Diaphorina citri psyllid: psy11507


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110---
MLRWSSKRLVELSVYLQTYTVEQKFRGSTDGIKEEELPRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLRGHEPQKKSSQIPKEKYNLAYLMSDSLDTTNRFN
cccccccccccccccccccccccccccccccccccccccCEccccccccccEECccccccccHHHHHHHHccccEEEEcccccccccccccccccccccccccccHHcccccc
***********************************ELPRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLRGHEPQKKSSQIPKEKYNLAYLMSDSLD******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLRWSSKRLVELSVYLQTYTVEQKFRGSTDGIKEEELPRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQARASLVSLRGHEPQKKSSQIPKEKYNLAYLMSDSLDTTNRFN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043566 [MF]structure-specific DNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0044212 [MF]transcription regulatory region DNA bindingprobableGO:0097159, GO:0000975, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0010557 [BP]positive regulation of macromolecule biosynthetic processprobableGO:0009893, GO:0019222, GO:0009891, GO:0060255, GO:0009889, GO:0010556, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0010604
GO:0009410 [BP]response to xenobiotic stimulusprobableGO:0042221, GO:0050896, GO:0008150
GO:0043565 [MF]sequence-specific DNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0044255 [BP]cellular lipid metabolic processprobableGO:0044238, GO:0044710, GO:0006629, GO:0009987, GO:0044237, GO:0071704, GO:0008150, GO:0008152
GO:0032355 [BP]response to estradiol stimulusprobableGO:1901700, GO:0009719, GO:0033993, GO:0050896, GO:0008150, GO:0014070, GO:0009725, GO:0043627, GO:0042221, GO:0097305, GO:0010033, GO:0048545
GO:0004879 [MF]ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activityprobableGO:0038023, GO:0003700, GO:0060089, GO:0003674, GO:0004872, GO:0004871, GO:0000981, GO:0001071
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0031328 [BP]positive regulation of cellular biosynthetic processprobableGO:0009893, GO:0019222, GO:0009891, GO:0031326, GO:0031325, GO:0009889, GO:0050794, GO:0031323, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0050728 [BP]negative regulation of inflammatory responseprobableGO:0032102, GO:0032101, GO:0048585, GO:0048583, GO:0050727, GO:0050789, GO:0008150, GO:0031348, GO:0065007, GO:0048519, GO:0080134, GO:0031347
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0010628 [BP]positive regulation of gene expressionprobableGO:0009893, GO:0019222, GO:0060255, GO:0050789, GO:0065007, GO:0048518, GO:0008150, GO:0010468, GO:0010604
GO:0031981 [CC]nuclear lumenprobableGO:0005575, GO:0043231, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0043031 [BP]negative regulation of macrophage activationprobableGO:0008150, GO:0050865, GO:0050866, GO:0050794, GO:0002695, GO:0002694, GO:0065007, GO:0002682, GO:0002683, GO:0048519, GO:0043030, GO:0050789, GO:0048523
GO:0030522 [BP]intracellular receptor mediated signaling pathwayprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1LO1, chain A
Confidence level:very confident
Coverage over the Query: 38-112
View the alignment between query and template
View the model in PyMOL