BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy11512
         (62 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3CW1|G Chain G, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|3 Chain 3, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|4 Chain 4, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|5 Chain 5, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3PGW|G Chain G, Crystal Structure Of Human U1 Snrnp
 pdb|3PGW|J Chain J, Crystal Structure Of Human U1 Snrnp
 pdb|2Y9A|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|3S6N|G Chain G, Crystal Structure Of The Gemin2-Binding Domain Of Smn,
          Gemin2 In Complex With Smd1D2FEG FROM HUMAN
 pdb|4F7U|G Chain G, Macromolecular Machine 6
 pdb|4F7U|J Chain J, Macromolecular Machine 6
 pdb|1VU2|H Chain H, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|P Chain P, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|X Chain X, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|FF Chain f, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|NN Chain n, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|VV Chain v, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|4 Chain 4, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|H Chain H, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|P Chain P, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|X Chain X, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|FF Chain f, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|NN Chain n, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|VV Chain v, The 8s Snrnp Assembly Intermediate
 pdb|4F77|P Chain P, The 8s Snrnp Assembly Intermediate
 pdb|4F77|H Chain H, The 8s Snrnp Assembly Intermediate
 pdb|4F77|X Chain X, The 8s Snrnp Assembly Intermediate
 pdb|4F77|FF Chain f, The 8s Snrnp Assembly Intermediate
 pdb|4F77|NN Chain n, The 8s Snrnp Assembly Intermediate
 pdb|4F77|VV Chain v, The 8s Snrnp Assembly Intermediate
 pdb|4F77|4 Chain 4, The 8s Snrnp Assembly Intermediate
          Length = 76

 Score = 91.7 bits (226), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 43/60 (71%), Positives = 49/60 (81%)

Query: 1  MSKSHPPELKKFMDKKVTLKLNANRNVTGILRGFDPFMNLVLDEGVEYRKDNTVHNIGMV 60
          MSK+HPPELKKFMDKK++LKLN  R+V GILRGFDPFMNLV+DE VE       +NIGMV
Sbjct: 1  MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMV 60


>pdb|3SWN|C Chain C, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|F Chain F, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|O Chain O, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|R Chain R, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
          Length = 117

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 25/37 (67%)

Query: 8  ELKKFMDKKVTLKLNANRNVTGILRGFDPFMNLVLDE 44
          +L ++ D+++       R +TGIL+GFD  MNLVLD+
Sbjct: 31 DLSRYQDQRIQATFTGGRQITGILKGFDQLMNLVLDD 67


>pdb|4EMK|C Chain C, Crystal Structure Of Splsm567
          Length = 113

 Score = 41.2 bits (95), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 24/37 (64%)

Query: 8  ELKKFMDKKVTLKLNANRNVTGILRGFDPFMNLVLDE 44
          +L ++ D+++       R +TGIL+GFD   NLVLD+
Sbjct: 27 DLSRYQDQRIQATFTGGRQITGILKGFDQLXNLVLDD 63


>pdb|1TH7|A Chain A, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|B Chain B, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|C Chain C, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|D Chain D, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|E Chain E, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|F Chain F, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|G Chain G, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|H Chain H, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|I Chain I, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|J Chain J, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|K Chain K, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|L Chain L, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|M Chain M, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|N Chain N, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
          Length = 81

 Score = 37.7 bits (86), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%)

Query: 9  LKKFMDKKVTLKLNANRNVTGILRGFDPFMNLVLDEGVEYRKDNTVHNIGMV 60
          L + ++  V +KL  N+ V G+LR +D  MNLVL +  E + D +   +G +
Sbjct: 14 LAESLNNLVLVKLKGNKEVRGMLRSYDQHMNLVLSDSEEIQSDGSGKKLGTI 65


>pdb|3BW1|A Chain A, Crystal Structure Of Homomeric Yeast Lsm3 Exhibiting
          Novel Octameric Ring Organisation
 pdb|3BW1|B Chain B, Crystal Structure Of Homomeric Yeast Lsm3 Exhibiting
          Novel Octameric Ring Organisation
          Length = 96

 Score = 35.4 bits (80), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%)

Query: 9  LKKFMDKKVTLKLNANRNVTGILRGFDPFMNLVLDEGVE 47
          LK  +D++V +KL   R + G L+ FD   N+VL + VE
Sbjct: 15 LKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLSDAVE 53


>pdb|2FWK|A Chain A, Crystal Structure Of Cryptosporidium Parvum U6 Snrna-
          Associated Sm-Like Protein Lsm5
 pdb|2FWK|B Chain B, Crystal Structure Of Cryptosporidium Parvum U6 Snrna-
          Associated Sm-Like Protein Lsm5
 pdb|3PGG|A Chain A, Crystal Structure Of Cryptosporidium Parvum U6
          Snrna-Associated Sm- Like Protein Lsm5
 pdb|3PGG|B Chain B, Crystal Structure Of Cryptosporidium Parvum U6
          Snrna-Associated Sm- Like Protein Lsm5
          Length = 121

 Score = 35.0 bits (79), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 27/40 (67%)

Query: 9  LKKFMDKKVTLKLNANRNVTGILRGFDPFMNLVLDEGVEY 48
          + K +  ++ + +  ++  +G+LRGFD ++N+VLD+  EY
Sbjct: 33 IDKCIGNRIYVVMKGDKEFSGVLRGFDEYVNMVLDDVQEY 72


>pdb|3SWN|B Chain B, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|E Chain E, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|Q Chain Q, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|T Chain T, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
          Length = 77

 Score = 34.3 bits (77), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 4  SHPPE-LKKFMDKKVTLKLNANRNVTGILRGFDPFMNLVLDEGVEY 48
          S P E L K + KKV ++L++  +  GIL   D +MNL L+   EY
Sbjct: 5  SSPNEFLNKVIGKKVLIRLSSGVDYKGILSCLDGYMNLALERTEEY 50


>pdb|1I81|A Chain A, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|B Chain B, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|C Chain C, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|D Chain D, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|E Chain E, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|F Chain F, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|G Chain G, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|A Chain A, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|B Chain B, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|C Chain C, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|D Chain D, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|E Chain E, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|F Chain F, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|G Chain G, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
          Length = 83

 Score = 32.7 bits (73), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%)

Query: 9  LKKFMDKKVTLKLNANRNVTGILRGFDPFMNLVLDEGVEYRKDNTVHNIGMV 60
          L   ++  V +KL  +R   G+L+ FD  MNLVL++  E         +G V
Sbjct: 20 LGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTV 71


>pdb|1JBM|A Chain A, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|B Chain B, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|C Chain C, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|D Chain D, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|E Chain E, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|F Chain F, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|G Chain G, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
          Length = 86

 Score = 32.7 bits (73), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%)

Query: 9  LKKFMDKKVTLKLNANRNVTGILRGFDPFMNLVLDEGVEYRKDNTVHNIGMV 60
          L   ++  V +KL  +R   G+L+ FD  MNLVL++  E         +G V
Sbjct: 18 LGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTV 69


>pdb|1LOJ|A Chain A, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|B Chain B, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|C Chain C, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|D Chain D, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|E Chain E, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|F Chain F, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|G Chain G, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|H Chain H, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|I Chain I, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|J Chain J, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|K Chain K, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|L Chain L, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|M Chain M, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|N Chain N, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
          Length = 87

 Score = 32.7 bits (73), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%)

Query: 9  LKKFMDKKVTLKLNANRNVTGILRGFDPFMNLVLDEGVEYRKDNTVHNIGMV 60
          L   ++  V +KL  +R   G+L+ FD  MNLVL++  E         +G V
Sbjct: 18 LGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTV 69


>pdb|1JRI|A Chain A, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|B Chain B, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|C Chain C, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|D Chain D, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|E Chain E, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|F Chain F, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|G Chain G, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|H Chain H, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|I Chain I, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|J Chain J, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|K Chain K, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|L Chain L, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|M Chain M, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|N Chain N, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit
          Length = 85

 Score = 32.7 bits (73), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%)

Query: 9  LKKFMDKKVTLKLNANRNVTGILRGFDPFMNLVLDEGVEYRKDNTVHNIGMV 60
          L   ++  V +KL  +R   G+L+ FD  MNLVL++  E         +G V
Sbjct: 18 LGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTV 69


>pdb|4EMK|B Chain B, Crystal Structure Of Splsm567
          Length = 75

 Score = 31.6 bits (70), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 4  SHPPE-LKKFMDKKVTLKLNANRNVTGILRGFDPFMNLVLDEGVEY 48
          S P E L K + KKV ++L++  +  GIL   D + NL L+   EY
Sbjct: 3  SSPNEFLNKVIGKKVLIRLSSGVDYKGILSCLDGYXNLALERTEEY 48


>pdb|1I8F|A Chain A, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|B Chain B, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|C Chain C, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|D Chain D, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|E Chain E, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|F Chain F, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|G Chain G, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1LNX|A Chain A, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|B Chain B, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|C Chain C, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|D Chain D, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|E Chain E, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|F Chain F, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|G Chain G, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
          Length = 81

 Score = 31.6 bits (70), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%)

Query: 9  LKKFMDKKVTLKLNANRNVTGILRGFDPFMNLVLDEGVEYRKDNTVHNIGMV 60
          L+  + K+V +KL  +  + GILR FD  +NL+L++  E    N      MV
Sbjct: 16 LQDSIGKQVLVKLRDSHEIRGILRSFDQHVNLLLEDAEEIIDGNVYKRGTMV 67


>pdb|1I5L|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|B Chain B, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|C Chain C, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|D Chain D, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|E Chain E, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|F Chain F, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|G Chain G, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|H Chain H, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|I Chain I, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|J Chain J, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|K Chain K, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|L Chain L, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|M Chain M, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|N Chain N, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I4K|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|B Chain B, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|C Chain C, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|D Chain D, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|E Chain E, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|F Chain F, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|G Chain G, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|H Chain H, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|I Chain I, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|J Chain J, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|K Chain K, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|L Chain L, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|M Chain M, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|N Chain N, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|O Chain O, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|P Chain P, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|Q Chain Q, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|R Chain R, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|S Chain S, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|T Chain T, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|U Chain U, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|V Chain V, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|W Chain W, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|X Chain X, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|Y Chain Y, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|Z Chain Z, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|1 Chain 1, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|2 Chain 2, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
          Length = 77

 Score = 31.6 bits (70), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 25/52 (48%)

Query: 9  LKKFMDKKVTLKLNANRNVTGILRGFDPFMNLVLDEGVEYRKDNTVHNIGMV 60
          L + +   V ++L   R   G L G+D  MNLVL +  E +    V  +G V
Sbjct: 9  LNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSV 60


>pdb|3CW1|E Chain E, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|W Chain W, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|X Chain X, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|Y Chain Y, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3PGW|E Chain E, Crystal Structure Of Human U1 Snrnp
 pdb|3PGW|H Chain H, Crystal Structure Of Human U1 Snrnp
 pdb|2Y9A|E Chain E, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|L Chain L, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|S Chain S, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|E Chain E, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|L Chain L, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|S Chain S, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|E Chain E, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|L Chain L, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|S Chain S, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|E Chain E, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|L Chain L, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|S Chain S, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|3S6N|E Chain E, Crystal Structure Of The Gemin2-Binding Domain Of Smn,
          Gemin2 In Complex With Smd1D2FEG FROM HUMAN
 pdb|4F7U|E Chain E, Macromolecular Machine 6
 pdb|4F7U|H Chain H, Macromolecular Machine 6
 pdb|1VU2|C Chain C, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|K Chain K, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|S Chain S, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|AA Chain a, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|II Chain i, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|QQ Chain q, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|YY Chain y, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|C Chain C, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|K Chain K, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|S Chain S, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|AA Chain a, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|II Chain i, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|QQ Chain q, The 8s Snrnp Assembly Intermediate
 pdb|4F77|K Chain K, The 8s Snrnp Assembly Intermediate
 pdb|4F77|C Chain C, The 8s Snrnp Assembly Intermediate
 pdb|4F77|S Chain S, The 8s Snrnp Assembly Intermediate
 pdb|4F77|AA Chain a, The 8s Snrnp Assembly Intermediate
 pdb|4F77|II Chain i, The 8s Snrnp Assembly Intermediate
 pdb|4F77|QQ Chain q, The 8s Snrnp Assembly Intermediate
 pdb|4F77|YY Chain y, The 8s Snrnp Assembly Intermediate
          Length = 92

 Score = 31.2 bits (69), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 19/32 (59%)

Query: 16 KVTLKLNANRNVTGILRGFDPFMNLVLDEGVE 47
          +V L    N  + G + GFD +MNLVLD+  E
Sbjct: 32 QVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEE 63


>pdb|3SWN|A Chain A, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|D Chain D, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|P Chain P, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|S Chain S, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
          Length = 82

 Score = 28.1 bits (61), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 6  PPEL-KKFMDKKVTLKLNANRNVTGILRGFDPFMNLVLDEGVEY 48
          P EL  K +   + + + + R   G L GFD ++N+VL +  EY
Sbjct: 9  PLELIDKCIGSNLWVIMKSEREFAGTLVGFDDYVNIVLKDVTEY 52


>pdb|2Y9A|A Chain A, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|H Chain H, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|O Chain O, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|A Chain A, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|H Chain H, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|O Chain O, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|A Chain A, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|H Chain H, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|O Chain O, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|A Chain A, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|H Chain H, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|O Chain O, Structure Of The Spliceosomal U4 Snrnp Core Domain
          Length = 95

 Score = 28.1 bits (61), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 25/50 (50%)

Query: 1  MSKSHPPELKKFMDKKVTLKLNANRNVTGILRGFDPFMNLVLDEGVEYRK 50
          M+     ++ + +D ++   L   R   G  + FD  MNL+L +  E+RK
Sbjct: 1  MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRK 50


>pdb|1D3B|B Chain B, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
 pdb|1D3B|D Chain D, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
 pdb|1D3B|F Chain F, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
 pdb|1D3B|H Chain H, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
 pdb|1D3B|J Chain J, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
 pdb|1D3B|L Chain L, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
          Length = 91

 Score = 28.1 bits (61), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 25/50 (50%)

Query: 1  MSKSHPPELKKFMDKKVTLKLNANRNVTGILRGFDPFMNLVLDEGVEYRK 50
          M+     ++ + +D ++   L   R   G  + FD  MNL+L +  E+RK
Sbjct: 1  MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRK 50


>pdb|3PGW|B Chain B, Crystal Structure Of Human U1 Snrnp
 pdb|3PGW|Q Chain Q, Crystal Structure Of Human U1 Snrnp
          Length = 231

 Score = 27.3 bits (59), Expect = 2.2,   Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 25/50 (50%)

Query: 1  MSKSHPPELKKFMDKKVTLKLNANRNVTGILRGFDPFMNLVLDEGVEYRK 50
          M+     ++ + +D ++   L   R   G  + FD  MNL+L +  E+RK
Sbjct: 1  MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRK 50


>pdb|1LJO|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm2) From
          Archaeoglobus Fulgidus At 1.95a Resolution
          Length = 77

 Score = 27.3 bits (59), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 9  LKKFMDKKVTLKLNANRN-VTGILRGFDPFMNLVLDEGVEYRKDNTVHNIG 58
          +K  + K + +++    N + G L G D +MNL L   +E + +  V ++G
Sbjct: 10 VKSMVGKIIRVEMKGEENQLVGKLEGVDDYMNLYLTNAMECKGEEKVRSLG 60


>pdb|4EMK|A Chain A, Crystal Structure Of Splsm567
          Length = 94

 Score = 26.9 bits (58), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 21/40 (52%)

Query: 9  LKKFMDKKVTLKLNANRNVTGILRGFDPFMNLVLDEGVEY 48
          + K +   + +   + R   G L GFD ++N+VL +  EY
Sbjct: 25 IDKCIGSNLWVIXKSEREFAGTLVGFDDYVNIVLKDVTEY 64


>pdb|3CW1|A Chain A, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|H Chain H, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|I Chain I, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|J Chain J, Crystal Structure Of Human Spliceosomal U1 Snrnp
          Length = 174

 Score = 26.6 bits (57), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 21/40 (52%)

Query: 11 KFMDKKVTLKLNANRNVTGILRGFDPFMNLVLDEGVEYRK 50
          + +D ++   L   R   G  + FD  MNL+L +  E+RK
Sbjct: 11 QHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRK 50


>pdb|1EIA|A Chain A, X-Ray Crystal Structure Of Equine Infectious Anemia Virus
           (Eiav) Capsid Protein P26
          Length = 207

 Score = 26.6 bits (57), Expect = 4.1,   Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 19/35 (54%), Gaps = 1/35 (2%)

Query: 2   SKSHPPELKKFMDKKVTLKLNANRNVTGILRGFDP 36
           S+ HP E+ KF+   +T++ NAN      +R   P
Sbjct: 159 SEGHPQEISKFLTDTLTIQ-NANEECRNAMRHLRP 192


>pdb|2EIA|A Chain A, X-Ray Crystal Structure Of Equine Infectious Anemia Virus
           (Eiav) Capsid Protein P26
 pdb|2EIA|B Chain B, X-Ray Crystal Structure Of Equine Infectious Anemia Virus
           (Eiav) Capsid Protein P26
          Length = 206

 Score = 26.6 bits (57), Expect = 4.1,   Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 19/35 (54%), Gaps = 1/35 (2%)

Query: 2   SKSHPPELKKFMDKKVTLKLNANRNVTGILRGFDP 36
           S+ HP E+ KF+   +T++ NAN      +R   P
Sbjct: 158 SEGHPQEISKFLTDTLTIQ-NANEECRNAMRHLRP 191


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.317    0.136    0.388 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,908,741
Number of Sequences: 62578
Number of extensions: 60996
Number of successful extensions: 137
Number of sequences better than 100.0: 24
Number of HSP's better than 100.0 without gapping: 22
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 115
Number of HSP's gapped (non-prelim): 24
length of query: 62
length of database: 14,973,337
effective HSP length: 33
effective length of query: 29
effective length of database: 12,908,263
effective search space: 374339627
effective search space used: 374339627
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 45 (21.9 bits)