Diaphorina citri psyllid: psy11523


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------
MRSGLPTLKLIDFGRSIDMTLYPPGTTFSTVVTTDGFQCTEMKEGREWSYHTDVYGLAGSMCCTLLGKYMNTVKRGARWILADTIPRYLRRDVMEPIFDKLLNSPSHYDITLLEDIIHSLEQELECSLARSDEGLQTVDTILAQLKL
cccccccEEEEEccccccccccccccEEEEEEcccccccHHHHccccccccHHHHHHHHHHHHHHHccccEEEEEccEEEEccccccccccccHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
****LPTLKLIDFGRSIDMTLYPPGTTFSTVVTTDGFQCTEMKEGREWSYHTDVYGLAGSMCCTLLGKYMNTVKRGARWILADTIPRYLRRDVMEPIFDKLLNSPSHYDITLLEDIIHSLEQELECSLARSDEGLQTVDTILAQLKL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRSGLPTLKLIDFGRSIDMTLYPPGTTFSTVVTTDGFQCTEMKEGREWSYHTDVYGLAGSMCCTLLGKYMNTVKRGARWILADTIPRYLRRDVMEPIFDKLLNSPSHYDITLLEDIIHSLEQELECSLARSDEGLQTVDTILAQLKL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000780 [CC]condensed nuclear chromosome, centromeric regionprobableGO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0000793, GO:0000794, GO:0000775, GO:0043231, GO:0043232, GO:0000779, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0044699 [BP]single-organism processprobableGO:0008150
GO:0000777 [CC]condensed chromosome kinetochoreprobableGO:0043234, GO:0005575, GO:0005622, GO:0032991, GO:0043232, GO:0000793, GO:0044464, GO:0005623, GO:0043226, GO:0044446, GO:0000779, GO:0043229, GO:0043228, GO:0044422, GO:0044424, GO:0044427, GO:0005694, GO:0000775, GO:0000776

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3E7E, chain A
Confidence level:very confident
Coverage over the Query: 5-142
View the alignment between query and template
View the model in PyMOL