
          DNA-binding groove in structure-specific 5' nucleases.
          Length = 108

 Score = 25.8 bits (57), Expect = 3.9
 Identities = 10/45 (22%), Positives = 20/45 (44%), Gaps = 3/45 (6%)

Query: 22 EQKFRGSTDGIKEEELPRR---LCLVCGDVASGFHYGVASCEACK 63
           + +R ++D    +EL ++    C  CG +     +  + CE C 
Sbjct: 44 LRNWRATSDPSSPQELKKKDKNHCSNCGHLGKKQEHIKSGCEDCD 88


>gnl|CDD|234951 PRK01392, citX,
           2'-(5''-triphosphoribosyl)-3'-dephospho-CoA:apo-citrate
           lyase; Reviewed.
          Length = 180

 Score = 25.4 bits (56), Expect = 6.2
 Identities = 8/13 (61%), Positives = 9/13 (69%)

Query: 37  LPRRLCLVCGDVA 49
           LP R CL+CG  A
Sbjct: 137 LPPRRCLLCGQDA 149


>gnl|CDD|179648 PRK03776, PRK03776, phosphoglycerol transferase I; Provisional.
          Length = 762

 Score = 25.8 bits (57), Expect = 6.8
 Identities = 12/27 (44%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 83  EPQKKSSQIPKEKYNLAYLMSDSLDTT 109
           EP K    IP  K NL Y+  +SL+ T
Sbjct: 152 EPAKT---IPNPKLNLVYIYGESLERT 175


>gnl|CDD|99920 cd05537, POLBc_Pol_II, DNA polymerase type-II subfamily catalytic
           domain. Bacteria contain five DNA polymerases (I, II,
           III, IV and V). DNA polymerase II (Pol II) is a
           prototype for the B-family of polymerases. The role of
           Pol II in a variety of cellular activities, such as
           repair of DNA damaged by UV irradiation or oxidation has
           been proven by genetic studies. DNA polymerase III is
           the main enzyme responsible for replication of the
           bacterial chromosome; however, In vivo studies have also
           shown that Pol II is able to participate in chromosomal
           DNA replication with larger role in lagging-strand
           replication.
          Length = 371

 Score = 25.3 bits (56), Expect = 8.4
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 7/55 (12%)

Query: 54  YGVASCEACKAFFKRTIQAR-ASLVSLRGHEPQKKSSQ-IPKEKYNLAYLMSDSL 106
           YGV     C+ FF      R AS ++LRGHE  K++   I ++ Y + Y  +DS 
Sbjct: 104 YGVLGSTGCR-FF----DPRLASSITLRGHEIMKQTRAWIEQQGYQVIYGDTDST 153


>gnl|CDD|217739 pfam03802, CitX, Apo-citrate lyase phosphoribosyl-dephospho-CoA
           transferase. 
          Length = 171

 Score = 24.9 bits (55), Expect = 9.6
 Identities = 8/13 (61%), Positives = 9/13 (69%)

Query: 37  LPRRLCLVCGDVA 49
           LP R CL+CG  A
Sbjct: 130 LPPRRCLLCGRPA 142


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.320    0.132    0.388 

Gapped
Lambda     K      H
   0.267   0.0820    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 5,423,886
Number of extensions: 429994
Number of successful extensions: 366
Number of sequences better than 10.0: 1
Number of HSP's gapped: 366
Number of HSP's successfully gapped: 46
Length of query: 113
Length of database: 10,937,602
Length adjustment: 77
Effective length of query: 36
Effective length of database: 7,522,344
Effective search space: 270804384
Effective search space used: 270804384
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (24.0 bits)