Query         psy11558
Match_columns 74
No_of_seqs    113 out of 372
Neff          5.9 
Searched_HMMs 46136
Date          Fri Aug 16 21:32:57 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy11558.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/11558hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd05848 Ig1_Contactin-5 First   99.3 1.6E-11 3.5E-16   74.7   6.8   46   18-65      1-49  (94)
  2 cd05850 Ig1_Contactin-2 First   99.2 8.5E-11 1.8E-15   71.4   7.1   47   18-66      1-50  (94)
  3 cd07693 Ig1_Robo First immunog  99.2 1.6E-10 3.4E-15   68.4   6.3   44   18-63      1-44  (100)
  4 cd05849 Ig1_Contactin-1 First   99.1 3.1E-10 6.8E-15   69.2   6.6   43   18-62      1-46  (93)
  5 cd05749 Ig2_Tyro3_like Second   99.1 1.5E-10 3.2E-15   69.5   4.9   41   21-63      1-42  (81)
  6 cd05851 Ig3_Contactin-1 Third   99.1 4.5E-10 9.8E-15   67.5   5.7   43   18-62      1-43  (88)
  7 cd05722 Ig1_Neogenin First imm  99.0 8.8E-10 1.9E-14   66.3   6.2   44   20-65      1-44  (95)
  8 cd05762 Ig8_MLCK Eighth immuno  99.0 9.7E-10 2.1E-14   67.5   6.3   45   19-65      1-45  (98)
  9 cd05737 Ig_Myomesin_like_C C-t  99.0 1.7E-09 3.8E-14   64.9   6.7   44   21-65      3-46  (92)
 10 PF07679 I-set:  Immunoglobulin  99.0 3.1E-09 6.7E-14   62.2   7.3   48   19-68      1-48  (90)
 11 cd04972 Ig_TrkABC_d4 Fourth do  99.0 1.9E-09 4.2E-14   64.4   6.4   39   23-62      4-42  (90)
 12 cd04967 Ig1_Contactin First Ig  99.0 2.7E-09 5.8E-14   63.9   7.0   45   18-64      1-48  (91)
 13 cd05868 Ig4_NrCAM Fourth immun  99.0 1.6E-09 3.6E-14   63.3   5.2   31   34-65      1-31  (76)
 14 cd05747 Ig5_Titin_like M5, fif  98.9 4.1E-09 8.9E-14   63.2   6.6   46   17-64      2-47  (92)
 15 cd04968 Ig3_Contactin_like Thi  98.9 3.3E-09 7.1E-14   62.9   5.1   40   19-59      2-41  (88)
 16 cd05728 Ig4_Contactin-2-like F  98.9 6.5E-09 1.4E-13   61.7   5.4   41   21-63      2-42  (85)
 17 cd05870 Ig5_NCAM-2 Fifth immun  98.8 1.4E-08   3E-13   61.6   6.3   43   18-62      2-45  (98)
 18 cd05739 Ig3_RPTP_IIa_LAR_like   98.8 5.4E-09 1.2E-13   60.5   4.1   29   34-63      1-29  (69)
 19 cd05894 Ig_C5_MyBP-C C5 immuno  98.8 2.1E-08 4.5E-13   60.1   6.2   37   27-64      3-39  (86)
 20 cd05867 Ig4_L1-CAM_like Fourth  98.8 1.7E-08 3.6E-13   58.6   5.3   30   34-64      1-30  (76)
 21 cd05745 Ig3_Peroxidasin Third   98.8 1.2E-08 2.6E-13   59.0   4.6   30   33-63      1-30  (74)
 22 cd05869 Ig5_NCAM-1 Fifth immun  98.8 3.1E-08 6.7E-13   60.0   6.0   43   18-62      2-44  (97)
 23 cd05857 Ig2_FGFR Second immuno  98.7 5.4E-08 1.2E-12   56.8   5.6   34   30-64      5-38  (85)
 24 cd05730 Ig3_NCAM-1_like Third   98.7 4.2E-08 9.2E-13   58.7   5.1   45   19-64      2-47  (95)
 25 cd05758 Ig5_KIRREL3-like Fifth  98.7 1.1E-07 2.3E-12   57.7   6.8   44   18-64      2-46  (98)
 26 cd04978 Ig4_L1-NrCAM_like Four  98.7 4.6E-08 9.9E-13   55.9   4.9   31   34-65      1-31  (76)
 27 cd05875 Ig6_hNeurofascin_like   98.7 3.6E-08 7.9E-13   58.0   4.5   25   37-62      1-25  (77)
 28 cd05773 Ig8_hNephrin_like Eigh  98.7 4.4E-08 9.6E-13   61.0   5.1   46   17-63      3-51  (109)
 29 cd05865 Ig1_NCAM-1 First immun  98.7 8.8E-08 1.9E-12   58.8   6.3   37   27-63      8-45  (96)
 30 cd05874 Ig6_NrCAM Sixth immuno  98.7 3.5E-08 7.7E-13   58.0   4.3   25   37-62      1-25  (77)
 31 cd05723 Ig4_Neogenin Fourth im  98.7 6.1E-08 1.3E-12   55.7   5.1   27   36-63      1-27  (71)
 32 cd05892 Ig_Myotilin_C C-termin  98.7   7E-08 1.5E-12   56.9   5.1   26   37-63      1-26  (75)
 33 cd05733 Ig6_L1-CAM_like Sixth   98.6 3.9E-08 8.4E-13   57.5   4.0   26   37-63      1-26  (77)
 34 cd05891 Ig_M-protein_C C-termi  98.6 1.4E-07 2.9E-12   57.0   6.5   40   25-65      7-46  (92)
 35 cd05724 Ig2_Robo Second immuno  98.6 1.5E-07 3.3E-12   54.8   6.1   37   26-63      3-40  (86)
 36 cd05738 Ig2_RPTP_IIa_LAR_like   98.6 7.4E-08 1.6E-12   55.8   4.5   26   37-63      1-26  (74)
 37 cd04975 Ig4_SCFR_like Fourth i  98.6 8.1E-08 1.8E-12   59.6   4.9   36   27-63     11-47  (101)
 38 cd05893 Ig_Palladin_C C-termin  98.6   1E-07 2.2E-12   56.1   4.8   26   37-63      1-26  (75)
 39 cd05852 Ig5_Contactin-1 Fifth   98.6 8.9E-08 1.9E-12   55.9   4.4   28   34-62      1-28  (73)
 40 cd05760 Ig2_PTK7 Second immuno  98.6 9.9E-08 2.1E-12   55.7   4.6   28   37-65      1-28  (77)
 41 cd05732 Ig5_NCAM-1_like Fifth   98.6 1.9E-07   4E-12   55.6   5.6   42   18-62      2-43  (96)
 42 cd05764 Ig_2 Subgroup of the i  98.6 1.5E-07 3.3E-12   53.8   5.1   30   34-63      1-30  (74)
 43 cd05743 Ig_Perlecan_D2_like Im  98.6 1.8E-07   4E-12   54.5   5.0   29   34-63      1-29  (78)
 44 cd05744 Ig_Myotilin_C_like Imm  98.5   2E-07 4.4E-12   54.3   4.9   26   37-63      1-26  (75)
 45 cd04974 Ig3_FGFR Third immunog  98.5 1.2E-07 2.6E-12   56.9   4.0   23   34-56      1-23  (90)
 46 cd05866 Ig1_NCAM-2 First immun  98.5 3.3E-07 7.2E-12   56.0   5.9   38   26-64      7-44  (92)
 47 cd05746 Ig4_Peroxidasin Fourth  98.5 1.1E-07 2.4E-12   54.2   3.5   27   37-64      1-27  (69)
 48 cd05863 Ig2_VEGFR-3 Second imm  98.5 2.2E-07 4.7E-12   54.1   4.5   26   37-63      1-26  (67)
 49 cd04969 Ig5_Contactin_like Fif  98.5 2.4E-07 5.3E-12   53.2   4.6   30   34-64      1-30  (73)
 50 cd05859 Ig4_PDGFR-alpha Fourth  98.5 2.5E-07 5.5E-12   57.2   4.9   35   29-64     13-47  (101)
 51 KOG3513|consensus               98.5   2E-07 4.3E-12   77.0   5.3   49   16-66    329-377 (1051)
 52 cd05856 Ig2_FGFRL1-like Second  98.5 2.8E-07 6.1E-12   52.8   4.5   32   30-62      5-36  (82)
 53 cd05763 Ig_1 Subgroup of the i  98.5 1.9E-07 4.2E-12   53.7   3.7   22   37-58      1-22  (75)
 54 cd05748 Ig_Titin_like Immunogl  98.5 4.9E-07 1.1E-11   51.8   4.9   27   37-64      2-28  (74)
 55 cd04977 Ig1_NCAM-1_like First   98.4 9.5E-07 2.1E-11   53.3   6.3   39   23-63      5-43  (92)
 56 cd05735 Ig8_DSCAM Eight immuno  98.4 6.5E-07 1.4E-11   53.7   5.4   30   34-64      1-30  (88)
 57 cd05864 Ig2_VEGFR-2 Second imm  98.4 2.8E-07   6E-12   53.8   3.5   26   37-63      1-26  (70)
 58 cd05752 Ig1_FcgammaR_like Frst  98.4 9.2E-07   2E-11   52.4   5.7   42   19-62      1-43  (78)
 59 cd05858 Ig3_FGFR-2 Third immun  98.4 7.7E-07 1.7E-11   53.1   5.3   28   34-61      1-31  (90)
 60 cd05855 Ig_TrkB_d5 Fifth domai  98.4 5.7E-07 1.2E-11   54.0   4.5   28   38-66      2-29  (79)
 61 cd05845 Ig2_L1-CAM_like Second  98.4 6.7E-07 1.5E-11   55.7   4.8   44   18-61      2-46  (95)
 62 cd05876 Ig3_L1-CAM Third immun  98.4   3E-07 6.4E-12   52.8   3.0   24   37-61      1-24  (71)
 63 cd07702 Ig2_VEGFR-1 Second imm  98.4 6.1E-07 1.3E-11   52.9   4.2   27   37-64      1-27  (72)
 64 cd04976 Ig2_VEGFR Second immun  98.4 5.1E-07 1.1E-11   52.1   3.8   27   37-64      1-27  (71)
 65 cd05736 Ig2_Follistatin_like S  98.4 9.4E-07   2E-11   50.8   4.6   28   37-65      1-28  (76)
 66 cd05740 Ig_CEACAM_D4 Fourth im  98.4 1.2E-06 2.6E-11   53.0   5.2   42   19-62      2-44  (91)
 67 KOG3513|consensus               98.3 1.3E-06 2.8E-11   72.3   6.7   51   19-70     40-92  (1051)
 68 cd04971 Ig_TrKABC_d5 Fifth dom  98.3 6.4E-07 1.4E-11   53.4   3.7   27   38-65      2-28  (81)
 69 cd05754 Ig3_Perlecan_like Thir  98.3 1.8E-06   4E-11   50.7   5.6   37   21-57      3-40  (85)
 70 cd05734 Ig7_DSCAM Seventh immu  98.3 3.9E-07 8.5E-12   53.0   2.7   23   37-59      1-23  (79)
 71 cd04973 Ig1_FGFR First immunog  98.3 1.4E-06 3.1E-11   51.0   5.1   36   27-64      2-37  (79)
 72 cd05882 Ig1_Necl-1 First (N-te  98.3 1.2E-06 2.6E-11   53.8   4.9   33   27-59      5-37  (95)
 73 cd05750 Ig_Pro_neuregulin Immu  98.3 1.1E-06 2.3E-11   49.9   4.3   29   37-66      1-30  (75)
 74 cd05726 Ig4_Robo Fhird immunog  98.3   9E-07   2E-11   52.7   3.5   25   34-58      1-25  (90)
 75 cd05731 Ig3_L1-CAM_like Third   98.3 7.5E-07 1.6E-11   50.1   3.0   22   37-58      1-22  (71)
 76 cd07701 Ig1_Necl-3 First (N-te  98.3 2.3E-06 4.9E-11   52.2   4.9   34   26-59      4-37  (95)
 77 cd05854 Ig6_Contactin-2 Sixth   98.3 2.5E-06 5.4E-11   50.9   4.9   28   36-64      2-31  (85)
 78 cd05765 Ig_3 Subgroup of the i  98.2 1.6E-06 3.6E-11   49.8   3.9   23   34-56      1-23  (81)
 79 cd05725 Ig3_Robo Third immunog  98.2   1E-06 2.2E-11   49.9   2.9   22   37-58      1-22  (69)
 80 KOG4222|consensus               98.2 1.1E-06 2.3E-11   73.4   3.5   60    9-70     22-82  (1281)
 81 cd05873 Ig_Sema4D_like Immunog  98.2 6.9E-06 1.5E-10   50.1   5.8   36   27-64      4-39  (87)
 82 KOG4194|consensus               98.2 1.4E-06   3E-11   69.8   3.1   45   16-61    610-654 (873)
 83 cd04979 Ig_Semaphorin_C Immuno  98.1 6.1E-06 1.3E-10   48.9   4.4   35   26-62      3-37  (89)
 84 cd05729 Ig2_FGFR_like Second i  98.1 1.5E-05 3.3E-10   45.5   5.9   31   31-62      6-36  (85)
 85 cd04970 Ig6_Contactin_like Six  98.1 7.2E-06 1.6E-10   48.2   4.2   27   36-63      2-30  (85)
 86 PF13895 Ig_2:  Immunoglobulin   98.0 1.4E-05 3.1E-10   44.8   4.9   43   19-65      2-44  (80)
 87 cd05717 Ig1_Necl-1-3_like Firs  97.9 2.6E-05 5.7E-10   46.6   5.1   34   27-60      5-38  (95)
 88 cd05759 Ig2_KIRREL3-like Secon  97.9 2.2E-05 4.8E-10   45.8   4.6   26   37-63      2-28  (82)
 89 KOG4221|consensus               97.9 5.4E-05 1.2E-09   63.9   7.3   46   16-63    235-280 (1381)
 90 PHA02785 IL-beta-binding prote  97.9 6.9E-05 1.5E-09   54.5   6.9   40   22-63    224-266 (326)
 91 smart00408 IGc2 Immunoglobulin  97.8 3.2E-05 6.9E-10   40.7   3.8   28   34-62      2-29  (63)
 92 cd05756 Ig1_IL1R_like First im  97.8 3.9E-05 8.4E-10   46.8   4.2   29   31-60     11-44  (94)
 93 cd05727 Ig2_Contactin-2-like S  97.8 4.4E-05 9.6E-10   47.6   4.3   40   21-61      5-45  (96)
 94 cd05742 Ig1_VEGFR_like First i  97.8 2.8E-05 6.2E-10   45.5   3.1   24   34-57      1-26  (84)
 95 PHA02826 IL-1 receptor-like pr  97.7 9.8E-05 2.1E-09   51.8   5.8   38   26-64    136-178 (227)
 96 smart00409 IG Immunoglobulin.   97.7 0.00032 6.9E-09   38.5   6.6   35   28-62      3-37  (86)
 97 smart00410 IG_like Immunoglobu  97.7 0.00032 6.9E-09   38.5   6.6   35   28-62      3-37  (86)
 98 cd05861 Ig1_PDGFR-alphabeta Fr  97.7 8.4E-05 1.8E-09   44.1   4.3   24   34-57      1-24  (84)
 99 cd07690 Ig1_CD4 First immunogl  97.6 0.00017 3.6E-09   44.5   4.9   31   29-59      2-32  (94)
100 cd05885 Ig2_Necl-4 Second immu  97.6 0.00011 2.3E-09   44.5   3.9   27   37-64      2-29  (80)
101 cd05761 Ig2_Necl-1-4_like Seco  97.6 0.00012 2.7E-09   43.1   4.1   26   37-63      2-28  (82)
102 cd05853 Ig6_Contactin-4 Sixth   97.6 0.00018 3.9E-09   43.6   4.8   26   36-62      2-29  (85)
103 cd05898 Ig5_KIRREL3 Fifth immu  97.5 0.00036 7.7E-09   43.4   5.9   43   18-63      2-45  (98)
104 cd05895 Ig_Pro_neuregulin-1 Im  97.5 0.00011 2.4E-09   42.1   3.2   26   37-63      1-27  (76)
105 cd07705 Ig2_Necl-1 Second immu  97.5 0.00019 4.1E-09   42.8   4.0   26   37-63      2-28  (83)
106 cd00098 IgC Immunoglobulin Con  97.5 0.00022 4.8E-09   42.0   4.1   31   33-64     12-44  (95)
107 PF00047 ig:  Immunoglobulin do  97.4 0.00017 3.6E-09   39.6   3.1   27   34-60      1-28  (64)
108 cd05768 IgC_CH4 CH4 domain (fo  97.4 0.00034 7.4E-09   43.4   4.4   36   26-62      8-45  (102)
109 PF08205 C2-set_2:  CD80-like C  97.4 0.00041 8.9E-09   40.7   4.5   27   34-60     14-41  (89)
110 cd05884 Ig2_Necl-3 Second immu  97.4 0.00033 7.1E-09   41.9   4.1   26   37-63      2-28  (83)
111 cd05753 Ig2_FcgammaR_like Seco  97.4 0.00057 1.2E-08   40.5   5.0   36   25-62      6-42  (83)
112 cd05899 IgV_TCR_beta Immunoglo  97.4  0.0013 2.8E-08   40.2   6.7   32   25-57      4-35  (110)
113 cd05769 IgC_TCR_beta T cell re  97.3 0.00046 9.9E-09   44.1   4.3   44   18-62      2-47  (115)
114 PF13927 Ig_3:  Immunoglobulin   97.3 0.00028   6E-09   38.8   2.9   35   18-54      1-36  (75)
115 KOG4221|consensus               97.3 0.00021 4.6E-09   60.5   3.2   46   16-63    326-371 (1381)
116 cd05771 IgC_Tapasin_R Tapasin-  97.3  0.0011 2.3E-08   42.2   5.8   40   17-57     37-78  (139)
117 cd04983 IgV_TCR_alpha_like Imm  97.3 0.00066 1.4E-08   41.0   4.6   33   24-56      3-35  (109)
118 cd05871 Ig_Semaphorin_classIII  97.2 0.00069 1.5E-08   41.0   4.0   27   29-56      6-32  (91)
119 KOG4222|consensus               97.2 0.00034 7.4E-09   58.9   3.3   45   16-61    313-357 (1281)
120 cd05772 IgC_SIRP Signal-regula  97.2   0.001 2.2E-08   42.0   4.8   31   32-63     19-51  (111)
121 cd07698 IgC_MHC_I_alpha3 Class  97.1  0.0015 3.3E-08   39.3   5.1   25   34-59     14-40  (93)
122 cd04980 IgV_L_kappa Immunoglob  97.1   0.004 8.6E-08   37.8   6.9   34   22-56      4-38  (106)
123 cd07699 IgC_L Immunoglobulin C  97.0  0.0012 2.6E-08   40.6   4.1   43   19-62      2-46  (100)
124 cd05757 Ig2_IL1R_like Second i  97.0   0.001 2.2E-08   40.5   3.7   33   31-64      7-44  (92)
125 cd04982 IgV_TCR_gamma Immunogl  97.0  0.0044 9.6E-08   38.0   6.4   31   26-56      5-37  (116)
126 cd05766 IgC_MHC_II_beta Class   97.0  0.0029 6.4E-08   38.6   5.4   30   33-63     13-44  (94)
127 cd05883 Ig2_Necl-2 Second immu  97.0  0.0015 3.3E-08   39.6   4.0   26   37-63      2-28  (82)
128 cd05755 Ig2_ICAM-1_like Second  96.7   0.006 1.3E-07   38.2   5.4   31   32-63     14-47  (100)
129 cd05872 Ig_Sema4B_like Immunog  96.7  0.0034 7.4E-08   38.1   4.2   35   27-63      4-38  (85)
130 smart00407 IGc1 Immunoglobulin  96.7  0.0035 7.7E-08   36.2   3.9   24   37-61      2-27  (75)
131 cd05881 Ig1_Necl-2 First (N-te  96.5  0.0091   2E-07   36.9   5.3   35   26-60      4-38  (95)
132 PF07654 C1-set:  Immunoglobuli  96.4  0.0036 7.7E-08   36.7   2.9   29   34-63      8-38  (83)
133 cd07696 IgC_CH3 CH3 domain (th  96.3  0.0056 1.2E-07   37.6   3.3   35   26-60      6-43  (96)
134 cd05862 Ig1_VEGFR First immuno  96.3  0.0075 1.6E-07   35.8   3.7   26   34-59      1-28  (86)
135 KOG4194|consensus               96.0  0.0052 1.1E-07   49.9   2.8   42   17-59    705-747 (873)
136 cd05847 IgC_CH2_IgE CH2 domain  96.0   0.012 2.6E-07   36.0   3.7   27   34-61     14-42  (94)
137 PHA02826 IL-1 receptor-like pr  95.9   0.011 2.4E-07   41.4   3.6   32   26-57     29-71  (227)
138 cd04984 IgV_L_lambda Immunoglo  95.8   0.036 7.8E-07   33.1   5.2   27   31-57      3-31  (98)
139 cd00099 IgV Immunoglobulin var  95.7   0.021 4.6E-07   33.8   3.9   28   30-57      2-30  (105)
140 cd05767 IgC_MHC_II_alpha Class  95.6   0.055 1.2E-06   33.1   5.4   29   34-63     15-45  (94)
141 PHA02785 IL-beta-binding prote  95.5   0.014   3E-07   42.5   3.0   27   32-58     39-70  (326)
142 cd00096 Ig Immunoglobulin doma  95.5    0.02 4.3E-07   29.2   2.8   23   37-60      1-23  (74)
143 cd07697 IgC_TCR_gamma T cell r  95.4   0.019   4E-07   35.5   3.0   31   31-62     13-45  (96)
144 cd07706 IgV_TCR_delta Immunogl  95.3   0.047   1E-06   33.5   4.6   34   22-56      3-37  (116)
145 cd05751 Ig1_LILRB1_like First   95.3   0.073 1.6E-06   31.6   5.2   39   18-60      2-40  (91)
146 cd07704 Ig2_Nectin-3-4_like Se  95.2    0.05 1.1E-06   34.0   4.5   32   25-56      7-40  (97)
147 cd05860 Ig4_SCFR Fourth immuno  95.2   0.057 1.2E-06   34.1   4.7   35   27-62     11-46  (101)
148 cd05770 IgC_beta2m Class I maj  94.8   0.066 1.4E-06   32.8   4.2   29   33-62     14-44  (93)
149 PF07686 V-set:  Immunoglobulin  94.7   0.058 1.3E-06   31.5   3.6   33   24-56      6-39  (114)
150 cd07703 Ig2_Nectin-2_like Seco  94.6   0.072 1.6E-06   32.8   4.0   21   36-56     17-38  (95)
151 cd05719 Ig2_PVR_like Second im  94.5   0.062 1.3E-06   32.9   3.5   21   36-56     17-38  (95)
152 PF06832 BiPBP_C:  Penicillin-B  94.3    0.61 1.3E-05   27.7   7.4   51   16-68      8-61  (89)
153 cd05715 Ig_P0-like Immunoglobu  94.1    0.12 2.5E-06   31.9   4.2   31   26-56      5-39  (116)
154 cd05897 Ig2_IL1R2_like Second   93.5   0.096 2.1E-06   32.3   2.9   31   32-63      8-43  (95)
155 cd04985 IgC_CH1 CH1 domain (fi  93.3    0.35 7.6E-06   29.5   5.3   38   20-60      4-43  (95)
156 cd05741 Ig_CEACAM_D1_like Firs  93.3     0.1 2.2E-06   30.2   2.7   24   34-57      1-24  (92)
157 cd07694 Ig2_CD4 Second immunog  93.2    0.28   6E-06   30.4   4.7   32   31-62     11-44  (88)
158 cd07700 IgV_CD8_beta Immunoglo  93.1     0.2 4.4E-06   30.5   4.0   28   31-58      3-31  (107)
159 cd05714 Ig_CSPGs_LP Immunoglob  93.1    0.16 3.4E-06   30.6   3.4   23   34-56      2-30  (106)
160 cd05880 Ig_EVA1 Immunoglobulin  93.0    0.23   5E-06   30.9   4.2   30   26-55      5-38  (115)
161 PHA03052 Hypothetical protein;  93.0    0.46   1E-05   28.3   5.2   34   27-61      5-41  (69)
162 cd04981 IgV_H Immunoglobulin (  92.7    0.88 1.9E-05   28.3   6.6   33   23-56      2-36  (117)
163 cd05711 Ig_FcalphaRI Immunoglo  92.5    0.51 1.1E-05   28.3   5.1   37   19-58      2-38  (94)
164 cd04986 IgC_CH2 CH2 domain (se  92.5    0.26 5.6E-06   30.8   3.9   38   20-58      6-46  (99)
165 PHA02987 Ig domain OX-2-like p  92.3    0.27 5.9E-06   34.3   4.2   31   28-58     24-55  (189)
166 cd05720 Ig_CD8_alpha Immunoglo  91.9    0.77 1.7E-05   27.9   5.5   27   31-57      3-29  (104)
167 cd05877 Ig_LP_like Immunoglobu  91.1    0.37   8E-06   28.9   3.4   24   34-57      2-31  (106)
168 cd05712 Ig_Siglec_N Immunoglob  90.6    0.63 1.4E-05   28.8   4.2   33   25-57      5-43  (119)
169 cd05879 Ig_P0 Immunoglobulin (  90.6    0.63 1.4E-05   29.4   4.2   29   27-55      6-38  (116)
170 cd05718 Ig1_PVR_like First imm  89.9    0.38 8.2E-06   28.1   2.6   23   36-58      2-27  (98)
171 cd05716 Ig_pIgR Immunoglobulin  89.4    0.67 1.5E-05   27.3   3.5   28   30-57      3-31  (98)
172 cd05721 IgV_CTLA-4 Immunoglobu  89.3    0.85 1.8E-05   29.4   4.1   33   23-56      3-38  (115)
173 KOG3515|consensus               88.9     0.4 8.8E-06   39.3   2.9   31   28-58     16-47  (741)
174 cd05890 Ig2_Nectin-1_like Seco  88.9    0.85 1.8E-05   28.9   3.8   23   37-59     23-47  (98)
175 cd05900 Ig_Aggrecan Immunoglob  88.4    0.76 1.7E-05   28.9   3.4   23   34-56      2-36  (112)
176 cd07689 Ig2_VCAM-1 Second immu  88.2     1.3 2.8E-05   28.0   4.3   33   19-55      4-39  (99)
177 cd05774 Ig_CEACAM_D1 First imm  88.2     1.4   3E-05   27.4   4.5   24   31-56     10-35  (105)
178 cd07692 Ig_CD3_epsilon Immunog  88.0    0.52 1.1E-05   27.6   2.3   25   29-57      3-27  (65)
179 cd05878 Ig_Aggrecan_like Immun  87.9    0.95 2.1E-05   27.9   3.6   24   34-57      2-35  (110)
180 smart00406 IGv Immunoglobulin   87.6       1 2.2E-05   24.8   3.3   21   37-57      2-24  (81)
181 cd05713 Ig_MOG_like Immunoglob  86.9     1.7 3.6E-05   25.6   4.1   25   34-58      1-28  (100)
182 cd05846 Ig1_MRC-OX-2_like Firs  86.5     1.3 2.8E-05   26.3   3.5   25   34-58      1-26  (97)
183 PHA03376 BARF1; Provisional     85.6    0.64 1.4E-05   33.1   2.1   26   34-59    139-164 (221)
184 cd05902 Ig_Neurocan Immunoglob  81.4     2.4 5.1E-05   26.6   3.2   23   34-56      2-31  (110)
185 KOG3515|consensus               77.0     5.1 0.00011   33.1   4.6   36   36-72    611-646 (741)
186 cd05775 Ig_SLAM-CD84_like_N N-  76.7     2.2 4.7E-05   25.5   2.0   24   33-56      3-27  (97)
187 cd05896 Ig1_IL1RAPL-1_like Fir  76.1     5.3 0.00012   25.2   3.7   28   29-56     10-48  (104)
188 cd05901 Ig_Versican Immunoglob  68.7     8.5 0.00018   24.6   3.4   23   34-56      2-35  (117)
189 PHA03112 IL-18 binding protein  63.0      11 0.00024   25.2   3.2   25   33-57     37-63  (141)
190 PF11910 NdhO:  Cyanobacterial   61.9      13 0.00028   22.0   2.9   40   14-57     23-62  (67)
191 cd05886 Ig1_Nectin-1_like Firs  52.7      30 0.00064   21.0   3.7   20   36-56      2-26  (99)
192 KOG4597|consensus               52.4      10 0.00023   30.3   1.9   30   31-60    208-239 (560)
193 KOG1026|consensus               49.9      15 0.00033   30.6   2.5   25   32-56    205-229 (774)
194 cd05888 Ig1_Nectin-4_like Frst  48.8      24 0.00053   21.0   2.8   21   36-56      2-25  (100)
195 PF06328 Lep_receptor_Ig:  Ig-l  48.6      59  0.0013   19.6   5.9   36   24-61      9-49  (89)
196 cd07691 Ig_CD3_gamma_delta Imm  48.4      28  0.0006   20.6   2.9   22   36-63      8-29  (69)
197 cd05889 Ig1_DNAM-1_like First   40.1      41 0.00089   20.4   2.9   23   36-58      2-25  (96)
198 PF03921 ICAM_N:  Intercellular  37.8      37 0.00081   20.9   2.4   31   23-55      8-39  (91)
199 smart00089 PKD Repeats in poly  36.4      78  0.0017   17.5   5.0   28   33-60     13-41  (79)
200 PF05428 CRF-BP:  Corticotropin  36.2      61  0.0013   24.4   3.7   32   13-45     77-108 (311)
201 PHA02865 MHC-like TNF binding   35.9      59  0.0013   24.7   3.6   21   36-56    216-238 (338)
202 PF08204 V-set_CD47:  CD47 immu  33.9      40 0.00087   22.1   2.2   26   35-61     28-58  (130)
203 PRK14051 negative regulator Gr  33.9      41 0.00089   21.9   2.2   22   32-53     81-102 (123)
204 cd05887 Ig1_Nectin-3_like Firs  31.9      76  0.0017   19.2   3.1   23   36-58      2-25  (96)
205 PF01681 C6:  C6 domain;  Inter  30.6      58  0.0013   19.3   2.4   21   37-63     69-89  (92)
206 COG3908 Uncharacterized protei  27.8      75  0.0016   19.1   2.5   14   37-50     29-42  (77)
207 PF02124 Marek_A:  Marek's dise  27.6 1.5E+02  0.0032   21.1   4.3   41   16-59     74-116 (211)
208 TIGR02073 PBP_1c penicillin-bi  27.1 2.8E+02   0.006   22.8   6.3   45   19-65    644-693 (727)
209 cd00146 PKD polycystic kidney   26.6 1.2E+02  0.0027   16.7   4.5   25   34-58     14-39  (81)
210 PF10094 DUF2332:  Uncharacteri  23.7      72  0.0016   24.0   2.3   29   33-63    168-200 (343)
211 PF09866 DUF2093:  Uncharacteri  22.5      75  0.0016   17.1   1.6   13   37-49      6-18  (42)
212 PF11386 VERL:  Vitelline envel  22.0      78  0.0017   19.2   1.8   12   37-48     61-72  (78)

No 1  
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5. Ig1_Contactin-5: First Ig domain of the neural cell adhesion molecule contactin-5. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains, anchored to the membrane by glycosylphosphatidylinositol. The different contactins show different expression patterns in the central nervous system. In rats, a lack of contactin-5 (NB-2) results in an impairment of the neuronal activity in the auditory system. Contactin-5 is expressed specifically in the postnatal nervous system, peaking at about 3 weeks postnatal. Contactin-5 is highly expressed in the adult human brain in the occipital lobe and in the amygdala; lower levels of expression have been detected in the corpus callosum, caudate nucleus, and spinal cord.
Probab=99.28  E-value=1.6e-11  Score=74.71  Aligned_cols=46  Identities=37%  Similarity=0.905  Sum_probs=36.8

Q ss_pred             cceEEEcCCCcEEec---CCCCeEEEEEEcccCCCeEEEEeCCCeeecCCC
Q psy11558         18 GPIFIKEPPNRIDFS---NTTGAQVECTARGSPNPEIIWIRSDGTAVGDVP   65 (74)
Q Consensus        18 ~P~fv~~Pp~~v~~~---~g~~v~L~C~A~G~P~P~I~W~~~dG~~i~~~~   65 (74)
                      +|.|+.+|.+.+ +.   +|..++|.|.|.|+|.|+|+|++ ||.++....
T Consensus         1 ~P~f~~~p~~~~-~~~~~~g~~v~l~C~~~G~P~P~i~W~k-~g~~l~~~~   49 (94)
T cd05848           1 GPVFVQEPDDAI-FPTDSDEKKVILNCEARGNPVPTYRWLR-NGTEIDTES   49 (94)
T ss_pred             CCeeEECCCcEE-ccCCCCCCEEEEEEEeeecCCCEEEEEE-CCeECccCC
Confidence            589999976644 43   35679999999999999999996 788886443


No 2  
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2. Ig1_Contactin-2: First Ig domain of the neural cell adhesion molecule contactin-2-like. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. It may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module by contacts between IG domains 1 and 4, and domains 2 and 3. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-2 is also expressed in retinal amacrine cells in the developing c
Probab=99.20  E-value=8.5e-11  Score=71.39  Aligned_cols=47  Identities=30%  Similarity=0.637  Sum_probs=37.0

Q ss_pred             cceEEEcCCCcEEecCC---CCeEEEEEEcccCCCeEEEEeCCCeeecCCCC
Q psy11558         18 GPIFIKEPPNRIDFSNT---TGAQVECTARGSPNPEIIWIRSDGTAVGDVPG   66 (74)
Q Consensus        18 ~P~fv~~Pp~~v~~~~g---~~v~L~C~A~G~P~P~I~W~~~dG~~i~~~~~   66 (74)
                      +|.|+++| +.+.+.+|   +.+.|.|.|.|+|.|+|+|++ ||.++....+
T Consensus         1 ~P~f~~~P-~~~~~~~~~~g~~v~l~C~a~g~P~p~i~W~~-~g~~l~~~~~   50 (94)
T cd05850           1 GPVFEEQP-SSLLFPEGSPEEKVTLGCRARASPPATYRWKM-NGTEIKFAPE   50 (94)
T ss_pred             CCeeEECC-CCEEecCCCCCCeEEEEeEceeCCCCEEEEEE-CCEECccCCC
Confidence            58999985 45456655   359999999999999999996 8888764443


No 3  
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins. Ig1_Robo: domain similar to the first immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit res
Probab=99.15  E-value=1.6e-10  Score=68.37  Aligned_cols=44  Identities=27%  Similarity=0.684  Sum_probs=37.7

Q ss_pred             cceEEEcCCCcEEecCCCCeEEEEEEcccCCCeEEEEeCCCeeecC
Q psy11558         18 GPIFIKEPPNRIDFSNTTGAQVECTARGSPNPEIIWIRSDGTAVGD   63 (74)
Q Consensus        18 ~P~fv~~Pp~~v~~~~g~~v~L~C~A~G~P~P~I~W~~~dG~~i~~   63 (74)
                      +|.|++.| +++.+.+|+.++|.|.|.|+|.|+|+|++ ||..+..
T Consensus         1 ~P~i~~~p-~~~~v~~G~~~~l~C~~~g~P~p~i~W~k-~g~~l~~   44 (100)
T cd07693           1 PPRIVEHP-SDLIVSKGDPATLNCKAEGRPTPTIQWLK-NGQPLET   44 (100)
T ss_pred             CCeEEecC-ceeEEcCCCeEEEEeeCCcCCCCEEEEEE-CCEECcc
Confidence            58899886 45668889899999999999999999997 7887755


No 4  
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1. Ig1_Contactin-1: First Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may, through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=99.11  E-value=3.1e-10  Score=69.18  Aligned_cols=43  Identities=26%  Similarity=0.652  Sum_probs=34.2

Q ss_pred             cceEEEcCCCcEEecCCC---CeEEEEEEcccCCCeEEEEeCCCeeec
Q psy11558         18 GPIFIKEPPNRIDFSNTT---GAQVECTARGSPNPEIIWIRSDGTAVG   62 (74)
Q Consensus        18 ~P~fv~~Pp~~v~~~~g~---~v~L~C~A~G~P~P~I~W~~~dG~~i~   62 (74)
                      +|.|+.+|.+. .+.++.   .+.|+|.|.|+|.|+|+|++ ||.++.
T Consensus         1 ~P~f~~~P~~~-~~~~~~~~~~v~l~C~a~G~P~P~i~W~k-~~~~i~   46 (93)
T cd05849           1 GPVFEEQPIDT-IYPEESTEGKVSVNCRARANPFPIYKWRK-NNLDID   46 (93)
T ss_pred             CCEEEECCCCE-EecCCccCCeEEEeCcCccCCCCEEEEEE-CCEEcc
Confidence            58999997654 454433   59999999999999999997 677664


No 5  
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs). Ig2_Tyro3_like: the second immunoglobulin (Ig)-like domain in the Axl/Tyro3 family of receptor tyrosine kinases (RTKs). This family includes Axl (also known as Ark, Ufo, and Tyro7), Tyro3 (also known as Sky, Rse, Brt, Dtk, and Tif), and Mer (also known as Nyk, c-Eyk, and Tyro12). Axl/Tyro3 family receptors have an extracellular portion with two Ig-like domains followed by two fibronectin-types III (FNIII) domains, a membrane-spanning single helix, and a cytoplasmic tyrosine kinase domain. Axl, Tyro3 and Mer are widely expressed in adult tissues, though they show higher expression in the brain, in the lymphatic and vascular systems, and in the testis. Axl, Tyro3, and Mer bind the vitamin K dependent protein Gas6 with high affinity, and in doing so activate their tyrosine kinase activity. Axl/Gas6 signaling may play a part in cell adhesion processes, prevention of apoptosis, and c
Probab=99.11  E-value=1.5e-10  Score=69.53  Aligned_cols=41  Identities=37%  Similarity=0.841  Sum_probs=34.0

Q ss_pred             EEEcCCCcEEecCCCCeEEEEEEcccCCC-eEEEEeCCCeeecC
Q psy11558         21 FIKEPPNRIDFSNTTGAQVECTARGSPNP-EIIWIRSDGTAVGD   63 (74)
Q Consensus        21 fv~~Pp~~v~~~~g~~v~L~C~A~G~P~P-~I~W~~~dG~~i~~   63 (74)
                      |+++| +++.+..|+.+.|+|.|+|+|.| +|+|.+ ||.++..
T Consensus         1 f~~~P-~~~~v~~G~~v~l~C~a~G~P~P~~I~W~k-~g~~l~~   42 (81)
T cd05749           1 FTVEP-EDLSVTANTPFNLTCQAVGPPEPVEILWWQ-GGSPLGD   42 (81)
T ss_pred             CcCCC-CceEEcCCCCEEEEEEeeeecCCeEEEEEE-CCEECCC
Confidence            45664 55678889999999999999999 799996 7888754


No 6  
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig3_Contactin-1: Third Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=99.06  E-value=4.5e-10  Score=67.46  Aligned_cols=43  Identities=19%  Similarity=0.194  Sum_probs=35.4

Q ss_pred             cceEEEcCCCcEEecCCCCeEEEEEEcccCCCeEEEEeCCCeeec
Q psy11558         18 GPIFIKEPPNRIDFSNTTGAQVECTARGSPNPEIIWIRSDGTAVG   62 (74)
Q Consensus        18 ~P~fv~~Pp~~v~~~~g~~v~L~C~A~G~P~P~I~W~~~dG~~i~   62 (74)
                      +|.|+..|.+. ....|+.++|.|.|.|+|.|+|+|++ +|.++.
T Consensus         1 ~p~i~~~~~~~-~~~~G~~v~l~C~~~G~P~P~v~W~k-~~~~~~   43 (88)
T cd05851           1 PADINVKFKDT-YALKGQNVTLECFALGNPVPVIRWRK-ILEPMP   43 (88)
T ss_pred             CCceEEccccE-EEeCCCcEEEEEEecccCCCEEEEEE-CCcCCC
Confidence            58899996655 56788899999999999999999997 555543


No 7  
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins. Ig1_Neogenin: first immunoglobulin (Ig)-like domain in neogenin and related proteins. Neogenin  is a cell surface protein which is expressed in the developing nervous system of vertebrate embryos in the growing nerve cells. It is also expressed in other embryonic tissues, and may play a general role in developmental processes such as cell migration, cell-cell recognition, and tissue growth regulation. Included in this group is the tumor suppressor protein DCC, which is deleted in colorectal carcinoma . DCC and neogenin each have four Ig-like domains followed by six fibronectin type III domains, a transmembrane domain, and an intracellular domain.
Probab=99.04  E-value=8.8e-10  Score=66.32  Aligned_cols=44  Identities=30%  Similarity=0.587  Sum_probs=35.8

Q ss_pred             eEEEcCCCcEEecCCCCeEEEEEEcccCCCeEEEEeCCCeeecCCC
Q psy11558         20 IFIKEPPNRIDFSNTTGAQVECTARGSPNPEIIWIRSDGTAVGDVP   65 (74)
Q Consensus        20 ~fv~~Pp~~v~~~~g~~v~L~C~A~G~P~P~I~W~~~dG~~i~~~~   65 (74)
                      .|+.+|.+. .+.+|+++.|.|.|.|+|.|+|+|++ ||..+....
T Consensus         1 ~f~~~P~~~-~~~~g~~v~l~C~v~g~P~p~i~W~k-~g~~l~~~~   44 (95)
T cd05722           1 WFLSEPSDI-VAVRGGPVVLNCSAEGEPPPKIEWKK-DGVLLNLVS   44 (95)
T ss_pred             CcEECCCCe-EEcCCCCEEEeeecccCCCCEEEEEE-CCeECcccc
Confidence            377887654 56678899999999999999999996 888886543


No 8  
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK). Ig8_MLCK: the eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK). MLCK is a key regulator of different forms of cell motility involving actin and myosin II.  Agonist stimulation of smooth muscle cells increases cytosolic Ca2+, which binds calmodulin.  This Ca2+-calmodulin complex in turn binds to and activates MLCK. Activated MLCK leads to the phosphorylation of the 20 kDa myosin regulatory light chain (RLC) of myosin II and the stimulation of actin-activated myosin MgATPase activity. MLCK is widely present in vertebrate tissues; it phosphorylates the 20 kDa RLC of both smooth and nonmuscle myosin II. Phosphorylation leads to the activation of the myosin motor domain and altered structural properties of myosin II. In smooth muscle MLCK it is involved in initiating contraction. In nonmuscle cells, MLCK may participate in cell division and cell motility; it has
Probab=99.03  E-value=9.7e-10  Score=67.45  Aligned_cols=45  Identities=13%  Similarity=0.349  Sum_probs=37.9

Q ss_pred             ceEEEcCCCcEEecCCCCeEEEEEEcccCCCeEEEEeCCCeeecCCC
Q psy11558         19 PIFIKEPPNRIDFSNTTGAQVECTARGSPNPEIIWIRSDGTAVGDVP   65 (74)
Q Consensus        19 P~fv~~Pp~~v~~~~g~~v~L~C~A~G~P~P~I~W~~~dG~~i~~~~   65 (74)
                      |.|++.| +.+.+..|+.+.|.|.+.|.|+|+|+|++ ||.+|....
T Consensus         1 p~~~~~p-~~~~v~~G~~v~l~C~~~G~p~p~v~W~k-dg~~l~~~~   45 (98)
T cd05762           1 PQIIQFP-EDMKVRAGESVELFCKVTGTQPITCTWMK-FRKQIQEGE   45 (98)
T ss_pred             CceEECC-cCEEEECCCEEEEEEEEcccCCCceEEEE-CCEEecCCC
Confidence            6788885 55567889999999999999999999986 888886544


No 9  
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein. Ig_Myomesin_like_C: domain similar to the C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein. Myomesin and M-protein are both structural proteins localized to the M-band, a transverse structure in the center of the sarcomere, and are candidates for M-band bridges. Both proteins are modular, consisting mainly of repetitive Ig-like and fibronectin type III (FnIII) domains. Myomesin is expressed in all types of vertebrate striated muscle; M-protein has a muscle-type specific expression pattern. Myomesin is present in both slow and fast fibers; M-protein is present only in fast fibers. It has been suggested that myomesin acts as a molecular spring with alternative splicing as a means of modifying its elasticity.
Probab=99.01  E-value=1.7e-09  Score=64.93  Aligned_cols=44  Identities=20%  Similarity=0.537  Sum_probs=37.6

Q ss_pred             EEEcCCCcEEecCCCCeEEEEEEcccCCCeEEEEeCCCeeecCCC
Q psy11558         21 FIKEPPNRIDFSNTTGAQVECTARGSPNPEIIWIRSDGTAVGDVP   65 (74)
Q Consensus        21 fv~~Pp~~v~~~~g~~v~L~C~A~G~P~P~I~W~~~dG~~i~~~~   65 (74)
                      ++...|+.+.+.+|..+.|.|.+.|+|.|+|+|++ ||.++....
T Consensus         3 ~~~~lp~~v~v~~G~~v~L~C~v~G~P~p~v~W~k-~g~~l~~~~   46 (92)
T cd05737           3 VVGGLPDVVTIMEGKTLNLTCTVFGDPDPEVSWLK-NDQALALSD   46 (92)
T ss_pred             eeccCCceEEEeCCCcEEEEEEEEecCCCeEEEEE-CCEECccCC
Confidence            56677888888899999999999999999999997 788776544


No 10 
>PF07679 I-set:  Immunoglobulin I-set domain;  InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents I-set domains, which are found in several cell adhesion molecules, including vascular (VCAM), intercellular (ICAM), neural (NCAM) and mucosal addressin (MADCAM) cell adhesion molecules, as well as junction adhesion molecules (JAM). I-set domains are also present in several other diverse protein families, including several tyrosine-protein kinase receptors, the hemolymph protein hemolin, the muscle proteins titin, telokin, and twitchin, the neuronal adhesion molecule axonin-1 [], and the signalling molecule semaphorin 4D that is involved in axonal guidance, immune function and angiogenesis [].; PDB: 3MTR_A 2EDK_A 3DMK_B 1KOA_A 3NCM_A 2NCM_A 2V9Q_A 2CR3_A 3QQN_A 3QR2_A ....
Probab=99.00  E-value=3.1e-09  Score=62.22  Aligned_cols=48  Identities=23%  Similarity=0.692  Sum_probs=40.6

Q ss_pred             ceEEEcCCCcEEecCCCCeEEEEEEcccCCCeEEEEeCCCeeecCCCCce
Q psy11558         19 PIFIKEPPNRIDFSNTTGAQVECTARGSPNPEIIWIRSDGTAVGDVPGLR   68 (74)
Q Consensus        19 P~fv~~Pp~~v~~~~g~~v~L~C~A~G~P~P~I~W~~~dG~~i~~~~~~r   68 (74)
                      |.|+..| .++.+..|++++|.|.++|.|.|+|+|++ ||.++......+
T Consensus         1 P~~~~~~-~~~~v~~G~~~~l~c~~~~~p~~~v~W~~-~~~~l~~~~~~~   48 (90)
T PF07679_consen    1 PVFTKKP-KDVTVKEGESVTLECEVSGNPPPTVTWYK-NGRPLTSSQRYQ   48 (90)
T ss_dssp             EEEEEES-SEEEEETTSEEEEEEEEEESSSSEEEEEE-TTEEEESSSSEE
T ss_pred             CEEEEec-CCEEEeCCCEEEEEEEEEeCCCCcccccc-cccceeeeeeee
Confidence            7888886 77778899999999999999999999997 688887744443


No 11 
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC. TrkABC_d4: the fourth domain of Trk receptors TrkA, TrkB and TrkC, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors. They are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkA, TrkB, and TrkC share significant sequence homology and domain organization. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrkA, Band C mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. TrkA is recognized by NGF. TrKB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. TrkC is recognized by NT-3. NT-3 is promiscuous as in some cell systems it activates TrkA and TrkB receptors. TrkA is a receptor fo
Probab=98.99  E-value=1.9e-09  Score=64.39  Aligned_cols=39  Identities=36%  Similarity=0.571  Sum_probs=32.7

Q ss_pred             EcCCCcEEecCCCCeEEEEEEcccCCCeEEEEeCCCeeec
Q psy11558         23 KEPPNRIDFSNTTGAQVECTARGSPNPEIIWIRSDGTAVG   62 (74)
Q Consensus        23 ~~Pp~~v~~~~g~~v~L~C~A~G~P~P~I~W~~~dG~~i~   62 (74)
                      .+||++.....|+.+.|.|.|.|+|.|+|+|++ ||..+.
T Consensus         4 v~~p~~~~v~~G~~v~l~C~~~G~P~p~v~W~~-~g~~~~   42 (90)
T cd04972           4 VDGPNATVVYEGGTATIRCTAEGSPLPKVEWII-AGLIVI   42 (90)
T ss_pred             ccCCcCEEEcCCCcEEEEEEEEEcCCCeEEEEE-CCEEcc
Confidence            445666668889999999999999999999997 676664


No 12 
>cd04967 Ig1_Contactin First Ig domain of contactin. Ig1_Contactin: First Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 weeks postnata
Probab=98.99  E-value=2.7e-09  Score=63.87  Aligned_cols=45  Identities=36%  Similarity=0.808  Sum_probs=35.2

Q ss_pred             cceEEEcCCCcEEecCC---CCeEEEEEEcccCCCeEEEEeCCCeeecCC
Q psy11558         18 GPIFIKEPPNRIDFSNT---TGAQVECTARGSPNPEIIWIRSDGTAVGDV   64 (74)
Q Consensus        18 ~P~fv~~Pp~~v~~~~g---~~v~L~C~A~G~P~P~I~W~~~dG~~i~~~   64 (74)
                      +|.|+.+|.+ +.+..+   +.+.|.|.|.|+|.|+|+|++ ||.++...
T Consensus         1 ~P~f~~~p~~-~~~~~~~~~~~~~l~C~~~g~p~p~i~W~k-~~~~l~~~   48 (91)
T cd04967           1 GPVFEEQPDD-TIFPEESDEGKVSLNCRARGSPPPTYRWLM-NGTEIDDE   48 (91)
T ss_pred             CCeeEeCCCC-EEccCCCCCCEEEEEEeeeEcCCCEEEEEE-CCEECCCC
Confidence            5899999665 445433   359999999999999999996 78887443


No 13 
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule). Ig4_ NrCAM: fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule). NrCAM belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six IG-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. NrCAM is primarily expressed in the nervous system.
Probab=98.96  E-value=1.6e-09  Score=63.32  Aligned_cols=31  Identities=29%  Similarity=0.758  Sum_probs=26.7

Q ss_pred             CCCeEEEEEEcccCCCeEEEEeCCCeeecCCC
Q psy11558         34 TTGAQVECTARGSPNPEIIWIRSDGTAVGDVP   65 (74)
Q Consensus        34 g~~v~L~C~A~G~P~P~I~W~~~dG~~i~~~~   65 (74)
                      |+.++|.|.|.|+|+|+|+|++ ||.++...+
T Consensus         1 g~~~~l~C~a~G~P~P~i~W~k-~g~~i~~~~   31 (76)
T cd05868           1 GEDGTLICRANGNPKPSISWLT-NGVPIEIAP   31 (76)
T ss_pred             CCCEEEEEEeeEeCCCeEEEEE-CCEEccccC
Confidence            4679999999999999999997 898886543


No 14 
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins. Ig5_Titin_like: domain similar to the M5, fifth immunoglobulin (Ig)-like domain from the human titin C terminus. Titin (also called connectin) is a fibrous sarcomeric protein specifically found in vertebrate striated muscle. Titin is gigantic; depending on isoform composition it ranges from 2970 to 3700 kDa, and is of a length that spans half a sarcomere. Titin largely consists of multiple repeats of Ig-like and fibronectin type 3 (FN-III)-like domains. Titin connects the ends of myosin thick filaments to Z disks and extends along the thick filament to the H zone, and appears to function similar to an elastic band, keeping the myosin filaments centered in the sarcomere during muscle contraction or stretching.
Probab=98.95  E-value=4.1e-09  Score=63.17  Aligned_cols=46  Identities=24%  Similarity=0.645  Sum_probs=37.7

Q ss_pred             ccceEEEcCCCcEEecCCCCeEEEEEEcccCCCeEEEEeCCCeeecCC
Q psy11558         17 LGPIFIKEPPNRIDFSNTTGAQVECTARGSPNPEIIWIRSDGTAVGDV   64 (74)
Q Consensus        17 ~~P~fv~~Pp~~v~~~~g~~v~L~C~A~G~P~P~I~W~~~dG~~i~~~   64 (74)
                      .+|.|+..| +++....|+.+.|+|.|.|+|.|+++|++ ||..+...
T Consensus         2 ~~~~~~~~p-~~~~~~~G~~~~L~C~~~g~P~p~v~W~k-~g~~l~~~   47 (92)
T cd05747           2 LPATILTKP-RSLTVSEGESARFSCDVDGEPAPTVTWMR-EGQIIVSS   47 (92)
T ss_pred             CCCcccccC-ccEEEeCCCcEEEEEEEeecCCCEEEEEE-CCEECCCC
Confidence            468888885 55667888899999999999999999997 67776543


No 15 
>cd04968 Ig3_Contactin_like Third Ig domain of contactin. Ig3_Contactin_like: Third Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=98.91  E-value=3.3e-09  Score=62.91  Aligned_cols=40  Identities=30%  Similarity=0.573  Sum_probs=31.9

Q ss_pred             ceEEEcCCCcEEecCCCCeEEEEEEcccCCCeEEEEeCCCe
Q psy11558         19 PIFIKEPPNRIDFSNTTGAQVECTARGSPNPEIIWIRSDGT   59 (74)
Q Consensus        19 P~fv~~Pp~~v~~~~g~~v~L~C~A~G~P~P~I~W~~~dG~   59 (74)
                      |.+...| ..+....|+.++|.|.|.|+|.|+|+|.++++.
T Consensus         2 ~~~~~~p-~~~~~~~g~~v~l~C~~~g~P~p~v~W~k~~~~   41 (88)
T cd04968           2 SIIVVFP-KDTYALKGQNVTLECFALGNPVPQIKWRKVDGS   41 (88)
T ss_pred             CcEEECC-CceEEeCCCcEEEEEEeeEeCCCEEEEEECCCc
Confidence            4556665 555577888999999999999999999985553


No 16 
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins. Ig4_Contactin-2-like: fourth Ig domain of the neural cell adhesion molecule contactin-2. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (aliases TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. The first four Ig domains form the intermolecular binding fragment which arranges as a compact U-shaped module by contacts between Ig domains 1 and 4, and domains 2 and 3. It has been proposed that a linear zipper-like array forms, from contactin-2 molecules alternatively provided by the two apposed membranes.
Probab=98.87  E-value=6.5e-09  Score=61.70  Aligned_cols=41  Identities=22%  Similarity=0.575  Sum_probs=33.6

Q ss_pred             EEEcCCCcEEecCCCCeEEEEEEcccCCCeEEEEeCCCeeecC
Q psy11558         21 FIKEPPNRIDFSNTTGAQVECTARGSPNPEIIWIRSDGTAVGD   63 (74)
Q Consensus        21 fv~~Pp~~v~~~~g~~v~L~C~A~G~P~P~I~W~~~dG~~i~~   63 (74)
                      |+..| .+.....|+.+.|.|.|.|.|.|+++|++ ||.++..
T Consensus         2 ~~~~p-~~~~~~~G~~~~l~C~~~g~p~p~v~W~k-~g~~~~~   42 (85)
T cd05728           2 WLKVI-SDTEADIGSSLRWECKASGNPRPAYRWLK-NGQPLAS   42 (85)
T ss_pred             ccccC-CccEEcCCCcEEEEEEeeEeCCCEEEEEE-CCEECCC
Confidence            56665 44567788899999999999999999986 7877754


No 17 
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM). Ig5_NCAM-2: the fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM). NCAM-2  is organized similarly to NCAM , including five N-terminal Ig-like domains and two fibronectin type III domains. NCAM-2 is differentially expressed in the developing and mature olfactory epithelium (OE), and may function like NCAM, as an adhesion molecule.
Probab=98.84  E-value=1.4e-08  Score=61.57  Aligned_cols=43  Identities=33%  Similarity=0.607  Sum_probs=33.2

Q ss_pred             cceEEEcCCCcEEecCCCCeEEEEEEcccCCCeEEEEeC-CCeeec
Q psy11558         18 GPIFIKEPPNRIDFSNTTGAQVECTARGSPNPEIIWIRS-DGTAVG   62 (74)
Q Consensus        18 ~P~fv~~Pp~~v~~~~g~~v~L~C~A~G~P~P~I~W~~~-dG~~i~   62 (74)
                      +|.++. +. ++...+|+.++|.|.|.|.|.|+|+|++. +|..+.
T Consensus         2 ~p~i~~-~~-~~~~~~G~~v~l~C~~~G~P~p~i~W~k~~~g~~~~   45 (98)
T cd05870           2 QPHIIQ-LK-NETTVENGAATLSCKAEGEPIPEITWKRASDGHTFS   45 (98)
T ss_pred             CCEEEe-ec-cEEEcCCCcEEEEEecccCCCCeEEEEECCCCceec
Confidence            577754 44 45577888999999999999999999985 454443


No 18 
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. Ig3_RPTP_IIa_LAR_like: domain similar to the third immunoglobulin (Ig)-like domain found in the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. LAR belongs to the RPTP type IIa subfamily. Members of this subfamily are cell adhesion molecule-like proteins involved in central nervous system (CNS) development. They have large extracellular portions, comprised of multiple IG-like domains and two to nine fibronectin type III (FNIII) domains, and a cytoplasmic portion having two tandem phosphatase domains. Included in this group is Drosophila LAR (DLAR).
Probab=98.83  E-value=5.4e-09  Score=60.48  Aligned_cols=29  Identities=24%  Similarity=0.676  Sum_probs=24.3

Q ss_pred             CCCeEEEEEEcccCCCeEEEEeCCCeeecC
Q psy11558         34 TTGAQVECTARGSPNPEIIWIRSDGTAVGD   63 (74)
Q Consensus        34 g~~v~L~C~A~G~P~P~I~W~~~dG~~i~~   63 (74)
                      |+.+.|.|.|.|+|.|+|+|++ ||.++..
T Consensus         1 G~~v~L~C~a~G~P~P~v~W~k-~g~~l~~   29 (69)
T cd05739           1 GGSVNLTCVAVGAPMPYVKWMK-GGEELTK   29 (69)
T ss_pred             CCeEEEEEEeeecCCCEEEEEE-CCEECCC
Confidence            4569999999999999999997 6666643


No 19 
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C). Ig_C5_MyBP_C : the C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C). MyBP_C consists of repeated domains, Ig and fibronectin type 3, and various linkers. Three isoforms of MYBP_C exist and are included in this group: cardiac(c), and fast and slow skeletal muscle (s) MyBP_C. cMYBP_C has insertions between and inside domains and an additional cardiac-specific Ig domain at the N-terminus. For cMYBP_C  an interaction has been demonstrated between this C5 domain and the Ig C8 domain.
Probab=98.80  E-value=2.1e-08  Score=60.10  Aligned_cols=37  Identities=22%  Similarity=0.463  Sum_probs=31.4

Q ss_pred             CcEEecCCCCeEEEEEEcccCCCeEEEEeCCCeeecCC
Q psy11558         27 NRIDFSNTTGAQVECTARGSPNPEIIWIRSDGTAVGDV   64 (74)
Q Consensus        27 ~~v~~~~g~~v~L~C~A~G~P~P~I~W~~~dG~~i~~~   64 (74)
                      ..+.+..|+.+.|.|.+.|+|+|+|+|++ ||.++...
T Consensus         3 ~~~~v~~G~~v~l~c~~~G~P~P~v~W~k-~~~~i~~~   39 (86)
T cd05894           3 NTIVVVAGNKLRLDVPISGEPAPTVTWSR-GDKAFTET   39 (86)
T ss_pred             CEEEEEcCCEEEEEeeEeecCCCeEEEEE-CCEECccC
Confidence            35567788899999999999999999986 78888654


No 20 
>cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig4_L1-CAM_like:  fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM.
Probab=98.79  E-value=1.7e-08  Score=58.60  Aligned_cols=30  Identities=27%  Similarity=0.722  Sum_probs=25.9

Q ss_pred             CCCeEEEEEEcccCCCeEEEEeCCCeeecCC
Q psy11558         34 TTGAQVECTARGSPNPEIIWIRSDGTAVGDV   64 (74)
Q Consensus        34 g~~v~L~C~A~G~P~P~I~W~~~dG~~i~~~   64 (74)
                      |+.+.|.|.|.|+|.|+|+|++ ||.++...
T Consensus         1 G~~v~l~C~~~G~P~p~i~W~k-~g~~i~~~   30 (76)
T cd05867           1 GETARLDCQVEGIPTPNITWSI-NGAPIEGT   30 (76)
T ss_pred             CCeEEEEEEeeEeCCCeEEEEE-CCEECCCC
Confidence            4579999999999999999996 88887654


No 21 
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin. Ig3_Peroxidasin: the third immunoglobulin (Ig)-like domain in peroxidasin. Peroxidasin has a peroxidase domain and interacting extracellular motifs containing four Ig-like domains. It has been suggested that peroxidasin is secreted and has functions related to the stabilization of the extracellular matrix. It may play a part in various other important processes such as removal and destruction of cells which have undergone programmed cell death, and protection of the organism against non-self.
Probab=98.79  E-value=1.2e-08  Score=58.96  Aligned_cols=30  Identities=27%  Similarity=0.643  Sum_probs=25.8

Q ss_pred             CCCCeEEEEEEcccCCCeEEEEeCCCeeecC
Q psy11558         33 NTTGAQVECTARGSPNPEIIWIRSDGTAVGD   63 (74)
Q Consensus        33 ~g~~v~L~C~A~G~P~P~I~W~~~dG~~i~~   63 (74)
                      +|+.+.|+|.|.|+|.|+|+|++ ||.++..
T Consensus         1 eG~~v~l~C~~~g~P~p~i~W~k-~g~~~~~   30 (74)
T cd05745           1 EGQTVDFLCEAQGYPQPVIAWTK-GGSQLSV   30 (74)
T ss_pred             CCCeEEEEeECCEecCCEEEEEE-CCEECCC
Confidence            46789999999999999999996 7877654


No 22 
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). Ig5_NCAM-1: The fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM) and heterophilic (NCAM-non-NCAM) interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the surface of opposing cells (tr
Probab=98.76  E-value=3.1e-08  Score=59.95  Aligned_cols=43  Identities=19%  Similarity=0.380  Sum_probs=33.2

Q ss_pred             cceEEEcCCCcEEecCCCCeEEEEEEcccCCCeEEEEeCCCeeec
Q psy11558         18 GPIFIKEPPNRIDFSNTTGAQVECTARGSPNPEIIWIRSDGTAVG   62 (74)
Q Consensus        18 ~P~fv~~Pp~~v~~~~g~~v~L~C~A~G~P~P~I~W~~~dG~~i~   62 (74)
                      .|.|+..|.+. ....|+.++|.|.|.|.|.|+|+|++ +|..+.
T Consensus         2 ~p~i~~~~~~~-~~~~g~~v~l~C~~~G~P~P~v~W~~-~~~~~~   44 (97)
T cd05869           2 KPKITYVENQT-AMELEEQITLTCEASGDPIPSITWRT-STRNIS   44 (97)
T ss_pred             CceEEEccCce-EEEcCCCEEEEEEeeEeCCCEEEEEE-CCcccc
Confidence            57777775444 34456789999999999999999997 666654


No 23 
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. Ig2_FGFR: second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. FGF receptors bind FGF signaling polypeptides. FGFs participate in multiple processes such as morphogenesis, development, and angiogenesis. FGFs bind to four FGF receptor tyrosine kinases (FGFR1, -2, -3, -4). Receptor diversity is controlled by alternative splicing producing splice variants with different ligand binding characteristics and different expression patterns. FGFRs have an extracellular region comprised of three IG-like domains, a single transmembrane helix, and an intracellular tyrosine kinase domain. Ligand binding and specificity reside in the Ig-like domains 2 and 3, and the linker region that connects these two. FGFR activation and signaling depend on FGF-induced dimerization, a process involving cell surface heparin or heparin sulfate proteoglycans.
Probab=98.70  E-value=5.4e-08  Score=56.82  Aligned_cols=34  Identities=21%  Similarity=0.640  Sum_probs=28.6

Q ss_pred             EecCCCCeEEEEEEcccCCCeEEEEeCCCeeecCC
Q psy11558         30 DFSNTTGAQVECTARGSPNPEIIWIRSDGTAVGDV   64 (74)
Q Consensus        30 ~~~~g~~v~L~C~A~G~P~P~I~W~~~dG~~i~~~   64 (74)
                      .+..|..+.|.|.|.|.|.|+|+|++ ||..+...
T Consensus         5 ~v~~G~~~~L~C~~~g~P~p~i~W~k-~g~~l~~~   38 (85)
T cd05857           5 AVPAANTVKFRCPAAGNPTPTMRWLK-NGKEFKQE   38 (85)
T ss_pred             EcCCCCEEEEEEEcCCCCCCEEEEEE-CCEECCCC
Confidence            35678889999999999999999996 78777543


No 24 
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). Ig3_NCAM-1_like: domain similar to the third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-non-NCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1,and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the
Probab=98.69  E-value=4.2e-08  Score=58.69  Aligned_cols=45  Identities=20%  Similarity=0.457  Sum_probs=33.3

Q ss_pred             ceEEEcC-CCcEEecCCCCeEEEEEEcccCCCeEEEEeCCCeeecCC
Q psy11558         19 PIFIKEP-PNRIDFSNTTGAQVECTARGSPNPEIIWIRSDGTAVGDV   64 (74)
Q Consensus        19 P~fv~~P-p~~v~~~~g~~v~L~C~A~G~P~P~I~W~~~dG~~i~~~   64 (74)
                      |.+...+ +..+....|+.+.|.|.|.|.|.|+|+|.+ ||.++...
T Consensus         2 p~i~~~~~~~~~~~~~G~~v~L~C~~~g~P~p~v~W~k-~g~~~~~~   47 (95)
T cd05730           2 PTIRARQSEVNATANLGQSVTLACDADGFPEPTMTWTK-DGEPIESG   47 (95)
T ss_pred             CccccCCcccceEEeCCCCEEEEEeccEeCCCEEEEEE-CCEECcCC
Confidence            4444433 223456678889999999999999999986 78877543


No 25 
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins. Ig5_KIRREL3-like: domain similar to the fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1), Kirrel2 (Neph3), and Drosophila RST (irregular chiasm C-roughest) protein. These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development.
Probab=98.68  E-value=1.1e-07  Score=57.66  Aligned_cols=44  Identities=20%  Similarity=0.376  Sum_probs=33.2

Q ss_pred             cceEEEcCCCcEEecCCCCeEEEEEEcccCCC-eEEEEeCCCeeecCC
Q psy11558         18 GPIFIKEPPNRIDFSNTTGAQVECTARGSPNP-EIIWIRSDGTAVGDV   64 (74)
Q Consensus        18 ~P~fv~~Pp~~v~~~~g~~v~L~C~A~G~P~P-~I~W~~~dG~~i~~~   64 (74)
                      +|.+ ..+++. ....|..+.|.|.|.|+|.| +|+|.+ ||.++...
T Consensus         2 pp~i-~~~~~~-~~~~G~~v~L~C~~~g~P~P~~v~W~~-~~~~i~~~   46 (98)
T cd05758           2 PPII-TSEATQ-YAILGDKGRVECFIFSTPPPDRIVWTW-KENELESG   46 (98)
T ss_pred             CCeE-cCCCcE-EEeCCCcEEEEEEEcccCCCCEeEEEE-CCEEccCC
Confidence            4555 444444 45778889999999999999 699986 77777544


No 26 
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related). Ig4_L1-NrCAM_like: fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related). These proteins belong to the L1 subfamily of cell adhesion molecules (CAMs) and are comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. These molecules are primarily expressed in the nervous system. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth.
Probab=98.68  E-value=4.6e-08  Score=55.95  Aligned_cols=31  Identities=29%  Similarity=0.812  Sum_probs=26.2

Q ss_pred             CCCeEEEEEEcccCCCeEEEEeCCCeeecCCC
Q psy11558         34 TTGAQVECTARGSPNPEIIWIRSDGTAVGDVP   65 (74)
Q Consensus        34 g~~v~L~C~A~G~P~P~I~W~~~dG~~i~~~~   65 (74)
                      |+.++|.|.|.|+|.|+|+|++ ||.++....
T Consensus         1 G~~~~l~C~~~g~P~p~i~W~~-~g~~~~~~~   31 (76)
T cd04978           1 GETGRLDCEAEGIPQPTITWRL-NGVPIEELP   31 (76)
T ss_pred             CCeEEEEEEceeeCCCEEEEEE-CCEECCCCC
Confidence            4579999999999999999996 788776544


No 27 
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF). Ig6_hNeurofascin_like:  the sixth immunoglobulin (Ig)-like domain of human neurofascin (NF). NF belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region, and a cytoplasmic domain. NF has many alternatively spliced isoforms having different temporal expression patterns during development. NF participates in axon subcellular targeting and synapse formation, however little is known of the functions of the different isoforms.
Probab=98.68  E-value=3.6e-08  Score=57.97  Aligned_cols=25  Identities=36%  Similarity=0.872  Sum_probs=21.8

Q ss_pred             eEEEEEEcccCCCeEEEEeCCCeeec
Q psy11558         37 AQVECTARGSPNPEIIWIRSDGTAVG   62 (74)
Q Consensus        37 v~L~C~A~G~P~P~I~W~~~dG~~i~   62 (74)
                      +.|+|.|.|+|.|+|+|++ ||.++.
T Consensus         1 ~~l~C~~~G~P~P~v~W~k-~g~~~~   25 (77)
T cd05875           1 IIIECEAKGNPVPTFQWTR-NGKFFN   25 (77)
T ss_pred             CEEEEeccccCCCEEEEEE-CCEEcc
Confidence            4799999999999999997 787664


No 28 
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin. Ig8_hNephrin_like: domain similar to the eighth immunoglobulin-like domain in human nephrin. Nephrin is an integral component of the slit diaphragm, and is a central component of the glomerular ultrafilter. Nephrin plays a structural role, and has a role in signaling. Nephrin is a transmembrane protein having a short intracellular portion, and an extracellular portion comprised of eight Ig-like domains, and one fibronectin type III-like domain. The extracellular portions of nephrin, from neighboring foot processes of separate podocyte cells, may interact with each other, and in association with other components of the slit diaphragm, form a porous molecular sieve within the slit pore.  The intracellular portion of nephrin is associated with linker proteins, which connect nephrin to the actin cytoskeleton. The intracellular portion is tyrosine phosphorylated, and mediates signaling from the slit diaphragm into the p
Probab=98.68  E-value=4.4e-08  Score=61.05  Aligned_cols=46  Identities=26%  Similarity=0.507  Sum_probs=34.2

Q ss_pred             ccceEEEcCCCcEEec---CCCCeEEEEEEcccCCCeEEEEeCCCeeecC
Q psy11558         17 LGPIFIKEPPNRIDFS---NTTGAQVECTARGSPNPEIIWIRSDGTAVGD   63 (74)
Q Consensus        17 ~~P~fv~~Pp~~v~~~---~g~~v~L~C~A~G~P~P~I~W~~~dG~~i~~   63 (74)
                      .+|.|...|......+   .|..+.|.|.|.|+|.|+++|.+ ||.++..
T Consensus         3 ~~P~~~~~~~~~~~~~~~~~g~~v~L~C~a~G~P~p~i~W~k-~g~~l~~   51 (109)
T cd05773           3 FAPDLQKGPQLRKVASRGDGSSDANLVCQAQGVPRVQFRWAK-NGVPLDL   51 (109)
T ss_pred             cccccccCCceEEEEEecCCCCEEEEEEECcccCCCEEEEEE-CCEECCC
Confidence            4678776655333232   34569999999999999999996 8888753


No 29 
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. Ig1_NCAM-1: first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. NCAM-1 plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-nonNCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves the Ig1, Ig2, and Ig3 domains. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the surface of opposing cells (trans
Probab=98.68  E-value=8.8e-08  Score=58.84  Aligned_cols=37  Identities=16%  Similarity=0.380  Sum_probs=30.1

Q ss_pred             CcEEecCCCCeEEEEEEcccCC-CeEEEEeCCCeeecC
Q psy11558         27 NRIDFSNTTGAQVECTARGSPN-PEIIWIRSDGTAVGD   63 (74)
Q Consensus        27 ~~v~~~~g~~v~L~C~A~G~P~-P~I~W~~~dG~~i~~   63 (74)
                      ++..+..|+.++|+|.|.|.|. |+|+|+++||..+..
T Consensus         8 ~~~~v~~G~~v~l~C~v~G~P~~p~i~W~~~~g~~l~~   45 (96)
T cd05865           8 SQGEISVGESKFFLCQVAGEAKDKDISWFSPNGEKLTP   45 (96)
T ss_pred             CccEECCCCeEEEEEEEeCCCCCCEEEEECCCCcCccc
Confidence            4445778889999999999995 799999878876543


No 30 
>cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule). Ig6_NrCAM: sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule). NrCAM belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region, and an intracellular domain. NrCAM is primarily expressed in the nervous system.
Probab=98.68  E-value=3.5e-08  Score=58.02  Aligned_cols=25  Identities=36%  Similarity=0.912  Sum_probs=21.9

Q ss_pred             eEEEEEEcccCCCeEEEEeCCCeeec
Q psy11558         37 AQVECTARGSPNPEIIWIRSDGTAVG   62 (74)
Q Consensus        37 v~L~C~A~G~P~P~I~W~~~dG~~i~   62 (74)
                      +.|.|.|.|+|.|+|+|++ ||.++.
T Consensus         1 ~~l~C~a~G~P~P~i~W~k-~g~~l~   25 (77)
T cd05874           1 IVIQCEAKGKPPPSFSWTR-NGTHFD   25 (77)
T ss_pred             CEEEeeCcccCCCeEEEEE-CCeECC
Confidence            4799999999999999997 787764


No 31 
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins. Ig4_Neogenin: fourth immunoglobulin (Ig)-like domain in neogenin and related proteins. Neogenin  is a cell surface protein which is expressed in the developing nervous system of vertebrate embryos in the growing nerve cells. It is also expressed in other embryonic tissues, and may play a general role in developmental processes such as cell migration, cell-cell recognition, and tissue growth regulation. Included in this group is the tumor suppressor protein DCC, which is deleted in colorectal carcinoma . DCC and neogenin each have four Ig-like domains followed by six fibronectin type III domains, a transmembrane domain, and an intracellular domain.
Probab=98.67  E-value=6.1e-08  Score=55.74  Aligned_cols=27  Identities=30%  Similarity=0.777  Sum_probs=22.7

Q ss_pred             CeEEEEEEcccCCCeEEEEeCCCeeecC
Q psy11558         36 GAQVECTARGSPNPEIIWIRSDGTAVGD   63 (74)
Q Consensus        36 ~v~L~C~A~G~P~P~I~W~~~dG~~i~~   63 (74)
                      +++|.|.|.|+|.|+|+|.+ ||..+..
T Consensus         1 ~v~l~C~~~G~P~p~v~W~k-~g~~~~~   27 (71)
T cd05723           1 DVIFECEVTGKPTPTVKWVK-NGDMVIP   27 (71)
T ss_pred             CEEEEEEEEEeCCCEEEEEE-CCeECCC
Confidence            37999999999999999997 6666544


No 32 
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin. Ig_Myotilin_C: C-terminal immunoglobulin (Ig)-like domain of myotilin. Mytolin belongs to the palladin-myotilin-myopalladin family. Proteins belonging to the latter family contain multiple Ig-like domains and function as scaffolds, modulating actin cytoskeleton. Myotilin is most abundant in skeletal and cardiac muscle, and is involved in maintaining sarcomere integrity. It binds to alpha-actinin, filamin and actin. Mutations in myotilin lead to muscle disorders.
Probab=98.65  E-value=7e-08  Score=56.92  Aligned_cols=26  Identities=31%  Similarity=0.704  Sum_probs=22.9

Q ss_pred             eEEEEEEcccCCCeEEEEeCCCeeecC
Q psy11558         37 AQVECTARGSPNPEIIWIRSDGTAVGD   63 (74)
Q Consensus        37 v~L~C~A~G~P~P~I~W~~~dG~~i~~   63 (74)
                      +.|+|.|.|+|+|+|+|++ ||.+|..
T Consensus         1 v~l~C~v~G~P~P~i~W~k-~~~~i~~   26 (75)
T cd05892           1 VKLECQISAIPPPKIFWKR-NNEMVQY   26 (75)
T ss_pred             CEEEEEEEecCCCeEEEEE-CCEECcC
Confidence            5799999999999999997 7888763


No 33 
>cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins. Ig6_L1-CAM_like: domain similar to the sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM).  L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains NrCAM [Ng(neuronglia)CAM-related cell adhesion molecule], which is primarily expressed in the nervous system, and human neurofascin.
Probab=98.65  E-value=3.9e-08  Score=57.46  Aligned_cols=26  Identities=35%  Similarity=0.868  Sum_probs=22.6

Q ss_pred             eEEEEEEcccCCCeEEEEeCCCeeecC
Q psy11558         37 AQVECTARGSPNPEIIWIRSDGTAVGD   63 (74)
Q Consensus        37 v~L~C~A~G~P~P~I~W~~~dG~~i~~   63 (74)
                      ++|.|.|.|+|.|+|+|.+ ||.++..
T Consensus         1 i~l~C~~~G~P~P~v~W~k-~g~~l~~   26 (77)
T cd05733           1 IVIKCEAKGNPPPTFSWTR-NGTHFDP   26 (77)
T ss_pred             CEEEeeCcccCCCeEEEEE-CCeECCC
Confidence            4799999999999999996 8887754


No 34 
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2). Ig_M-protein_C: the C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2). M-protein is a structural protein localized to the M-band, a transverse structure in the center of the sarcomere, and is a candidate for M-band bridges. M-protein is modular consisting mainly of repetitive IG-like and fibronectin type III (FnIII) domains, and has a muscle-type specific expression pattern. M-protein is present in fast fibers.
Probab=98.65  E-value=1.4e-07  Score=56.99  Aligned_cols=40  Identities=23%  Similarity=0.596  Sum_probs=32.6

Q ss_pred             CCCcEEecCCCCeEEEEEEcccCCCeEEEEeCCCeeecCCC
Q psy11558         25 PPNRIDFSNTTGAQVECTARGSPNPEIIWIRSDGTAVGDVP   65 (74)
Q Consensus        25 Pp~~v~~~~g~~v~L~C~A~G~P~P~I~W~~~dG~~i~~~~   65 (74)
                      +|..+...+|+.+.|.|.+.|+|.|.+.|++ +|..+....
T Consensus         7 ~p~~v~v~eG~~v~L~C~v~g~P~p~i~W~k-~~~~~~~~~   46 (92)
T cd05891           7 LPDVVTIMEGKTLNLTCTVFGNPDPEVIWFK-NDQDIELSE   46 (92)
T ss_pred             CCCcEEEcCCCEEEEEEEEEEeCCCeEEEEE-CCEECCCCC
Confidence            4567778899999999999999999999997 566555433


No 35 
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig2_Robo: domain similar to the second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antago
Probab=98.63  E-value=1.5e-07  Score=54.76  Aligned_cols=37  Identities=30%  Similarity=0.677  Sum_probs=30.7

Q ss_pred             CCcEEecCCCCeEEEEEE-cccCCCeEEEEeCCCeeecC
Q psy11558         26 PNRIDFSNTTGAQVECTA-RGSPNPEIIWIRSDGTAVGD   63 (74)
Q Consensus        26 p~~v~~~~g~~v~L~C~A-~G~P~P~I~W~~~dG~~i~~   63 (74)
                      |..+.+..|+.+.|.|.+ .|.|.|+|+|++ ||.++..
T Consensus         3 p~~~~~~~G~~v~l~C~~~~g~p~p~i~W~k-~g~~~~~   40 (86)
T cd05724           3 PSDTQVAVGEMAVLECSPPRGHPEPTVSWRK-DGQPLNL   40 (86)
T ss_pred             CccEEEeCCCCEEEEEECCCCCCCCEEEEEE-CCEECCC
Confidence            455567788899999999 899999999997 7877654


No 36 
>cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of  the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. Ig2_RPTP_IIa_LAR_like: domain similar to the second immunoglobulin (Ig)-like domain found in the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. LAR belongs to the RPTP type IIa subfamily. Members of this subfamily are cell adhesion molecule-like proteins involved in central nervous system (CNS) development. They have large extracellular portions, comprised of multiple Ig-like domains and two to nine fibronectin type III (FNIII) domains, and a cytoplasmic portion having two tandem phosphatase domains.
Probab=98.62  E-value=7.4e-08  Score=55.77  Aligned_cols=26  Identities=42%  Similarity=0.862  Sum_probs=22.7

Q ss_pred             eEEEEEEcccCCCeEEEEeCCCeeecC
Q psy11558         37 AQVECTARGSPNPEIIWIRSDGTAVGD   63 (74)
Q Consensus        37 v~L~C~A~G~P~P~I~W~~~dG~~i~~   63 (74)
                      ++|+|.|.|+|.|+|+|++ ||.++..
T Consensus         1 a~l~C~~~G~P~p~v~W~k-~~~~~~~   26 (74)
T cd05738           1 ATMLCAASGNPDPEITWFK-DFLPVDT   26 (74)
T ss_pred             CEEEEEEeEecCCEEEEEE-CCEECcc
Confidence            5799999999999999997 7777754


No 37 
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins. Ig4_SCFR_like; fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR). In addition to SCFR this group also includes the fourth Ig domain of platelet-derived growth factor receptors (PDGFR), alpha and beta, the fourth Ig domain of macrophage colony stimulating factor (M-CSF), and the Ig domain of the receptor tyrosine kinase KIT. SCFR and the PDGFR alpha and beta have similar organization: an extracellular component having five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. SCFR and its ligand SCF are critical for normal hematopoiesis, mast cell development, melanocytes and gametogenesis. SCF binds to the second and third Ig-like domains of SCFR, this fourth Ig-like domain participates in SCFR dimerization, which follows ligand binding. Deletion of this fourth SCFR_Ig-like domain abolishes
Probab=98.62  E-value=8.1e-08  Score=59.64  Aligned_cols=36  Identities=17%  Similarity=0.314  Sum_probs=31.2

Q ss_pred             CcEEecCCCCeEEEEEEcc-cCCCeEEEEeCCCeeecC
Q psy11558         27 NRIDFSNTTGAQVECTARG-SPNPEIIWIRSDGTAVGD   63 (74)
Q Consensus        27 ~~v~~~~g~~v~L~C~A~G-~P~P~I~W~~~dG~~i~~   63 (74)
                      +.+....|+++.|.|.|.| .|+|+|+|++ ||.+|..
T Consensus        11 ~~~~v~~G~~v~L~c~v~g~~P~p~v~W~K-dg~~i~~   47 (101)
T cd04975          11 TTIFVNLGENLNLVVEVEAYPPPPHINWTY-DNRTLTN   47 (101)
T ss_pred             ceEEEECCCCEEEEEEEEecCCCCccEEEe-CCeeCCC
Confidence            4556678889999999999 9999999996 8998864


No 38 
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin. Ig_Palladin_C: C-terminal immunoglobulin (Ig)-like domain of palladin. Palladin belongs to the palladin-myotilin-myopalladin family. Proteins belonging to this family contain multiple Ig-like domains and function as scaffolds, modulating actin cytoskeleton. Palladin binds to alpha-actinin ezrin, vasodilator-stimulated phosphoprotein VASP, SPIN90 (DIP, mDia interacting protein), and Src. Palladin also binds F-actin directly, via its Ig3 domain. Palladin is expressed as several alternatively spliced isoforms, having various combinations of Ig-like domains, in a cell-type-specific manner. It has been suggested that palladin's different Ig-like domains may be specialized for distinct functions.
Probab=98.60  E-value=1e-07  Score=56.05  Aligned_cols=26  Identities=27%  Similarity=0.857  Sum_probs=22.1

Q ss_pred             eEEEEEEcccCCCeEEEEeCCCeeecC
Q psy11558         37 AQVECTARGSPNPEIIWIRSDGTAVGD   63 (74)
Q Consensus        37 v~L~C~A~G~P~P~I~W~~~dG~~i~~   63 (74)
                      +.|+|.|.|.|.|+|+|++ ||.++..
T Consensus         1 v~l~C~v~G~P~P~v~W~k-~~~~l~~   26 (75)
T cd05893           1 VRLECRVSGVPHPQIFWKK-ENESLTH   26 (75)
T ss_pred             CEEEEEEeEecCCEEEEEE-CCEECCC
Confidence            5799999999999999997 6666643


No 39 
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig5_Contactin-1: fifth Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=98.60  E-value=8.9e-08  Score=55.94  Aligned_cols=28  Identities=18%  Similarity=0.544  Sum_probs=23.9

Q ss_pred             CCCeEEEEEEcccCCCeEEEEeCCCeeec
Q psy11558         34 TTGAQVECTARGSPNPEIIWIRSDGTAVG   62 (74)
Q Consensus        34 g~~v~L~C~A~G~P~P~I~W~~~dG~~i~   62 (74)
                      |+.+.|+|.|.|.|.|+|+|++ ||.++.
T Consensus         1 G~~~~l~C~~~g~P~p~v~W~k-~~~~l~   28 (73)
T cd05852           1 GGRVIIECKPKAAPKPKFSWSK-GTELLV   28 (73)
T ss_pred             CCeEEEEEecceeCCCEEEEEe-CCEecc
Confidence            4569999999999999999996 677654


No 40 
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4. Ig2_PTK7: domain similar to the second immunoglobulin (Ig)-like domain in protein tyrosine kinase (PTK) 7, also known as CCK4. PTK7 is a subfamily of the receptor protein tyrosine kinase family, and is referred to as an RPTK-like molecule. RPTKs transduce extracellular signals across the cell membrane, and play important roles in regulating cell proliferation, migration, and differentiation. PTK7 is organized as an extracellular portion having seven Ig-like domains, a single transmembrane region, and a cytoplasmic tyrosine kinase-like domain. PTK7 is considered a pseudokinase as it has several unusual residues in some of the highly conserved tyrosine kinase (TK) motifs; it is predicted to lack TK activity. PTK7 may function as a cell-adhesion molecule. PTK7 mRNA is expressed at high levels in placenta, melanocytes, liver, lung, pancreas, and kidney. PTK7 is overexpressed in s
Probab=98.59  E-value=9.9e-08  Score=55.72  Aligned_cols=28  Identities=36%  Similarity=0.821  Sum_probs=23.8

Q ss_pred             eEEEEEEcccCCCeEEEEeCCCeeecCCC
Q psy11558         37 AQVECTARGSPNPEIIWIRSDGTAVGDVP   65 (74)
Q Consensus        37 v~L~C~A~G~P~P~I~W~~~dG~~i~~~~   65 (74)
                      ++|.|.|.|+|.|+|+|++ ||.++....
T Consensus         1 v~L~C~~~g~P~p~v~W~k-~g~~l~~~~   28 (77)
T cd05760           1 VTLRCHIDGHPRPTYQWFR-DGTPLSDGQ   28 (77)
T ss_pred             CEEEEEeeecCCCcEEEEE-CCEECCCCC
Confidence            5899999999999999997 788875543


No 41 
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins. Ig5_NCAM-1 like: domain similar to the fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic  (NCAM-NCAM), and heterophilic (NCAM-non-NCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM mole
Probab=98.58  E-value=1.9e-07  Score=55.64  Aligned_cols=42  Identities=26%  Similarity=0.423  Sum_probs=31.6

Q ss_pred             cceEEEcCCCcEEecCCCCeEEEEEEcccCCCeEEEEeCCCeeec
Q psy11558         18 GPIFIKEPPNRIDFSNTTGAQVECTARGSPNPEIIWIRSDGTAVG   62 (74)
Q Consensus        18 ~P~fv~~Pp~~v~~~~g~~v~L~C~A~G~P~P~I~W~~~dG~~i~   62 (74)
                      .|.+. .+++ ....+|+.+.|.|.|.|.|.|+|+|++ +|..+.
T Consensus         2 ~P~i~-~~~~-~~~~~g~~v~l~C~~~g~p~p~v~W~~-~~~~~~   43 (96)
T cd05732           2 QPKIT-YLEN-QTAVELEQITLTCEAEGDPIPEITWRR-ATRNFS   43 (96)
T ss_pred             Cccce-ecCc-eeEecCCcEEEEEEEeEcCCCcEEEEE-CCcccC
Confidence            46665 3333 456678889999999999999999997 555443


No 42 
>cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily. Ig_2: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=98.58  E-value=1.5e-07  Score=53.84  Aligned_cols=30  Identities=40%  Similarity=0.894  Sum_probs=26.2

Q ss_pred             CCCeEEEEEEcccCCCeEEEEeCCCeeecC
Q psy11558         34 TTGAQVECTARGSPNPEIIWIRSDGTAVGD   63 (74)
Q Consensus        34 g~~v~L~C~A~G~P~P~I~W~~~dG~~i~~   63 (74)
                      |+.+.|.|.+.|.|.|+|+|+++||..+..
T Consensus         1 G~~~~l~C~~~g~P~p~v~W~~~~~~~~~~   30 (74)
T cd05764           1 GQRATLRCKARGDPEPAIHWISPDGKLISN   30 (74)
T ss_pred             CCeEEEEEEccCcCCCEEEEEeCCCEEecC
Confidence            456999999999999999999888887754


No 43 
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2. Ig_Perlecan_D2_like: the immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2. Perlecan consists of five domains. Domain I has three putative heparan sulfate attachment sites; domain II has four LDL receptor-like repeats, and one Ig-like repeat; domain III resembles the short arm of laminin chains; domain IV has multiple Ig-like repeats (21 repeats in human perlecan); and domain V resembles the globular G domain of the laminin A chain and internal repeats of EGF. Perlecan may participate in a variety of biological functions including cell binding, LDL-metabolism, basement membrane assembly and selective permeability, calcium binding, and growth- and neurite-promoting activities.
Probab=98.55  E-value=1.8e-07  Score=54.49  Aligned_cols=29  Identities=31%  Similarity=0.523  Sum_probs=23.9

Q ss_pred             CCCeEEEEEEcccCCCeEEEEeCCCeeecC
Q psy11558         34 TTGAQVECTARGSPNPEIIWIRSDGTAVGD   63 (74)
Q Consensus        34 g~~v~L~C~A~G~P~P~I~W~~~dG~~i~~   63 (74)
                      |+.++|.|.|.|.|.|+|+|++ |+..+..
T Consensus         1 G~~v~l~C~~~g~P~p~v~W~~-~~~~~~~   29 (78)
T cd05743           1 GETVEFTCVATGVPTPIINWRL-NWGHVPD   29 (78)
T ss_pred             CCEEEEEEEEEEecCCEEEEEE-CCeECCC
Confidence            4579999999999999999986 5655543


No 44 
>cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin. Ig_Myotilin_like_C: immunoglobulin (Ig)-like domain in myotilin, palladin, and myopalladin.  Myotilin, palladin, and myopalladin function as scaffolds that regulate actin organization. Myotilin and myopalladin are most abundant in skeletal and cardiac muscle; palladin is ubiquitously expressed in the organs of developing vertebrates and  plays a key role in cellular morphogenesis. The three family members each interact with specific molecular partners: all three bind to alpha-actinin; in addition, palladin also binds to vasodilator-stimulated phosphoprotein (VASP) and ezrin, myotilin binds to filamin and actin, and myopalladin also binds to nebulin and cardiac ankyrin repeat protein (CARP).
Probab=98.54  E-value=2e-07  Score=54.34  Aligned_cols=26  Identities=23%  Similarity=0.672  Sum_probs=22.8

Q ss_pred             eEEEEEEcccCCCeEEEEeCCCeeecC
Q psy11558         37 AQVECTARGSPNPEIIWIRSDGTAVGD   63 (74)
Q Consensus        37 v~L~C~A~G~P~P~I~W~~~dG~~i~~   63 (74)
                      ++|+|.+.|.|+|+|+|++ ||..+..
T Consensus         1 v~L~C~v~G~P~P~v~W~k-~~~~i~~   26 (75)
T cd05744           1 VRLECRVSAIPPPQIFWKK-NNEMLTY   26 (75)
T ss_pred             CEEEEEEeecCCCeEEEEE-CCEECCC
Confidence            5799999999999999997 7887764


No 45 
>cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Ig3_FGFR: third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for FGFs.
Probab=98.54  E-value=1.2e-07  Score=56.86  Aligned_cols=23  Identities=17%  Similarity=0.641  Sum_probs=20.9

Q ss_pred             CCCeEEEEEEcccCCCeEEEEeC
Q psy11558         34 TTGAQVECTARGSPNPEIIWIRS   56 (74)
Q Consensus        34 g~~v~L~C~A~G~P~P~I~W~~~   56 (74)
                      |+.++|+|.|.|+|.|+|+|++.
T Consensus         1 G~~v~l~C~v~g~P~P~i~W~k~   23 (90)
T cd04974           1 GSDVEFHCKVYSDAQPHIQWLKH   23 (90)
T ss_pred             CCcEEEEEEEeCCCCCeEEEEEe
Confidence            45799999999999999999985


No 46 
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2. Ig1_NCAM-2:  first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 (OCAM/mamFas II, RNCAM). NCAM-2  is organized similarly to NCAM , including five N-terminal Ig-like domains and two fibronectin type III domains. NCAM-2 is differentially expressed in the developing and mature olfactory epithelium (OE), and may function like NCAM, as an adhesion molecule.
Probab=98.53  E-value=3.3e-07  Score=56.03  Aligned_cols=38  Identities=24%  Similarity=0.488  Sum_probs=31.9

Q ss_pred             CCcEEecCCCCeEEEEEEcccCCCeEEEEeCCCeeecCC
Q psy11558         26 PNRIDFSNTTGAQVECTARGSPNPEIIWIRSDGTAVGDV   64 (74)
Q Consensus        26 p~~v~~~~g~~v~L~C~A~G~P~P~I~W~~~dG~~i~~~   64 (74)
                      +.++....|+.+.|+|.|.|.|. .|+|+++||.++...
T Consensus         7 ~~~~~v~~G~~v~l~C~~~G~P~-~v~W~k~~g~~~~~~   44 (92)
T cd05866           7 LSKVELSVGESKFFTCTAIGEPE-SIDWYNPQGEKIVSS   44 (92)
T ss_pred             ecceEEcCCCeEEEEEEEEEeCC-eEEEEeCCCeEecCC
Confidence            45556788989999999999998 999998888887544


No 47 
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin. Ig4_Peroxidasin: the fourth immunoglobulin (Ig)-like domain in peroxidasin. Peroxidasin has a peroxidase domain and interacting extracellular motifs containing four Ig-like domains. It has been suggested that peroxidasin is secreted, and has functions related to the stabilization of the extracellular matrix. It may play a part in various other important processes such as removal and destruction of cells, which have undergone programmed cell death, and protection of the organism against non-self.
Probab=98.53  E-value=1.1e-07  Score=54.25  Aligned_cols=27  Identities=41%  Similarity=0.962  Sum_probs=23.1

Q ss_pred             eEEEEEEcccCCCeEEEEeCCCeeecCC
Q psy11558         37 AQVECTARGSPNPEIIWIRSDGTAVGDV   64 (74)
Q Consensus        37 v~L~C~A~G~P~P~I~W~~~dG~~i~~~   64 (74)
                      |.|.|.|.|.|.|+|+|++ ||.++...
T Consensus         1 v~L~C~~~g~P~p~i~W~k-~g~~~~~~   27 (69)
T cd05746           1 VQIPCSAQGDPEPTITWNK-DGVQVTES   27 (69)
T ss_pred             CEeEecceEeCCCEEEEEE-CCEECCCC
Confidence            5799999999999999996 78877543


No 48 
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3). Ig2_VEGFR-3: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-3 (Flt-4) binds two members of the VEGF family (VEGF-C and -D) and is involved in tumor angiogenesis and growth.
Probab=98.51  E-value=2.2e-07  Score=54.07  Aligned_cols=26  Identities=23%  Similarity=0.617  Sum_probs=23.1

Q ss_pred             eEEEEEEcccCCCeEEEEeCCCeeecC
Q psy11558         37 AQVECTARGSPNPEIIWIRSDGTAVGD   63 (74)
Q Consensus        37 v~L~C~A~G~P~P~I~W~~~dG~~i~~   63 (74)
                      +.|.|.+.|.|+|+++|++ ||.+|..
T Consensus         1 ~~l~c~v~g~P~P~v~W~k-dg~~l~~   26 (67)
T cd05863           1 VKLPVKVAAYPPPEFQWYK-DGKLISG   26 (67)
T ss_pred             CEEEEEEEEeCCCEEEEEE-CCEECcc
Confidence            4799999999999999997 8988863


No 49 
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin. Ig5_Contactin_like: Fifth Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=98.51  E-value=2.4e-07  Score=53.16  Aligned_cols=30  Identities=20%  Similarity=0.576  Sum_probs=24.8

Q ss_pred             CCCeEEEEEEcccCCCeEEEEeCCCeeecCC
Q psy11558         34 TTGAQVECTARGSPNPEIIWIRSDGTAVGDV   64 (74)
Q Consensus        34 g~~v~L~C~A~G~P~P~I~W~~~dG~~i~~~   64 (74)
                      |+.+.|.|.+.|+|.|+++|.+ +|..+...
T Consensus         1 G~~v~L~C~~~g~P~p~v~W~k-~~~~~~~~   30 (73)
T cd04969           1 GGDVIIECKPKAAPKPTISWSK-GTELLTNS   30 (73)
T ss_pred             CCeEEEEEeeeEcCCCEEEEEE-CCEEcccC
Confidence            4569999999999999999997 67666443


No 50 
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha. IG4_PDGFR-alpha: The fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha. PDGF is a potent mitogen for connective tissue cells. PDGF-stimulated processes are mediated by three different PDGFs (PDGF-A,-B, and C). PDGFR alpha binds to all three PDGFs, whereas the PDGFR beta (not included in this group) binds only to PDGF-B. PDGF alpha is organized as an extracellular component having five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. In mice, PDGFR alpha and PDGFR beta are essential for normal development.
Probab=98.50  E-value=2.5e-07  Score=57.25  Aligned_cols=35  Identities=14%  Similarity=0.228  Sum_probs=29.2

Q ss_pred             EEecCCCCeEEEEEEcccCCCeEEEEeCCCeeecCC
Q psy11558         29 IDFSNTTGAQVECTARGSPNPEIIWIRSDGTAVGDV   64 (74)
Q Consensus        29 v~~~~g~~v~L~C~A~G~P~P~I~W~~~dG~~i~~~   64 (74)
                      .....+..+.|.|.+.|.|+|+|+|++ ||.+|...
T Consensus        13 ~~~~~~~~~~l~~~v~g~P~P~v~W~k-dg~~l~~~   47 (101)
T cd05859          13 EFANLHEVKEFVVEVEAYPPPQIRWLK-DNRTLIEN   47 (101)
T ss_pred             EEEecCCcEEEEEEEEEeCCCceEEEE-CCEECcCC
Confidence            345567789999999999999999996 89887643


No 51 
>KOG3513|consensus
Probab=98.49  E-value=2e-07  Score=76.99  Aligned_cols=49  Identities=22%  Similarity=0.643  Sum_probs=41.3

Q ss_pred             CccceEEEcCCCcEEecCCCCeEEEEEEcccCCCeEEEEeCCCeeecCCCC
Q psy11558         16 TLGPIFIKEPPNRIDFSNTTGAQVECTARGSPNPEIIWIRSDGTAVGDVPG   66 (74)
Q Consensus        16 ~~~P~fv~~Pp~~v~~~~g~~v~L~C~A~G~P~P~I~W~~~dG~~i~~~~~   66 (74)
                      .++|.|++. +++..+..|+.+++.|.|.|.|.|+|+|.+ ||.++.....
T Consensus       329 ~a~P~w~~~-~~d~~~~~gs~v~~eC~a~g~P~p~v~Wlk-Ng~pl~~~~r  377 (1051)
T KOG3513|consen  329 YAPPYWLQK-PQDTEADTGSNVTLECKASGKPNPTVKWLK-NGEPLEPAER  377 (1051)
T ss_pred             ecCchhhcc-cceeEecCCCCeEEEEEecCCCCCceEEee-CCeecCccCC
Confidence            468999998 466668888899999999999999999995 9999874443


No 52 
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1). Ig2_FGFRL1-like: second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1). FGFRL1 is comprised of a signal peptide, three extracellular Ig-like modules, a transmembrane segment, and a short intracellular domain. FGFRL1 is expressed preferentially in skeletal tissues. Similar to FGF receptors, the expressed protein interacts specifically with heparin and with FGF2.  FGFRL1 does not have a protein tyrosine kinase domain at its C terminus; neither does its cytoplasmic domain appear to interact with a signaling partner. It has been suggested that FGFRL1 may not have any direct signaling function, but instead acts as a decoy receptor trapping FGFs and preventing them from binding other receptors.
Probab=98.49  E-value=2.8e-07  Score=52.85  Aligned_cols=32  Identities=25%  Similarity=0.717  Sum_probs=26.6

Q ss_pred             EecCCCCeEEEEEEcccCCCeEEEEeCCCeeec
Q psy11558         30 DFSNTTGAQVECTARGSPNPEIIWIRSDGTAVG   62 (74)
Q Consensus        30 ~~~~g~~v~L~C~A~G~P~P~I~W~~~dG~~i~   62 (74)
                      ....|+.+.|.|.+.|.|.|+|+|++ ||..+.
T Consensus         5 ~~~~G~~v~L~C~~~g~p~p~i~W~k-~~~~~~   36 (82)
T cd05856           5 ARPVGSSVRLKCVASGNPRPDITWLK-DNKPLT   36 (82)
T ss_pred             eccCCCeEEEEEEeeEeCCCcEEEEE-CCcCCc
Confidence            44567789999999999999999997 666553


No 53 
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily. Ig_1: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=98.48  E-value=1.9e-07  Score=53.71  Aligned_cols=22  Identities=45%  Similarity=1.102  Sum_probs=19.4

Q ss_pred             eEEEEEEcccCCCeEEEEeCCC
Q psy11558         37 AQVECTARGSPNPEIIWIRSDG   58 (74)
Q Consensus        37 v~L~C~A~G~P~P~I~W~~~dG   58 (74)
                      ++|.|.|.|.|.|+|+|+++++
T Consensus         1 a~l~C~~~G~P~P~v~W~k~~~   22 (75)
T cd05763           1 ARLECAATGHPTPQIAWQKDGG   22 (75)
T ss_pred             CEeEeecccccCCEEEEEeCCC
Confidence            5799999999999999998544


No 54 
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins. Ig_Titin_like: immunoglobulin (Ig)-like domain found in titin-like proteins. Titin (also called connectin) is a fibrous sarcomeric protein specifically found in vertebrate striated muscle. Titin is gigantic, depending on isoform composition it ranges from 2970 to 3700 kDa, and is of a length that spans half a sarcomere. Titin largely consists of multiple repeats of Ig-like and fibronectin type 3 (FN-III)-like domains. Titin connects the ends of myosin thick filaments to Z disks and extends along the thick filament to the H zone.  It appears to function similarly to an elastic band, keeping the myosin filaments centered in the sarcomere during muscle contraction or stretching. Within the sarcomere, titin is also attached to or is associated with myosin binding protein C (MyBP-C). MyBP-C appears to contribute to the generation of passive tension by titin, and similar to titin has repeated Ig-like and FN-
Probab=98.45  E-value=4.9e-07  Score=51.80  Aligned_cols=27  Identities=26%  Similarity=0.656  Sum_probs=23.0

Q ss_pred             eEEEEEEcccCCCeEEEEeCCCeeecCC
Q psy11558         37 AQVECTARGSPNPEIIWIRSDGTAVGDV   64 (74)
Q Consensus        37 v~L~C~A~G~P~P~I~W~~~dG~~i~~~   64 (74)
                      +.|+|.|.|.|.|+|+|++ ||..+...
T Consensus         2 ~~l~c~~~G~P~p~v~W~k-~g~~l~~~   28 (74)
T cd05748           2 VRLEVPISGRPTPTVTWSK-DGKPLKLS   28 (74)
T ss_pred             EEEEeeEeeeCCCeEEEEE-CCEEcCCC
Confidence            7899999999999999996 77776443


No 55 
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins. Ig1_NCAM-1 like: first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. NCAM-1 plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-nonNCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves the Ig1, Ig2, and Ig3 domains. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the s
Probab=98.44  E-value=9.5e-07  Score=53.25  Aligned_cols=39  Identities=21%  Similarity=0.414  Sum_probs=31.3

Q ss_pred             EcCCCcEEecCCCCeEEEEEEcccCCCeEEEEeCCCeeecC
Q psy11558         23 KEPPNRIDFSNTTGAQVECTARGSPNPEIIWIRSDGTAVGD   63 (74)
Q Consensus        23 ~~Pp~~v~~~~g~~v~L~C~A~G~P~P~I~W~~~dG~~i~~   63 (74)
                      ..|+ .+....|+.+.|.|.|.|.| |.|+|++.||..+..
T Consensus         5 v~p~-~~~v~~G~~~~l~C~~~G~p-~~i~W~~~~~~~~~~   43 (92)
T cd04977           5 IVPS-QGEISVGESKFFLCQVIGEP-KDISWFSPNGEKLVT   43 (92)
T ss_pred             EecC-cEEECCCCeEEEEEEeEeeC-CeEEEECCCCCEecc
Confidence            4444 45678888999999999998 599999878877655


No 56 
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM). Ig8_DSCAM:  the eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM). DSCAM is a cell adhesion molecule expressed largely in the developing nervous system. The gene encoding DSCAM is located at human chromosome 21q22, the locus associated with the mental retardation phenotype of Down Syndrome. DSCAM is predicted to be the largest member of the IG superfamily. It has been demonstrated that DSCAM can mediate cation-independent homophilic intercellular adhesion.
Probab=98.44  E-value=6.5e-07  Score=53.67  Aligned_cols=30  Identities=17%  Similarity=0.396  Sum_probs=25.4

Q ss_pred             CCCeEEEEEEcccCCCeEEEEeCCCeeecCC
Q psy11558         34 TTGAQVECTARGSPNPEIIWIRSDGTAVGDV   64 (74)
Q Consensus        34 g~~v~L~C~A~G~P~P~I~W~~~dG~~i~~~   64 (74)
                      |+.++|.|.|.|.|+|.|+|.+ ||..+...
T Consensus         1 g~~~~l~C~~~g~p~~~i~W~k-~~~~i~~~   30 (88)
T cd05735           1 GQKKEMSCTAHGEKPIIVRWEK-EDRIINPE   30 (88)
T ss_pred             CCeEEEEEEEECCCCCEEEEee-CCEECCCC
Confidence            5679999999999999999986 78777543


No 57 
>cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2). Ig2_VEGF-2: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-2 (KDR/Flk-1) is a major mediator of the mitogenic, angiogenic and microvascular permeability-enhancing effects of VEGF-A; VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGF-A also interacts with VEGFR-1, which it binds more strongly than VEGFR-2.  VEGFR-2 and -1 may mediate a chemotactic and a survival signal in hematopoietic stem cells or leukemia cells.
Probab=98.42  E-value=2.8e-07  Score=53.75  Aligned_cols=26  Identities=23%  Similarity=0.558  Sum_probs=22.9

Q ss_pred             eEEEEEEcccCCCeEEEEeCCCeeecC
Q psy11558         37 AQVECTARGSPNPEIIWIRSDGTAVGD   63 (74)
Q Consensus        37 v~L~C~A~G~P~P~I~W~~~dG~~i~~   63 (74)
                      +.|.|.|.|.|.|+|+|++ ||.++..
T Consensus         1 ~~~~c~v~G~P~P~v~W~k-~g~~l~~   26 (70)
T cd05864           1 VKIPVKYYGYPPPEVKWYK-NGQLIVL   26 (70)
T ss_pred             CEEEeEEEEeCCCEEEEEE-CCEECCC
Confidence            4799999999999999997 8888754


No 58 
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs) and similar proteins. Ig1_FcgammaR_like: domain similar to the first immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs). Interactions between IgG and FcgammaR are important to the initiation of cellular and humoral response. IgG binding to FcgammaR leads to a cascade of signals and ultimately to functions such as antibody-dependent-cellular-cytotoxicity (ADCC), endocytosis, phagocytosis, release of inflammatory mediators, etc. FcgammaR has two Ig-like domains. This group also contains FcepsilonRI, which binds IgE with high affinity.
Probab=98.42  E-value=9.2e-07  Score=52.44  Aligned_cols=42  Identities=17%  Similarity=0.415  Sum_probs=33.1

Q ss_pred             ceEEEcCCCcEEecCCCCeEEEEEEcccCC-CeEEEEeCCCeeec
Q psy11558         19 PIFIKEPPNRIDFSNTTGAQVECTARGSPN-PEIIWIRSDGTAVG   62 (74)
Q Consensus        19 P~fv~~Pp~~v~~~~g~~v~L~C~A~G~P~-P~I~W~~~dG~~i~   62 (74)
                      |+....|+.. .+.+|++++|.|.|.|+|. +.++|++ ||..+.
T Consensus         1 ~vv~~~P~~~-~v~~G~~V~L~C~~~~~p~~~~~~W~k-ng~~l~   43 (78)
T cd05752           1 AVVSLDPPWT-TIFQGEKVTLTCNGFNSPEQNSTQWYH-NGKLLE   43 (78)
T ss_pred             CeEEeCCCCe-EeeCCCCEEEEEeCCCCCCCccEEEEE-CCEEee
Confidence            5667776655 4567888999999999996 4799996 788873


No 59 
>cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2). Ig3_FGFR-2-like; domain similar to the third immunoglobulin (Ig)-like domain of human fibroblast growth factor receptor 2 (FGFR2). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for FGFs. FGFR2 is required for male sex determination.
Probab=98.42  E-value=7.7e-07  Score=53.10  Aligned_cols=28  Identities=18%  Similarity=0.590  Sum_probs=23.1

Q ss_pred             CCCeEEEEEEcccCCCeEEEEeC---CCeee
Q psy11558         34 TTGAQVECTARGSPNPEIIWIRS---DGTAV   61 (74)
Q Consensus        34 g~~v~L~C~A~G~P~P~I~W~~~---dG~~i   61 (74)
                      |+.++|+|.|.|+|.|+|+|++.   +|..+
T Consensus         1 G~~v~L~C~~~g~P~P~i~W~k~~~~~g~~~   31 (90)
T cd05858           1 GSTVEFVCKVYSDAQPHIQWLKHVEKNGSKY   31 (90)
T ss_pred             CCeEEEEEEEecCCCCEEEEEEecccCCcEe
Confidence            45799999999999999999974   35544


No 60 
>cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB. TrkB_d5: the fifth domain of Trk receptor TrkB, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors, which mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. The Trks are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkB shares significant sequence homology and domain organization with TrkA, and TrkC. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrKB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. In some cell systems NT-3 can activate TrkA and TrkB receptors. TrKB transcripts are found throughout multiple structures of the central and peripheral nervous systems.
Probab=98.40  E-value=5.7e-07  Score=53.99  Aligned_cols=28  Identities=21%  Similarity=0.635  Sum_probs=23.7

Q ss_pred             EEEEEEcccCCCeEEEEeCCCeeecCCCC
Q psy11558         38 QVECTARGSPNPEIIWIRSDGTAVGDVPG   66 (74)
Q Consensus        38 ~L~C~A~G~P~P~I~W~~~dG~~i~~~~~   66 (74)
                      -+.|.+.|+|+|+|+|++ ||.+|.+...
T Consensus         2 ~i~~~v~G~P~Pti~W~k-ng~~l~~~~~   29 (79)
T cd05855           2 CIPFTVKGNPKPTLQWFH-EGAILNESEY   29 (79)
T ss_pred             eEEEEEeEeCCCceEEEE-CCEECCCCcc
Confidence            378999999999999996 8998875543


No 61 
>cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins. Ig2_L1-CAM_like: domain similar to the second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains, five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth.
Probab=98.39  E-value=6.7e-07  Score=55.68  Aligned_cols=44  Identities=18%  Similarity=0.382  Sum_probs=36.0

Q ss_pred             cceEEEcCCCcEEecCCCCeEEEEE-EcccCCCeEEEEeCCCeee
Q psy11558         18 GPIFIKEPPNRIDFSNTTGAQVECT-ARGSPNPEIIWIRSDGTAV   61 (74)
Q Consensus        18 ~P~fv~~Pp~~v~~~~g~~v~L~C~-A~G~P~P~I~W~~~dG~~i   61 (74)
                      .|.|..+..+.+.+.+|.+++|.|. +.|.|.|+|.|++++...+
T Consensus         2 ~~~~~~~~~~~v~V~eG~~~~L~C~pP~g~P~P~i~W~~~~~~~i   46 (95)
T cd05845           2 TPKWPKEKIRPVEVEEGDSVVLPCNPPKSAVPLRIYWMNSDLLHI   46 (95)
T ss_pred             CCcCCccccceeEEecCCCEEEEecCCCCCCCCEEEEECCCCccc
Confidence            3667777778888999999999997 7999999999996544434


No 62 
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig3_L1-CAM:  third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains, five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM.
Probab=98.39  E-value=3e-07  Score=52.83  Aligned_cols=24  Identities=38%  Similarity=0.771  Sum_probs=20.1

Q ss_pred             eEEEEEEcccCCCeEEEEeCCCeee
Q psy11558         37 AQVECTARGSPNPEIIWIRSDGTAV   61 (74)
Q Consensus        37 v~L~C~A~G~P~P~I~W~~~dG~~i   61 (74)
                      +.|.|.|.|+|+|+|+|+++ |.++
T Consensus         1 ~~L~C~~~G~P~P~v~W~k~-~~~~   24 (71)
T cd05876           1 LVLECIAEGLPTPEVHWDRI-DGPL   24 (71)
T ss_pred             CEEEEEeeEecCCeEEEEEC-CcCC
Confidence            47999999999999999985 4444


No 63 
>cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1). Ig2_VEGFR-1: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1). VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-1 binds VEGF-A strongly; VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-1 may play an inhibitory rolet in the function of VEGFR-2 by binding VEGF-A and interfering with its interaction with VEGFR-2. VEGFR-1 has a signaling role in mediating monocyte chemotaxis and may mediate a chemotactic and a survival signal in hematopoietic stem cells or leukemia cells.
Probab=98.38  E-value=6.1e-07  Score=52.90  Aligned_cols=27  Identities=26%  Similarity=0.688  Sum_probs=23.0

Q ss_pred             eEEEEEEcccCCCeEEEEeCCCeeecCC
Q psy11558         37 AQVECTARGSPNPEIIWIRSDGTAVGDV   64 (74)
Q Consensus        37 v~L~C~A~G~P~P~I~W~~~dG~~i~~~   64 (74)
                      +.|.|.+.|.|+|+++|.+ ||.++...
T Consensus         1 ~~l~c~v~g~P~P~v~W~k-dg~~l~~~   27 (72)
T cd07702           1 YRLTPKVKAFPAPEVIWLK-DGLPAAEK   27 (72)
T ss_pred             CeEEeeEEEcCCCeEEEEE-CCEECCCC
Confidence            4799999999999999996 78887543


No 64 
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR). Ig2_VEGFR: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-2 is a major mediator of the mitogenic, angiogenic and microvascular permeability-enhancing effects of VEGF-A. VEGFR-1 may play an inhibitory part in these processes by binding VEGF and interfering with its interaction with VEGFR-2. VEGFR-1 has a signa
Probab=98.38  E-value=5.1e-07  Score=52.10  Aligned_cols=27  Identities=22%  Similarity=0.652  Sum_probs=23.4

Q ss_pred             eEEEEEEcccCCCeEEEEeCCCeeecCC
Q psy11558         37 AQVECTARGSPNPEIIWIRSDGTAVGDV   64 (74)
Q Consensus        37 v~L~C~A~G~P~P~I~W~~~dG~~i~~~   64 (74)
                      +.|.|.+.|.|+|+++|++ ||.++...
T Consensus         1 ~~l~c~v~g~P~p~v~W~k-~g~~l~~~   27 (71)
T cd04976           1 VRLPVKVKAYPPPEIQWYK-NGKLISEK   27 (71)
T ss_pred             CEEEeEEEEeCCCEEEEEE-CCEECCCC
Confidence            4799999999999999997 88887543


No 65 
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins. Ig2_Follistatin_like: domain similar to the second immunoglobulin (Ig)-like domain found in a follistatin-like molecule encoded by the CNS-related Mahya gene. Mahya genes have been retained in certain Bilaterian branches during evolution.  They are conserved in Hymenoptera and Deuterostomes, but are absent from other metazoan species such as fruit fly and nematode. Mahya proteins are secretory, with a follistatin-like domain (Kazal-type serine/threonine protease inhibitor domain and EF-hand calcium-binding domain), two Ig-like domains, and a novel C-terminal domain. Mahya may be involved in learning and memory and in processing of sensory information in Hymenoptera and vertebrates. Follistatin is a secreted, multidomain protein that binds activins with high affinity and antagonizes their signaling.
Probab=98.36  E-value=9.4e-07  Score=50.83  Aligned_cols=28  Identities=29%  Similarity=0.754  Sum_probs=23.2

Q ss_pred             eEEEEEEcccCCCeEEEEeCCCeeecCCC
Q psy11558         37 AQVECTARGSPNPEIIWIRSDGTAVGDVP   65 (74)
Q Consensus        37 v~L~C~A~G~P~P~I~W~~~dG~~i~~~~   65 (74)
                      +.|.|.|.|.|+|.|+|++ ||..+....
T Consensus         1 ~~L~C~v~g~P~p~v~W~k-~~~~l~~~~   28 (76)
T cd05736           1 ASLRCHAEGIPLPRLTWLK-NGMDITPKL   28 (76)
T ss_pred             CEeEeEeeecCCCEEEEEE-CCEECCCCC
Confidence            4799999999999999986 777775443


No 66 
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM). Ig_CEACAM_D4:  immunoglobulin (Ig)-like domain 4 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surface. This family corresponds to the
Probab=98.35  E-value=1.2e-06  Score=53.04  Aligned_cols=42  Identities=17%  Similarity=0.409  Sum_probs=31.1

Q ss_pred             ceEEEc-CCCcEEecCCCCeEEEEEEcccCCCeEEEEeCCCeeec
Q psy11558         19 PIFIKE-PPNRIDFSNTTGAQVECTARGSPNPEIIWIRSDGTAVG   62 (74)
Q Consensus        19 P~fv~~-Pp~~v~~~~g~~v~L~C~A~G~P~P~I~W~~~dG~~i~   62 (74)
                      |.+... .+......+|++++|+|.|.|. .|.|+|++ ||.++.
T Consensus         2 p~~~~~~~~~~~~v~~g~~v~l~C~a~g~-~p~i~W~k-ng~~l~   44 (91)
T cd05740           2 PVINSNNSVGNQPPEDNQPVTLTCEAEGQ-ATYIWWVN-NGSLLV   44 (91)
T ss_pred             CEeecccccCccccccCCcEEEEEEeCCC-CCEEEEEE-CCEECC
Confidence            555422 2334456788899999999999 99999996 676653


No 67 
>KOG3513|consensus
Probab=98.35  E-value=1.3e-06  Score=72.34  Aligned_cols=51  Identities=25%  Similarity=0.555  Sum_probs=39.9

Q ss_pred             ceEEEcCCCcEEecCCCC--eEEEEEEcccCCCeEEEEeCCCeeecCCCCceEE
Q psy11558         19 PIFIKEPPNRIDFSNTTG--AQVECTARGSPNPEIIWIRSDGTAVGDVPGLRKY   70 (74)
Q Consensus        19 P~fv~~Pp~~v~~~~g~~--v~L~C~A~G~P~P~I~W~~~dG~~i~~~~~~r~~   70 (74)
                      |.|+++|.+.+..-....  +.|+|.|.|+|.|+.+|++ ||..+......+..
T Consensus        40 P~f~~q~~~~~~~~~~~~~~v~l~C~A~G~P~Psy~W~k-ng~~~d~~~~~~~~   92 (1051)
T KOG3513|consen   40 PVFVEQPNDVIVPFPSDDSSVTLNCEANGNPEPSYRWTK-NGTEFDPTEYPRVS   92 (1051)
T ss_pred             ceeeecCCceEEecccCCccEEEEEEecCCCCceeEEEE-CCeeccccccccee
Confidence            999999876654443333  9999999999999999996 88877766655544


No 68 
>cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC. TrkABC_d5: the fifth domain of Trk receptors TrkA, TrkB and TrkC, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors. They are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkA, TrkB, and TrkC share significant sequence homology and domain organization. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrkA, Band C mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. TrkA is recognized by NGF. TrkB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. TrkC is recognized by NT-3. NT-3 is promiscuous as in some cell systems it activates TrkA and TrkB receptors. TrkA is a receptor foun
Probab=98.34  E-value=6.4e-07  Score=53.39  Aligned_cols=27  Identities=26%  Similarity=0.730  Sum_probs=23.4

Q ss_pred             EEEEEEcccCCCeEEEEeCCCeeecCCC
Q psy11558         38 QVECTARGSPNPEIIWIRSDGTAVGDVP   65 (74)
Q Consensus        38 ~L~C~A~G~P~P~I~W~~~dG~~i~~~~   65 (74)
                      -++|.|.|+|+|+|+|++ ||.+|....
T Consensus         2 ~i~~~v~G~P~P~v~W~k-~g~~i~~~~   28 (81)
T cd04971           2 CIPFTVRGNPKPTLTWYH-NGAVLNESD   28 (81)
T ss_pred             eEEEEeEeeCCCcEEEEE-CCEECcCCC
Confidence            378999999999999997 898887654


No 69 
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins. Ig3_Perlecan_like: domain similar to the third immunoglobulin (Ig)-like domain found in Perlecan. Perlecan is a large multi-domain heparin sulfate proteoglycan, important in tissue development and organogenesis.  Perlecan can be represented as 5 major portions; its fourth major portion (domain IV) is a tandem repeat of immunoglobulin-like domains (Ig2-Ig15), which can vary in size due to alternative splicing. Perlecan binds many cellular and extracellular ligands. Its domain IV region has many binding sites.  Some of these have been mapped at the level of individual Ig-like domains, including a site restricted to the Ig5 domain for heparin/sulfatide, a site restricted to the Ig3 domain for nidogen-1 and nidogen-2, a site restricted to Ig4-5 for fibronectin, and sites restricted to Ig2 and to Ig13-15 for fibulin-2.
Probab=98.34  E-value=1.8e-06  Score=50.67  Aligned_cols=37  Identities=22%  Similarity=0.470  Sum_probs=30.6

Q ss_pred             EEEcCCCcEEecCCCCeEEEEEEcc-cCCCeEEEEeCC
Q psy11558         21 FIKEPPNRIDFSNTTGAQVECTARG-SPNPEIIWIRSD   57 (74)
Q Consensus        21 fv~~Pp~~v~~~~g~~v~L~C~A~G-~P~P~I~W~~~d   57 (74)
                      ++.++|..+....|+.++|.|.|.| .|.|.|.|++.+
T Consensus         3 ~~~~~p~~~~v~~G~~v~L~C~~~~~~~~~~i~W~~~~   40 (85)
T cd05754           3 VTVEEPRSQEVRPGADVSFICRAKSKSPAYTLVWTRVG   40 (85)
T ss_pred             EEecCCCceEEcCCCCEEEEEEcCCCCCCcEEEEEECC
Confidence            4556677777889999999999985 799999999754


No 70 
>cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM). Ig7_DSCAM: the seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM). DSCAM is a cell adhesion molecule expressed largely in the developing nervous system. The gene encoding DSCAM is located at human chromosome 21q22, the locus associated with the mental retardation phenotype of Down Syndrome. DSCAM is predicted to be the largest member of the IG superfamily. It has been demonstrated that DSCAM can mediate cation-independent homophilic intercellular adhesion.
Probab=98.34  E-value=3.9e-07  Score=52.99  Aligned_cols=23  Identities=39%  Similarity=0.962  Sum_probs=20.3

Q ss_pred             eEEEEEEcccCCCeEEEEeCCCe
Q psy11558         37 AQVECTARGSPNPEIIWIRSDGT   59 (74)
Q Consensus        37 v~L~C~A~G~P~P~I~W~~~dG~   59 (74)
                      |+|+|.|.|.|+|+|+|++.++.
T Consensus         1 v~l~C~~~G~P~P~v~W~~~~~~   23 (79)
T cd05734           1 VTLNCSAEGYPPPTIVWKHSKGR   23 (79)
T ss_pred             CEeEeeCeEeCCCEEEEEECCCc
Confidence            58999999999999999986553


No 71 
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Ig1_FGFR: The first immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for all FGFs.
Probab=98.33  E-value=1.4e-06  Score=50.96  Aligned_cols=36  Identities=22%  Similarity=0.427  Sum_probs=28.8

Q ss_pred             CcEEecCCCCeEEEEEEcccCCCeEEEEeCCCeeecCC
Q psy11558         27 NRIDFSNTTGAQVECTARGSPNPEIIWIRSDGTAVGDV   64 (74)
Q Consensus        27 ~~v~~~~g~~v~L~C~A~G~P~P~I~W~~~dG~~i~~~   64 (74)
                      ....+..|+.+.|.|.|.|. .|+|+|++ ||.+|...
T Consensus         2 ~~~~~~~G~~v~l~C~~~~~-~~~v~W~k-~g~~l~~~   37 (79)
T cd04973           2 ESYSAHPGDLLQLRCRLRDD-VQSINWTK-DGVQLGEN   37 (79)
T ss_pred             CcEEecCCCCEEEEEEecCC-CceEEEee-CCcCCCCC
Confidence            34456788899999999996 68999996 88887653


No 72 
>cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)). Ig1_Necl-1: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-1, Necl-1 (also known as celll adhesion molecule 3 (CADM3), SynCAM2, IGSF4). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue, and is important to the format
Probab=98.33  E-value=1.2e-06  Score=53.82  Aligned_cols=33  Identities=9%  Similarity=0.266  Sum_probs=27.7

Q ss_pred             CcEEecCCCCeEEEEEEcccCCCeEEEEeCCCe
Q psy11558         27 NRIDFSNTTGAQVECTARGSPNPEIIWIRSDGT   59 (74)
Q Consensus        27 ~~v~~~~g~~v~L~C~A~G~P~P~I~W~~~dG~   59 (74)
                      +++.+..|+++.|+|.|.|.|.|+|.|.+.++.
T Consensus         5 ~~~tv~~G~tv~L~C~v~g~~~~~v~W~k~~~~   37 (95)
T cd05882           5 QDETVAVGGTVTLKCGVKEHDNSSLQWSNTAQQ   37 (95)
T ss_pred             ccEEEecCCcEEEEEEEeCCCCCeEEEeccCcc
Confidence            345677888999999999999999999976553


No 73 
>cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs). Ig_Pro_neuregulin: immunoglobulin (Ig)-like domain in neuregulins (NRGs). NRGs are signaling molecules, which participate in cell-cell interactions in the nervous system, breast, heart, and other organ systems, and are implicated in the pathology of diseases including schizophrenia, multiple sclerosis, and breast cancer. There are four members of the neuregulin gene family (NRG1, -2, -3, and -4). The NRG-1 protein, binds to and activates the tyrosine kinases receptors ErbB3 and ErbB4, initiating signaling cascades. The other NRGs proteins bind one or the other or both of these ErbBs. NRG-1 has multiple functions; for example, in the brain it regulates various processes such as radial glia formation and neuronal migration, dendritic development, and expression of neurotransmitters receptors; in the peripheral nervous system NRG-1 regulates processes such as target cell differentiation, and Schwann cell surv
Probab=98.33  E-value=1.1e-06  Score=49.93  Aligned_cols=29  Identities=21%  Similarity=0.523  Sum_probs=24.0

Q ss_pred             eEEEEEEcc-cCCCeEEEEeCCCeeecCCCC
Q psy11558         37 AQVECTARG-SPNPEIIWIRSDGTAVGDVPG   66 (74)
Q Consensus        37 v~L~C~A~G-~P~P~I~W~~~dG~~i~~~~~   66 (74)
                      .+|.|.|.| +|.|+++|++ ||.++.....
T Consensus         1 ~~l~C~~~g~~P~p~~~W~k-~g~~l~~~~~   30 (75)
T cd05750           1 LVLKCEATSEYPSLRFKWFK-DGKELNRKNK   30 (75)
T ss_pred             CEEEEEccCCCCCceEEEEc-CCeeccccCC
Confidence            369999999 9999999997 7888765443


No 74 
>cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig4_Robo: domain similar to the fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antagoni
Probab=98.29  E-value=9e-07  Score=52.69  Aligned_cols=25  Identities=28%  Similarity=0.763  Sum_probs=21.7

Q ss_pred             CCCeEEEEEEcccCCCeEEEEeCCC
Q psy11558         34 TTGAQVECTARGSPNPEIIWIRSDG   58 (74)
Q Consensus        34 g~~v~L~C~A~G~P~P~I~W~~~dG   58 (74)
                      |+.++|.|.|.|+|.|+|.|+++++
T Consensus         1 G~~v~L~C~~~g~P~p~v~W~k~g~   25 (90)
T cd05726           1 GRTVTFQCEATGNPQPAIFWQKEGS   25 (90)
T ss_pred             CCEEEEEEECCccCCCEEEEEeCCC
Confidence            4579999999999999999997544


No 75 
>cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig3_L1-CAM_like: domain similar to the third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM and human neurofascin.
Probab=98.29  E-value=7.5e-07  Score=50.10  Aligned_cols=22  Identities=50%  Similarity=1.031  Sum_probs=19.3

Q ss_pred             eEEEEEEcccCCCeEEEEeCCC
Q psy11558         37 AQVECTARGSPNPEIIWIRSDG   58 (74)
Q Consensus        37 v~L~C~A~G~P~P~I~W~~~dG   58 (74)
                      +.|.|.|.|.|.|+|+|+++++
T Consensus         1 v~l~C~~~g~P~p~v~W~k~~~   22 (71)
T cd05731           1 LLLECIAEGLPTPEISWIKIGG   22 (71)
T ss_pred             CEEEEEeeEecCCeEEEEECCe
Confidence            4799999999999999998544


No 76 
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)). Ig1_Necl-3: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-3, Necl-3 (also known as cell adhesion molecule 2 (CADM2), SynCAM2, IGSF4D).  Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region, belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses.  Necl-3 accumulates in central and peripheral nervous system tissue, and has been shown to selectively interact with oligodendrocytes.
Probab=98.26  E-value=2.3e-06  Score=52.20  Aligned_cols=34  Identities=12%  Similarity=0.323  Sum_probs=28.6

Q ss_pred             CCcEEecCCCCeEEEEEEcccCCCeEEEEeCCCe
Q psy11558         26 PNRIDFSNTTGAQVECTARGSPNPEIIWIRSDGT   59 (74)
Q Consensus        26 p~~v~~~~g~~v~L~C~A~G~P~P~I~W~~~dG~   59 (74)
                      .+.+.+.+|+++.|+|.+.|.|.|.|.|++.++.
T Consensus         4 ~~~v~v~eG~~v~L~C~~~~~p~~~v~W~~~~~~   37 (95)
T cd07701           4 TQNVTVVEGGTANLTCRVDQNDNTSLQWSNPAQQ   37 (95)
T ss_pred             cceEEEecCCcEEEEEEEecCCceEEEEeCCCCe
Confidence            3556788999999999999999999999865444


No 77 
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig6_Contactin-2: Sixth Ig domain of the neural cell adhesion molecule contactin-2-like. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. It may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module by contacts between IG domains 1 and 4, and domains 2 and 3. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-2 is also expressed in retinal amacrine cells in the developing c
Probab=98.25  E-value=2.5e-06  Score=50.90  Aligned_cols=28  Identities=18%  Similarity=0.366  Sum_probs=23.6

Q ss_pred             CeEEEEEEcccCCC--eEEEEeCCCeeecCC
Q psy11558         36 GAQVECTARGSPNP--EIIWIRSDGTAVGDV   64 (74)
Q Consensus        36 ~v~L~C~A~G~P~P--~I~W~~~dG~~i~~~   64 (74)
                      .++|.|.|.|+|.|  +|+|.+ ||.++...
T Consensus         2 ~~~L~C~a~g~P~p~~~v~W~~-~g~~i~~~   31 (85)
T cd05854           2 NLTLQCHASHDPTMDLTFTWSL-DDFPIDLD   31 (85)
T ss_pred             cEEEEEEEecCCCCCeEEEEEE-CCeEcccc
Confidence            48999999999998  589996 88887543


No 78 
>cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily. Ig_3: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=98.25  E-value=1.6e-06  Score=49.81  Aligned_cols=23  Identities=35%  Similarity=0.787  Sum_probs=20.9

Q ss_pred             CCCeEEEEEEcccCCCeEEEEeC
Q psy11558         34 TTGAQVECTARGSPNPEIIWIRS   56 (74)
Q Consensus        34 g~~v~L~C~A~G~P~P~I~W~~~   56 (74)
                      |+.++|.|.+.|.|.|+|+|++.
T Consensus         1 G~~v~l~C~~~g~P~p~v~W~k~   23 (81)
T cd05765           1 GETASFHCDVTGRPPPEITWEKQ   23 (81)
T ss_pred             CCcEEEEeeccccCCCcEEEEec
Confidence            45799999999999999999975


No 79 
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig3_Robo: domain similar to the third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antagoni
Probab=98.24  E-value=1e-06  Score=49.92  Aligned_cols=22  Identities=32%  Similarity=0.999  Sum_probs=19.4

Q ss_pred             eEEEEEEcccCCCeEEEEeCCC
Q psy11558         37 AQVECTARGSPNPEIIWIRSDG   58 (74)
Q Consensus        37 v~L~C~A~G~P~P~I~W~~~dG   58 (74)
                      ++|.|.+.|+|.|+|+|.++++
T Consensus         1 v~l~C~~~g~P~p~v~W~k~~~   22 (69)
T cd05725           1 VEFQCEVGGDPVPTVLWRKEDG   22 (69)
T ss_pred             CEEEEECccCCCCEEEEEECCc
Confidence            5799999999999999998544


No 80 
>KOG4222|consensus
Probab=98.21  E-value=1.1e-06  Score=73.35  Aligned_cols=60  Identities=27%  Similarity=0.567  Sum_probs=45.1

Q ss_pred             eecccCCCccceEEEcCCCcEEecCCCCeEEEEEEcccCCCeEEEEeCCCe-eecCCCCceEE
Q psy11558          9 TMAAEDDTLGPIFIKEPPNRIDFSNTTGAQVECTARGSPNPEIIWIRSDGT-AVGDVPGLRKY   70 (74)
Q Consensus         9 ~~~~~~~~~~P~fv~~Pp~~v~~~~g~~v~L~C~A~G~P~P~I~W~~~dG~-~i~~~~~~r~~   70 (74)
                      ..+......+|.++.-| +++.++.++.++|+|.|+|+|+|+|+|++ ||+ .....++..++
T Consensus        22 ~~~~r~qd~~p~iiehp-~d~vvs~~~patlnc~asG~ppPti~w~k-~G~~~~~~e~~shR~   82 (1281)
T KOG4222|consen   22 CPSLRAQDQPPRIIEHP-HDLVVSKGEPATLNCKASGDPPPTIEWYK-DGENVFKGEPGSHRF   82 (1281)
T ss_pred             ccccccccCCCceEecc-hhhhccCCCCceeecCCCCCCCCceeccc-CCcccCCCCCCCcce
Confidence            34455667899999985 55558888899999999999999999996 774 44455544443


No 81 
>cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D. Ig_Sema4D_like; Immunoglobulin (Ig)-like domain of Sema4D. Sema4D is a Class IV semaphorin. Semaphorins are classified based on structural features additional to the Sema domain. Sema4D has extracellular Sema and Ig domains, a transmembrane domain, and a short cytoplasmic domain. Sema4D plays a part in the development of GABAergic synapses. Sema4D in addition is an immune semaphorin. It is abundant on resting T cells; its expression is weak on resting B cells and antigen presenting cells (APCs), but is upregulated by various stimuli. The receptor used by Sema4D in the immune system is CD72. Sem4D enhances the activation of B cells and DCs through binding CD72, perhaps by reducing CD72s inhibitory signals. The receptor used by Sema4D in the non-lymphatic tissues is plexin-B1. Sem4D is anchored to the cell surface but its extracellular domain can be released from the cell surface by a metalloproteas
Probab=98.18  E-value=6.9e-06  Score=50.13  Aligned_cols=36  Identities=17%  Similarity=0.448  Sum_probs=29.4

Q ss_pred             CcEEecCCCCeEEEEEEcccCCCeEEEEeCCCeeecCC
Q psy11558         27 NRIDFSNTTGAQVECTARGSPNPEIIWIRSDGTAVGDV   64 (74)
Q Consensus        27 ~~v~~~~g~~v~L~C~A~G~P~P~I~W~~~dG~~i~~~   64 (74)
                      ++..+..|+++.|.|.+.+ |.|+|+|.+ ||.+|...
T Consensus         4 ~~~~v~~G~~v~L~C~~~~-~~~~i~W~~-ng~~i~~~   39 (87)
T cd05873           4 RQRTFKLGNNAELKCSPKS-NLARVVWKF-DGKVLTPE   39 (87)
T ss_pred             ceEEEECCCCEEEEEECCC-CCCeEEEEE-CCEECCCC
Confidence            4445778889999999875 889999996 89888654


No 82 
>KOG4194|consensus
Probab=98.16  E-value=1.4e-06  Score=69.82  Aligned_cols=45  Identities=36%  Similarity=0.742  Sum_probs=37.9

Q ss_pred             CccceEEEcCCCcEEecCCCCeEEEEEEcccCCCeEEEEeCCCeee
Q psy11558         16 TLGPIFIKEPPNRIDFSNTTGAQVECTARGSPNPEIIWIRSDGTAV   61 (74)
Q Consensus        16 ~~~P~fv~~Pp~~v~~~~g~~v~L~C~A~G~P~P~I~W~~~dG~~i   61 (74)
                      ...|.|+++| .++....|+-+.|.|.|+|.|.|+|.|.+.+|...
T Consensus       610 ~~~PsFtktP-~dltl~tg~mArl~CaAtG~P~PeIawqkdggtdF  654 (873)
T KOG4194|consen  610 NQAPSFTKTP-EDLTLRTGQMARLECAATGHPRPEIAWQKDGGTDF  654 (873)
T ss_pred             eccCccccCc-ccceeecccceeeeeeccCCCCcceeehhcCCCCC
Confidence            4689999995 56677788889999999999999999998666543


No 83 
>cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin. Ig_Semaphorin_C; Immunoglobulin (Ig)-like domain in semaphorins. Semaphorins are transmembrane protein that have important roles in a variety of tissues. Functionally, semaphorins were initially characterized for their importance in the development of the nervous system and in axonal guidance. Later they have been found to be important for the formation and functioning of the cardiovascular, endocrine, gastrointestinal, hepatic, immune, musculoskeletal, renal, reproductive, and respiratory systems. Semaphorins function through binding to their receptors and transmembrane semaphorins also serves as receptors themselves. Although molecular mechanism of semaphorins is poorly understood, the Ig-like domains may involve in ligand binding or dimerization.
Probab=98.10  E-value=6.1e-06  Score=48.87  Aligned_cols=35  Identities=11%  Similarity=0.426  Sum_probs=28.0

Q ss_pred             CCcEEecCCCCeEEEEEEcccCCCeEEEEeCCCeeec
Q psy11558         26 PNRIDFSNTTGAQVECTARGSPNPEIIWIRSDGTAVG   62 (74)
Q Consensus        26 p~~v~~~~g~~v~L~C~A~G~P~P~I~W~~~dG~~i~   62 (74)
                      +..+.+..|+.+.|+|.+.| |.|+|.|++ ||..+.
T Consensus         3 ~~~~~v~~g~~v~L~C~~~~-p~~~i~W~k-~~~~~~   37 (89)
T cd04979           3 EKVVTVVEGNSVFLECSPKS-NLASVVWLF-QGGPLQ   37 (89)
T ss_pred             ceEEEEECCCcEEEEEeCCC-CCceEEEEE-CCcccc
Confidence            45556778889999999998 999999997 555443


No 84 
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins. Ig2_FGFR_like: domain similar to the second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. FGF receptors bind FGF signaling polypeptides. FGFs participate in multiple processes such as morphogenesis, development, and angiogenesis. FGFs bind to four FGF receptor tyrosine kinases (FGFR1, -2, -3, -4). Receptor diversity is controlled by alternative splicing producing splice variants with different ligand binding characteristics and different expression patterns. FGFRs have an extracellular region comprised of three Ig-like domains, a single transmembrane helix, and an intracellular tyrosine kinase domain. Ligand binding and specificity reside in the Ig-like domains 2 and 3, and the linker region that connects these two. FGFR activation and signaling depend on FGF-induced dimerization, a process involving cell surface heparin or heparin 
Probab=98.09  E-value=1.5e-05  Score=45.53  Aligned_cols=31  Identities=29%  Similarity=0.802  Sum_probs=26.1

Q ss_pred             ecCCCCeEEEEEEcccCCCeEEEEeCCCeeec
Q psy11558         31 FSNTTGAQVECTARGSPNPEIIWIRSDGTAVG   62 (74)
Q Consensus        31 ~~~g~~v~L~C~A~G~P~P~I~W~~~dG~~i~   62 (74)
                      ...|+.+.|.|.|.|.|.|.|+|++ +|..+.
T Consensus         6 ~~~G~~~~l~C~~~~~p~~~v~W~k-~~~~~~   36 (85)
T cd05729           6 VPAGSTVRLKCPASGNPRPTITWLK-DGKPFK   36 (85)
T ss_pred             ecCCCcEEEEEEcCCCCCCeEEEEE-CCEECc
Confidence            4567789999999999999999997 666654


No 85 
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin. Ig6_Contactin_like: Sixth Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=98.07  E-value=7.2e-06  Score=48.19  Aligned_cols=27  Identities=19%  Similarity=0.479  Sum_probs=22.9

Q ss_pred             CeEEEEEEcccCCC--eEEEEeCCCeeecC
Q psy11558         36 GAQVECTARGSPNP--EIIWIRSDGTAVGD   63 (74)
Q Consensus        36 ~v~L~C~A~G~P~P--~I~W~~~dG~~i~~   63 (74)
                      +++|.|.|.|+|.|  +++|.+ ||.++..
T Consensus         2 ~~~L~C~~~g~P~p~i~~~W~~-~g~~i~~   30 (85)
T cd04970           2 SITLQCHASHDPTLDLTFTWSF-NGVPIDF   30 (85)
T ss_pred             cEEEEEEEecCCCCCeEEEEEE-CCeEeec
Confidence            58999999999999  669996 8888753


No 86 
>PF13895 Ig_2:  Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A ....
Probab=98.04  E-value=1.4e-05  Score=44.85  Aligned_cols=43  Identities=19%  Similarity=0.689  Sum_probs=33.0

Q ss_pred             ceEEEcCCCcEEecCCCCeEEEEEEcccCCCeEEEEeCCCeeecCCC
Q psy11558         19 PIFIKEPPNRIDFSNTTGAQVECTARGSPNPEIIWIRSDGTAVGDVP   65 (74)
Q Consensus        19 P~fv~~Pp~~v~~~~g~~v~L~C~A~G~P~P~I~W~~~dG~~i~~~~   65 (74)
                      |.+..++ ..  +..|+.++|.|.+.|.|.+++.|.+ ++..+...+
T Consensus         2 P~l~~~~-~~--v~~g~~~~l~C~~~~~p~~~~~w~~-~~~~~~~~~   44 (80)
T PF13895_consen    2 PVLSSSP-QS--VEEGDSVTLTCSVSGNPPPQVQWYK-NGSPINSSQ   44 (80)
T ss_dssp             -EEEEES-SE--EETTSEEEEEEEEESSSSSEEEEEE-TTEEEEEES
T ss_pred             cEEEccc-eE--EeCCCcEEEEEEEEcccceeeeeee-eeeeeeeee
Confidence            6666664 33  4568889999999999999999997 777776443


No 87 
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively). Ig1_Necl-1-3_like:  N-terminal immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 (also known as cell adhesion molecule 3 (CADM3)), Necl-2 (CADM1), and Necl-3 (CADM2). At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1, Necl-2, and Necl-3 have Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue, and is important to the form
Probab=97.94  E-value=2.6e-05  Score=46.62  Aligned_cols=34  Identities=12%  Similarity=0.398  Sum_probs=28.3

Q ss_pred             CcEEecCCCCeEEEEEEcccCCCeEEEEeCCCee
Q psy11558         27 NRIDFSNTTGAQVECTARGSPNPEIIWIRSDGTA   60 (74)
Q Consensus        27 ~~v~~~~g~~v~L~C~A~G~P~P~I~W~~~dG~~   60 (74)
                      +.+.+..|+++.|.|.+.|.|.|.+.|++.++..
T Consensus         5 ~~~~v~~G~~v~L~C~~~~~~~~~v~W~~p~~~~   38 (95)
T cd05717           5 QDVTVVEGGTATLKCRVKNNDNSSLQWSNPNQQT   38 (95)
T ss_pred             CcEEEcCCCCEEEEEEECCCCCceEEEeCCCCcE
Confidence            4556788999999999999999999998655543


No 88 
>cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). Ig2_KIRREL3-like: domain similar to the second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1), Kirrel2 (Neph3), and Drosophila RST (irregular chiasm C-roughest) protein. These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development.
Probab=97.94  E-value=2.2e-05  Score=45.78  Aligned_cols=26  Identities=46%  Similarity=0.995  Sum_probs=22.2

Q ss_pred             eEEEEEEcc-cCCCeEEEEeCCCeeecC
Q psy11558         37 AQVECTARG-SPNPEIIWIRSDGTAVGD   63 (74)
Q Consensus        37 v~L~C~A~G-~P~P~I~W~~~dG~~i~~   63 (74)
                      +.|.|.|.| .|.|+|+|++ ||.++..
T Consensus         2 ~~L~C~v~g~~P~~~v~W~~-~g~~l~~   28 (82)
T cd05759           2 YNLTCRARGAKPAAEIIWFR-DGEVLDG   28 (82)
T ss_pred             EEEEEEEeCccCCCEEEEEE-CCEEccC
Confidence            689999998 7999999997 7887654


No 89 
>KOG4221|consensus
Probab=97.87  E-value=5.4e-05  Score=63.90  Aligned_cols=46  Identities=26%  Similarity=0.663  Sum_probs=37.5

Q ss_pred             CccceEEEcCCCcEEecCCCCeEEEEEEcccCCCeEEEEeCCCeeecC
Q psy11558         16 TLGPIFIKEPPNRIDFSNTTGAQVECTARGSPNPEIIWIRSDGTAVGD   63 (74)
Q Consensus        16 ~~~P~fv~~Pp~~v~~~~g~~v~L~C~A~G~P~P~I~W~~~dG~~i~~   63 (74)
                      ...-+|+.+|...+ ...|++++|+|.|+|.|+|+|+|++ ||..|.-
T Consensus       235 ~~~~~fl~~p~~~~-v~~g~~v~leCvvs~~p~p~v~Wlr-ng~~i~~  280 (1381)
T KOG4221|consen  235 LNKLVFLDEPSNAV-VVEGDDVVLECVVSGVPKPSVKWLR-NGEKISV  280 (1381)
T ss_pred             ccceeeecCCCccc-cccCCcEEEEEEecCCCCCceEEee-CCeeeee
Confidence            44556999976665 5667789999999999999999997 8988753


No 90 
>PHA02785 IL-beta-binding protein; Provisional
Probab=97.85  E-value=6.9e-05  Score=54.49  Aligned_cols=40  Identities=18%  Similarity=0.449  Sum_probs=31.7

Q ss_pred             EEcCCCcEEecCCCCeEEEEEEcccCCC---eEEEEeCCCeeecC
Q psy11558         22 IKEPPNRIDFSNTTGAQVECTARGSPNP---EIIWIRSDGTAVGD   63 (74)
Q Consensus        22 v~~Pp~~v~~~~g~~v~L~C~A~G~P~P---~I~W~~~dG~~i~~   63 (74)
                      +..| +.+....|+.+.|.|.|.|.|.|   .|.|.+ ||..|..
T Consensus       224 ~~~p-~~~~~~~G~~v~L~C~a~g~P~~~~~~v~W~k-ng~~i~~  266 (326)
T PHA02785        224 MQLP-EGVVTSIGSNLTIACRVSLRPPTTDADVFWIS-NGMYYEE  266 (326)
T ss_pred             ecCC-CcEEecCCCcEEEEEEEECCCCCCCceEEEEE-CCEECCC
Confidence            4554 55666778889999999999974   899996 8888754


No 91 
>smart00408 IGc2 Immunoglobulin C-2 Type.
Probab=97.84  E-value=3.2e-05  Score=40.73  Aligned_cols=28  Identities=32%  Similarity=0.851  Sum_probs=23.8

Q ss_pred             CCCeEEEEEEcccCCCeEEEEeCCCeeec
Q psy11558         34 TTGAQVECTARGSPNPEIIWIRSDGTAVG   62 (74)
Q Consensus        34 g~~v~L~C~A~G~P~P~I~W~~~dG~~i~   62 (74)
                      |+.+.|.|.+.|.|.|++.|++ +|..+.
T Consensus         2 g~~~~l~C~~~~~~~~~v~W~~-~~~~~~   29 (63)
T smart00408        2 GQSVTLTCPAEGDPVPNITWLK-DGKPLP   29 (63)
T ss_pred             CceEEEEeeCccCCCCeEEEEE-CCEECC
Confidence            5679999999999999999997 666554


No 92 
>cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins. Ig1_IL1R_like: domain similar to the first immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R). IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three Ig-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta.
Probab=97.80  E-value=3.9e-05  Score=46.78  Aligned_cols=29  Identities=17%  Similarity=0.348  Sum_probs=24.6

Q ss_pred             ecCCCCeEEEEEEcc-----cCCCeEEEEeCCCee
Q psy11558         31 FSNTTGAQVECTARG-----SPNPEIIWIRSDGTA   60 (74)
Q Consensus        31 ~~~g~~v~L~C~A~G-----~P~P~I~W~~~dG~~   60 (74)
                      ..+|+.+.|.|.+.|     +|.|+|+|+++ |..
T Consensus        11 v~~G~~~~L~C~~~g~~~~~~p~~~v~Wyk~-~~~   44 (94)
T cd05756          11 VLEGEPVVIKCPLFYSYIAQSPGLNLTWYKS-DGK   44 (94)
T ss_pred             EecCCCeEEECCCCCcccccCCCceEEEEEc-CCC
Confidence            457888999999999     79999999984 544


No 93 
>cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins. Ig2_Contactin-2-like: second Ig domain of the neural cell adhesion molecule contactin-2. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (aliases TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. The first four Ig domains form the intermolecular binding fragment which arranges as a compact U-shaped module by contacts between Ig domains 1 and 4, and domains 2 and 3. It has been proposed that a linear zipper-like array forms, from contactin-2 molecules alternatively provided by the two apposed membranes.
Probab=97.79  E-value=4.4e-05  Score=47.55  Aligned_cols=40  Identities=15%  Similarity=0.290  Sum_probs=31.2

Q ss_pred             EEEcCCCcEEecCCCCeEEEEE-EcccCCCeEEEEeCCCeee
Q psy11558         21 FIKEPPNRIDFSNTTGAQVECT-ARGSPNPEIIWIRSDGTAV   61 (74)
Q Consensus        21 fv~~Pp~~v~~~~g~~v~L~C~-A~G~P~P~I~W~~~dG~~i   61 (74)
                      |..++.+.+.+.+|++++|+|. -.|.|.|+++|++ |+.++
T Consensus         5 f~~~~~~~~~v~eG~~~~L~C~pP~g~P~p~~~W~k-~~~~~   45 (96)
T cd05727           5 FPLEERDEVKVKEGWGVVLFCDPPPHYPDLSYRWLL-NEFPN   45 (96)
T ss_pred             cCcCCcCceeeeeCCcEEEeeCCCCCCCCCEEEEEE-CCccc
Confidence            4455566667788999999994 5699999999997 66653


No 94 
>cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins. Ig1_VEGFR_like: first immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) related proteins. The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGF-A interacts with both VEGFR-1 and VEGFR-2. VEGFR-1 binds strongest to VEGF, VEGF-2 binds more weakly. VEGFR-3 appears not to bind VEGF, but binds other members of the VEGF family (VEGF-C and -D). VEGFRs bind VEGFs with high affinity with the IG-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGF
Probab=97.77  E-value=2.8e-05  Score=45.51  Aligned_cols=24  Identities=13%  Similarity=0.292  Sum_probs=20.7

Q ss_pred             CCCeEEEEEEccc--CCCeEEEEeCC
Q psy11558         34 TTGAQVECTARGS--PNPEIIWIRSD   57 (74)
Q Consensus        34 g~~v~L~C~A~G~--P~P~I~W~~~d   57 (74)
                      |+.++|.|.|.|+  |.|.|+|.+++
T Consensus         1 Ge~~~L~C~~~g~~~~~~~i~W~~~~   26 (84)
T cd05742           1 GETLVLNCTVLTELNEGVDFQWTYPG   26 (84)
T ss_pred             CCeEEEEEEEEeCCCccEEEEEecCC
Confidence            4579999999999  89999998643


No 95 
>PHA02826 IL-1 receptor-like protein; Provisional
Probab=97.73  E-value=9.8e-05  Score=51.77  Aligned_cols=38  Identities=13%  Similarity=0.335  Sum_probs=29.2

Q ss_pred             CCcEEecCCCCeEEEEEEc-----ccCCCeEEEEeCCCeeecCC
Q psy11558         26 PNRIDFSNTTGAQVECTAR-----GSPNPEIIWIRSDGTAVGDV   64 (74)
Q Consensus        26 p~~v~~~~g~~v~L~C~A~-----G~P~P~I~W~~~dG~~i~~~   64 (74)
                      +....+..|+.+.|.|.|.     |.|.|+|+|++ ||.+|...
T Consensus       136 ~~~~~~~~G~~v~L~C~~~~~~~~~~p~p~I~WyK-ng~~l~~~  178 (227)
T PHA02826        136 TINYQFNSGKDSKLHCYGTDGISSTFKDYTLTWYK-NGNIVLYT  178 (227)
T ss_pred             CccceEecCCCEEEEeeCCCCccccCCCceEEEEE-CCEECCCC
Confidence            3444566788899999997     45789999997 88887543


No 96 
>smart00409 IG Immunoglobulin.
Probab=97.70  E-value=0.00032  Score=38.48  Aligned_cols=35  Identities=23%  Similarity=0.668  Sum_probs=28.5

Q ss_pred             cEEecCCCCeEEEEEEcccCCCeEEEEeCCCeeec
Q psy11558         28 RIDFSNTTGAQVECTARGSPNPEIIWIRSDGTAVG   62 (74)
Q Consensus        28 ~v~~~~g~~v~L~C~A~G~P~P~I~W~~~dG~~i~   62 (74)
                      .+....|+.+.|.|.+.+.+.+++.|.+.++..+.
T Consensus         3 ~~~~~~g~~~~l~C~~~~~~~~~~~W~~~~~~~v~   37 (86)
T smart00409        3 SVTVKEGESVTLSCEVSGSPPPEVTWYKQGGKLLA   37 (86)
T ss_pred             cEEEeCCCeEEEEEEEccCCCCeEEEEECCCEEcC
Confidence            34566788899999999999999999986466654


No 97 
>smart00410 IG_like Immunoglobulin like. IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.
Probab=97.70  E-value=0.00032  Score=38.48  Aligned_cols=35  Identities=23%  Similarity=0.668  Sum_probs=28.5

Q ss_pred             cEEecCCCCeEEEEEEcccCCCeEEEEeCCCeeec
Q psy11558         28 RIDFSNTTGAQVECTARGSPNPEIIWIRSDGTAVG   62 (74)
Q Consensus        28 ~v~~~~g~~v~L~C~A~G~P~P~I~W~~~dG~~i~   62 (74)
                      .+....|+.+.|.|.+.+.+.+++.|.+.++..+.
T Consensus         3 ~~~~~~g~~~~l~C~~~~~~~~~~~W~~~~~~~v~   37 (86)
T smart00410        3 SVTVKEGESVTLSCEVSGSPPPEVTWYKQGGKLLA   37 (86)
T ss_pred             cEEEeCCCeEEEEEEEccCCCCeEEEEECCCEEcC
Confidence            34566788899999999999999999986466654


No 98 
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b). Ig1_PDGFR-alphabeta: The first immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b). PDGF is a potent mitogen for connective tissue cells. PDGF-stimulated processes are mediated by three different PDGFs (PDGF-A,-B, and C). PDGFRalpha binds to all three PDGFs, whereas the PDGFRbeta binds only to PDGF-B. PDGFRs alpha and beta have similar organization: an extracellular component with five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. In mice, PDGFRalpha and PDGFRbeta are essential for normal development.
Probab=97.69  E-value=8.4e-05  Score=44.05  Aligned_cols=24  Identities=17%  Similarity=0.430  Sum_probs=21.1

Q ss_pred             CCCeEEEEEEcccCCCeEEEEeCC
Q psy11558         34 TTGAQVECTARGSPNPEIIWIRSD   57 (74)
Q Consensus        34 g~~v~L~C~A~G~P~P~I~W~~~d   57 (74)
                      |+.++|.|.|.|+|.|.++|...+
T Consensus         1 Ge~~~l~C~~~~~~~~~~~W~~~~   24 (84)
T cd05861           1 GETITVNCIVQGNEVVDFSWTYPG   24 (84)
T ss_pred             CCcEEEEEEEECCCccEEEEEECC
Confidence            567999999999999999999643


No 99 
>cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4. Ig1_CD4; first immunoglobulin (Ig) domain of CD4.  CD4 and CD8 are the two primary co-receptor proteins found on the surface of T cells, and the presence of either CD4 or CD8 determines the function of the T cell.  CD4 is found on helper T cells, where it is required for the binding of MHC (major histocompatibility complex) class II molecules, while CD8 is found on cytotoxic T cells, where it is required for the binding of MHC class I molecules.  CD4 contains four immunoglobulin domains, with the first three included in this hierarchy.  The fourth domain has a general Ig architecture, but has slight topological changes in the arrangement of beta strands relative to the other structures in this family and is not specifically included in the hierarchy.
Probab=97.60  E-value=0.00017  Score=44.45  Aligned_cols=31  Identities=19%  Similarity=0.289  Sum_probs=25.4

Q ss_pred             EEecCCCCeEEEEEEcccCCCeEEEEeCCCe
Q psy11558         29 IDFSNTTGAQVECTARGSPNPEIIWIRSDGT   59 (74)
Q Consensus        29 v~~~~g~~v~L~C~A~G~P~P~I~W~~~dG~   59 (74)
                      |....|+.|+|.|.++|.|.|.|.|++++..
T Consensus         2 v~~~~G~~VtL~C~~s~~~~~~i~W~~~~~k   32 (94)
T cd07690           2 VLGKKGDTAELPCTASQKKSIQFHWKNSNQI   32 (94)
T ss_pred             eEeeCCCCEEEEEEeCCCCCcEEEEEECCcE
Confidence            3455788899999999999999999875434


No 100
>cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4  (Necl-4, also known as cell adhesion molecule 4 (CADM4)). Ig2_Necl-4: second immunoglobulin (Ig)-like domain of nectin-like molecule-4  (Necl-4, also known as cell adhesion molecule 4 (CADM4)). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1-Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. Ig domains are likely to participate in ligand binding and recognition. Necl-4 is expressed on Schwann cells, and plays a key part in initiating peripheral nervous system (PNS) myelination.  In injured peripheral nerve cells, the mRNA signal for both Necl-4 and Necl-5 was observed to be elevated.  Necl-4 participates in cell-cell adhesion and is proposed to play a role in tumor suppression.
Probab=97.60  E-value=0.00011  Score=44.46  Aligned_cols=27  Identities=22%  Similarity=0.599  Sum_probs=22.9

Q ss_pred             eEEEEEEc-ccCCCeEEEEeCCCeeecCC
Q psy11558         37 AQVECTAR-GSPNPEIIWIRSDGTAVGDV   64 (74)
Q Consensus        37 v~L~C~A~-G~P~P~I~W~~~dG~~i~~~   64 (74)
                      +.|.|.+. |+|+|+|+|++ ||.+|...
T Consensus         2 ~~L~C~s~~skP~a~i~W~k-~~~~l~~~   29 (80)
T cd05885           2 VELTCLSPRSKPAATLRWYR-DRKELKGV   29 (80)
T ss_pred             EEEEEeCCCccCCCeEEEEE-CCEECCCC
Confidence            68999987 78999999997 88888654


No 101
>cd05761 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-4 (also known as cell adhesion molecules CADM3, CADM1, CADM2, and CADM4, respectively). Ig2_Necl-1-4_like: domain similar to the second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 (also known as cell adhesion molecule 3 (CADM3)), Necl-2 (CADM1), Necl-3 (CADM2) and Necl-4 (CADM4). These nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1 and Necl-2 have Ca(2+)-independent homophilic and heterophilic cell-cel
Probab=97.59  E-value=0.00012  Score=43.15  Aligned_cols=26  Identities=27%  Similarity=0.709  Sum_probs=21.7

Q ss_pred             eEEEEEEccc-CCCeEEEEeCCCeeecC
Q psy11558         37 AQVECTARGS-PNPEIIWIRSDGTAVGD   63 (74)
Q Consensus        37 v~L~C~A~G~-P~P~I~W~~~dG~~i~~   63 (74)
                      +.|.|.|.|. |.|+|+|++ ||..+..
T Consensus         2 ~~L~C~~~~~~P~~~v~W~~-~~~~l~~   28 (82)
T cd05761           2 VELTCTSSGSKPAATIRWFK-GDKELKG   28 (82)
T ss_pred             EEEEEEecCcCcCCeEEEEE-CCEEccC
Confidence            6899999875 999999996 6777653


No 102
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig6_Contactin-4: sixth Ig domain of the neural cell adhesion molecule contactin-4. Contactins are neural cell adhesion molecules, and are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The different contactins show different expression patterns in the central nervous system. Highest expresson of contactin-4 is in testes, thyroid, small intestine, uterus and brain. Contactin-4 plays a role in the response of neuroblastoma cells to differentiating agents, such as retinoids. The contactin 4 gene is associated with cerebellar degeneration in spinocerebellar ataxia type 16.
Probab=97.59  E-value=0.00018  Score=43.60  Aligned_cols=26  Identities=15%  Similarity=0.349  Sum_probs=22.6

Q ss_pred             CeEEEEEEcc--cCCCeEEEEeCCCeeec
Q psy11558         36 GAQVECTARG--SPNPEIIWIRSDGTAVG   62 (74)
Q Consensus        36 ~v~L~C~A~G--~P~P~I~W~~~dG~~i~   62 (74)
                      ++.|.|.|.+  ++.++|+|++ ||.+|.
T Consensus         2 ~~~l~C~v~~d~~l~~~~~W~~-dg~~i~   29 (85)
T cd05853           2 SIVLPCQVSHDHSLDIVFTWSF-NGHLID   29 (85)
T ss_pred             cEEEEEEeccCCCCCcEEEEEE-CCEECc
Confidence            5899999988  5599999996 899986


No 103
>cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2). Ig5_KIRREL3: the fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1). These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development. Neph1 and 2 may mediate axonal guidance and synapse formation in certain areas of the CNS. In the kidney, they participate in the formation of the slit diaphragm.
Probab=97.55  E-value=0.00036  Score=43.41  Aligned_cols=43  Identities=21%  Similarity=0.400  Sum_probs=30.5

Q ss_pred             cceEEEcCCCcEEecCCCCeEEEEEEcccCCCe-EEEEeCCCeeecC
Q psy11558         18 GPIFIKEPPNRIDFSNTTGAQVECTARGSPNPE-IIWIRSDGTAVGD   63 (74)
Q Consensus        18 ~P~fv~~Pp~~v~~~~g~~v~L~C~A~G~P~P~-I~W~~~dG~~i~~   63 (74)
                      +|.+..+  .......|+.+.|.|.|.+.|+|. |.|.. ++..|+.
T Consensus         2 pP~i~~~--~s~~~~~G~~~~L~C~~~s~P~P~~i~W~w-~~~~i~~   45 (98)
T cd05898           2 PPIISSE--QVQYAVRGERGKVKCFIGSTPPPDRIAWAW-KENVLES   45 (98)
T ss_pred             CCEEecC--ceEEEeCCCcEEEEEEEccCCCCcEEEEEE-ccccccC
Confidence            5666444  334466888999999999999885 68876 4555544


No 104
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1. Ig_Pro_neuregulin-1: immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1. There are many NRG-1 isoforms which arise from the alternative splicing of mRNA. NRG-1 belongs to the neuregulin gene family, which is comprised of four genes. This group represents NRG-1. NRGs are signaling molecules, which participate in cell-cell interactions in the nervous system, breast, and heart, and other organ systems, and are implicated in the pathology of diseases including schizophrenia, multiple sclerosis, and breast cancer. The NRG-1 protein binds to and activates the tyrosine kinases receptors ErbB3 and ErbB4, initiating signaling cascades. NRG-1 has multiple functions; for example, in the brain it regulates various processes such as radial glia formation and neuronal migration, dendritic development, and expression of neurotransmitters receptors; in the peripheral nervous system NRG-1 regulates process
Probab=97.53  E-value=0.00011  Score=42.11  Aligned_cols=26  Identities=19%  Similarity=0.638  Sum_probs=21.3

Q ss_pred             eEEEEEEcc-cCCCeEEEEeCCCeeecC
Q psy11558         37 AQVECTARG-SPNPEIIWIRSDGTAVGD   63 (74)
Q Consensus        37 v~L~C~A~G-~P~P~I~W~~~dG~~i~~   63 (74)
                      +.|.|.|.| .|.|+++|++ ||..+..
T Consensus         1 ~~L~C~a~~~~p~~~~~W~~-~g~~i~~   27 (76)
T cd05895           1 LVLRCETVSEYPSLRFKWFK-NGKEIGA   27 (76)
T ss_pred             CEEEEecccCCCCCceEEEE-CCccccc
Confidence            479999985 7899999997 7887753


No 105
>cd07705 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)). Ig2_Necl-1: second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)). These nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1 and Necl-2 have Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue and is important to the formation of synapses, axon bundles, and myel
Probab=97.50  E-value=0.00019  Score=42.80  Aligned_cols=26  Identities=31%  Similarity=0.718  Sum_probs=21.9

Q ss_pred             eEEEEEEccc-CCCeEEEEeCCCeeecC
Q psy11558         37 AQVECTARGS-PNPEIIWIRSDGTAVGD   63 (74)
Q Consensus        37 v~L~C~A~G~-P~P~I~W~~~dG~~i~~   63 (74)
                      +.|.|.|.|. |.++|+|++ ||..+..
T Consensus         2 ~~LtC~a~g~~P~~~ItW~k-~g~~l~~   28 (83)
T cd07705           2 AKLRCTSSGSKPAANIKWRK-GDQELEG   28 (83)
T ss_pred             EEEEEEecCccCCCEeEEEE-CCEECCC
Confidence            6899999996 999999996 7776654


No 106
>cd00098 IgC Immunoglobulin Constant domain. IgC: Immunoglobulin constant domain (IgC). Members of the IgC family are components of immunoglobulin, T-cell receptors, CD1 cell surface glycoproteins, secretory glycoproteins A/C, and Major Histocompatibility Complex (MHC) class I/II molecules. In immunoglobulins, each chain is composed of one variable domain (IgV) and one or more IgC domains. These names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. The IgV domain is responsible for antigen binding, and the IgC domain is involved in oligomerization and molecular interactions.
Probab=97.47  E-value=0.00022  Score=41.99  Aligned_cols=31  Identities=19%  Similarity=0.531  Sum_probs=24.8

Q ss_pred             CCCCeEEEEEEccc-C-CCeEEEEeCCCeeecCC
Q psy11558         33 NTTGAQVECTARGS-P-NPEIIWIRSDGTAVGDV   64 (74)
Q Consensus        33 ~g~~v~L~C~A~G~-P-~P~I~W~~~dG~~i~~~   64 (74)
                      .|..+.|.|.|.|. | .++|+|.+ ||..+...
T Consensus        12 ~~~~~~L~C~a~g~~P~~~~i~W~~-~g~~~~~~   44 (95)
T cd00098          12 LGGSVTLTCLATGFYPPDITVTWLK-NGKELTSG   44 (95)
T ss_pred             cCCCeEEEEEEeeEECCCcEEEEEE-CCEECCCc
Confidence            46679999999998 6 46899997 78876543


No 107
>PF00047 ig:  Immunoglobulin domain The Prosite family only concerns antibodies and MHCs.;  InterPro: IPR013151 Members of the immunoglobulin superfamily are found in hundreds of proteins of different functions. Examples include antibodies, the giant muscle kinase titin and receptor tyrosine kinases. Immunoglobulin-like domains may be involved in protein-protein and protein-ligand interactions. The Pfam alignments do not include the first and last strand of the immunoglobulin-like domain.; PDB: 1B6U_A 3O4O_C 3VH8_H 1BIH_A 2C9A_A 2V5Y_A 1BQH_K 2ATP_A 3B9K_A 1NEZ_H ....
Probab=97.44  E-value=0.00017  Score=39.65  Aligned_cols=27  Identities=15%  Similarity=0.582  Sum_probs=23.0

Q ss_pred             CCCeEEEEEE-cccCCCeEEEEeCCCee
Q psy11558         34 TTGAQVECTA-RGSPNPEIIWIRSDGTA   60 (74)
Q Consensus        34 g~~v~L~C~A-~G~P~P~I~W~~~dG~~   60 (74)
                      |+++.|.|.+ .+.|.+.++|.++++..
T Consensus         1 G~~v~L~C~~~~~~~~~~~~W~~~~~~~   28 (64)
T PF00047_consen    1 GSSVTLTCSVSSGPPPTTVTWSKNGQSL   28 (64)
T ss_dssp             TSEEEEEEEEEESSSTSEEEEEETTTTT
T ss_pred             CCeEEEEeecCCCCCCcEEEEEECCccc
Confidence            5679999999 99999999999866543


No 108
>cd05768 IgC_CH4 CH4 domain (fourth constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH4: The fourth immunoglobulin constant domain (IgC), of immunoglobulin (Ig) heavy chains. This domain is found on the Fc fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=97.40  E-value=0.00034  Score=43.40  Aligned_cols=36  Identities=25%  Similarity=0.622  Sum_probs=25.0

Q ss_pred             CCcEEecCCCCeEEEEEEcc-cCCC-eEEEEeCCCeeec
Q psy11558         26 PNRIDFSNTTGAQVECTARG-SPNP-EIIWIRSDGTAVG   62 (74)
Q Consensus        26 p~~v~~~~g~~v~L~C~A~G-~P~P-~I~W~~~dG~~i~   62 (74)
                      |.......+..++|.|.|+| .|+. +|+|.+ ||.++.
T Consensus         8 p~~~~~~~~~~~tL~C~a~gFyP~~i~v~W~k-~g~~~~   45 (102)
T cd05768           8 PPSEELSLQETATLTCLVKGFSPSDIFVKWLQ-NGQPLS   45 (102)
T ss_pred             cChHHhCcCCceEEEEEEeeEeCCCCEEEEEE-CCEECC
Confidence            33333444567999999999 5544 469996 787764


No 109
>PF08205 C2-set_2:  CD80-like C2-set immunoglobulin domain ;  InterPro: IPR013162 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents the C2-set type domains found in the T-cell antigen CD80, as well as in related proteins. CD80 (B7-1) is a glycoprotein expressed on antigen-presenting cells []. The shared ligands on CD80 and CD86 (B7-2) deliver the co-stimulatory signal through CD28 and CTLA-4 on T-cells, where CD28 augments the T-cell response and CTLA-4 attenuates it [].; PDB: 3S58_A 3O3U_N 3CJJ_A 3S59_A 2PF6_B 2PET_A 3ALP_A 3SKU_D 3U83_A 3U82_B ....
Probab=97.39  E-value=0.00041  Score=40.72  Aligned_cols=27  Identities=26%  Similarity=0.688  Sum_probs=20.3

Q ss_pred             CCCeEEEE-EEcccCCCeEEEEeCCCee
Q psy11558         34 TTGAQVEC-TARGSPNPEIIWIRSDGTA   60 (74)
Q Consensus        34 g~~v~L~C-~A~G~P~P~I~W~~~dG~~   60 (74)
                      |+.+.+.| ...|+|+|+|+|..+++..
T Consensus        14 ~~~~~~~C~s~~~~P~~~i~W~~~~~~~   41 (89)
T PF08205_consen   14 GEEVTLTCSSSGGYPPPQITWYLDGGPV   41 (89)
T ss_dssp             TEEEEEEEEEEEEBS-EEEEEEETTCEE
T ss_pred             ceEEEEEEEeCCeECCeEEEEEECCCce
Confidence            56799999 5568999999999754443


No 110
>cd05884 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)). Ig2_Necl-3: second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. Necl-3 has been shown to accumulate in tissues of the central and peripheral nervous system, where it is expressed in ependymal cells and myelinated axons.  It is observed at the interface between the axon shaft and the myelin sheath. Ig domains are likely to participate in ligand binding and recognition.
Probab=97.38  E-value=0.00033  Score=41.93  Aligned_cols=26  Identities=27%  Similarity=0.786  Sum_probs=22.0

Q ss_pred             eEEEEEEcc-cCCCeEEEEeCCCeeecC
Q psy11558         37 AQVECTARG-SPNPEIIWIRSDGTAVGD   63 (74)
Q Consensus        37 v~L~C~A~G-~P~P~I~W~~~dG~~i~~   63 (74)
                      +.|.|.|.| +|..+|+|++ ||..+..
T Consensus         2 ~~LtC~a~gf~P~~~itW~k-ng~~l~~   28 (83)
T cd05884           2 MQLTCKTSGSKPAADIRWFK-NDKEIKD   28 (83)
T ss_pred             EEEEEEeCCccCCCEEEEEE-CCEECcC
Confidence            689999998 8999999997 7877644


No 111
>cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs) and similar proteins. Ig2_FcgammaR_like: domain similar to the second immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs). Interactions between IgG and FcgammaR are important to the initiation of cellular and humoral response. IgG binding to FcgammaR leads to a cascade of signals and ultimately to functions such as antibody-dependent-cellular-cytotoxicity (ADCC), endocytosis, phagocytosis, release of inflammatory mediators, etc. FcgammaR has two Ig-like domains. This group also contains FcepsilonRI, which binds IgE with high affinity.
Probab=97.37  E-value=0.00057  Score=40.49  Aligned_cols=36  Identities=22%  Similarity=0.419  Sum_probs=27.1

Q ss_pred             CCCcEEecCCCCeEEEEEEc-ccCCCeEEEEeCCCeeec
Q psy11558         25 PPNRIDFSNTTGAQVECTAR-GSPNPEIIWIRSDGTAVG   62 (74)
Q Consensus        25 Pp~~v~~~~g~~v~L~C~A~-G~P~P~I~W~~~dG~~i~   62 (74)
                      +|..+ +.+|+.++|.|.+. |.|.+++.|.+ ||..+.
T Consensus         6 ~p~~~-V~~G~~vtL~C~~~~~~~~~~~~w~k-~g~~~~   42 (83)
T cd05753           6 VPSRV-VFEGEPLVLRCHGWKNKPVYKVTYYR-DGKAKK   42 (83)
T ss_pred             CCcce-ecCCCCEEEEeeCCCCCcceEEEEEE-CCeEcc
Confidence            34443 56788899999995 57888999997 666654


No 112
>cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain. IgV_TCR_beta: immunoglobulin (Ig) variable domain of the beta chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group includes the variable domain of the alpha chain of alpha/beta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor.  Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.
Probab=97.36  E-value=0.0013  Score=40.24  Aligned_cols=32  Identities=16%  Similarity=0.441  Sum_probs=26.8

Q ss_pred             CCCcEEecCCCCeEEEEEEcccCCCeEEEEeCC
Q psy11558         25 PPNRIDFSNTTGAQVECTARGSPNPEIIWIRSD   57 (74)
Q Consensus        25 Pp~~v~~~~g~~v~L~C~A~G~P~P~I~W~~~d   57 (74)
                      +|..+.+.+|+.++|.|.+.+ +.+.|.|++.+
T Consensus         4 ~p~~~~v~~G~~v~l~C~~~~-~~~~v~Wykq~   35 (110)
T cd05899           4 SPRYLIKGRGQSVTLRCSQTS-GHDNMYWYRQD   35 (110)
T ss_pred             CCCceEEcCCCcEEEEEEECC-CCCEEEEEEEC
Confidence            355566788999999999999 88999998753


No 113
>cd05769 IgC_TCR_beta T cell receptor (TCR) beta chain constant immunoglobulin domain. IgC_TCR_beta: Constant domain of the beta chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group includes the variable domain of the beta chain. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The antigen binding site is formed by the variable domains of the alpha and beta chains, located at the N-terminus of each chain. Alpha/beta TCRs recognize antigens differently from gamma/delta TCRs.
Probab=97.31  E-value=0.00046  Score=44.08  Aligned_cols=44  Identities=27%  Similarity=0.539  Sum_probs=30.6

Q ss_pred             cceEEEcCCCcEEecCCCCeEEEEEEcc-cCCC-eEEEEeCCCeeec
Q psy11558         18 GPIFIKEPPNRIDFSNTTGAQVECTARG-SPNP-EIIWIRSDGTAVG   62 (74)
Q Consensus        18 ~P~fv~~Pp~~v~~~~g~~v~L~C~A~G-~P~P-~I~W~~~dG~~i~   62 (74)
                      +|....-||+..++..++.++|.|.|.| .|.. +|+|++ ||..+.
T Consensus         2 ~P~V~v~~ps~~e~~~~~~~tL~Cla~gFyP~~I~V~W~k-ng~~l~   47 (115)
T cd05769           2 PPTVAIFPPSEAEIRNKRKATLVCLATGFYPDHVSLSWKV-NGKEVT   47 (115)
T ss_pred             CCEEEEECcChHHhccCCCcEEEEEEEeEeCCCcEEEEEE-CCEECC
Confidence            3544444666655555556999999999 5764 889997 777654


No 114
>PF13927 Ig_3:  Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C ....
Probab=97.30  E-value=0.00028  Score=38.79  Aligned_cols=35  Identities=31%  Similarity=0.692  Sum_probs=27.4

Q ss_pred             cceEEEcCCCcEEecCCCCeEEEEEEcccC-CCeEEEE
Q psy11558         18 GPIFIKEPPNRIDFSNTTGAQVECTARGSP-NPEIIWI   54 (74)
Q Consensus        18 ~P~fv~~Pp~~v~~~~g~~v~L~C~A~G~P-~P~I~W~   54 (74)
                      +|.+...+...+ ...++ +.|.|.|.|.| .++++|.
T Consensus         1 kP~I~~~~~~~~-~~~~~-~~l~C~~~~~~~~~~~~W~   36 (75)
T PF13927_consen    1 KPQISVPPPPVV-TSGGS-VTLTCSAEGGPPPPSISWY   36 (75)
T ss_dssp             ESEEEEESTSEE-ETTEE-EEEEEEESSEESSEEEEEE
T ss_pred             CCEEEEcCCCcE-eecee-EEEEEEEccccCCeEEEEE
Confidence            477777766554 33333 99999999999 9999999


No 115
>KOG4221|consensus
Probab=97.29  E-value=0.00021  Score=60.46  Aligned_cols=46  Identities=24%  Similarity=0.546  Sum_probs=37.9

Q ss_pred             CccceEEEcCCCcEEecCCCCeEEEEEEcccCCCeEEEEeCCCeeecC
Q psy11558         16 TLGPIFIKEPPNRIDFSNTTGAQVECTARGSPNPEIIWIRSDGTAVGD   63 (74)
Q Consensus        16 ~~~P~fv~~Pp~~v~~~~g~~v~L~C~A~G~P~P~I~W~~~dG~~i~~   63 (74)
                      ..+|.|+..|...+ .-++.++.|.|.++|.|.|+++|++ ||..+..
T Consensus       326 ~a~P~~~~~p~~l~-A~e~~die~ec~~~g~p~p~v~w~k-Ngd~~ip  371 (1381)
T KOG4221|consen  326 LAPPGFTKAPTTLV-AHESMDIEFECPVSGKPIPTVRWYK-NGDRIIP  371 (1381)
T ss_pred             EcCCCCCCCCccee-eeeccceeEeCCCCCCCcceEEEEe-cCcccCc
Confidence            56899999976655 4457789999999999999999996 7877655


No 116
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain. IgC_Tapasin_R: Immunoglobulin-like domain on Tapasin-R. Tapasin is a V-C1 (variable-constant) immunoglobulin superfamily molecule present in the endoplasmic reticulum (ER), where it links MHC class I molecules to the transporter associated with antigen processing (TAP). Tapasin-R is a tapasin-related protein that contains similar structural motifs to Tapasin, with some marked differences, especially in the V domain, transmembrane and cytoplasmic regions. The majority of Tapasin-R is located within the ER; however, there may be some expression of Tapasin-R at the cell surface. Tapasin-R lacks an obvious ER retention signal.
Probab=97.28  E-value=0.0011  Score=42.23  Aligned_cols=40  Identities=15%  Similarity=0.142  Sum_probs=27.1

Q ss_pred             ccceEEEcCCCcEEecCCCCeEEEEEEccc-CC-CeEEEEeCC
Q psy11558         17 LGPIFIKEPPNRIDFSNTTGAQVECTARGS-PN-PEIIWIRSD   57 (74)
Q Consensus        17 ~~P~fv~~Pp~~v~~~~g~~v~L~C~A~G~-P~-P~I~W~~~d   57 (74)
                      .+|.....|... ....|..++|.|.|.|. |+ ++|+|++++
T Consensus        37 ~~P~v~~~~~~~-~~~~~~~~~L~C~a~g~~P~~~~i~W~~~g   78 (139)
T cd05771          37 EPPRVRLSLEKL-VSMIEEPQTLICHIAGYYPLDVQVEWTREP   78 (139)
T ss_pred             cCCceEEeCCCc-eeecCCcEEEEEEECCCCCCCeEEEEEECC
Confidence            456665554433 23356679999999996 54 489999743


No 117
>cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins. IgV_TCR_alpha: immunoglobulin (Ig) variable domain of the alpha chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group represents the variable domain of the alpha chain of TCRs and also includes the variable domain of delta chains of TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor.  Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.
Probab=97.28  E-value=0.00066  Score=40.97  Aligned_cols=33  Identities=15%  Similarity=0.413  Sum_probs=28.7

Q ss_pred             cCCCcEEecCCCCeEEEEEEcccCCCeEEEEeC
Q psy11558         24 EPPNRIDFSNTTGAQVECTARGSPNPEIIWIRS   56 (74)
Q Consensus        24 ~Pp~~v~~~~g~~v~L~C~A~G~P~P~I~W~~~   56 (74)
                      .+|..+....|++|.|.|.+.+.+.+.+.|++.
T Consensus         3 q~~~~v~~~~G~~v~L~C~~~~~~~~~v~W~k~   35 (109)
T cd04983           3 QSPQSLSVQEGENVTLNCNYSTSTFYYLFWYRQ   35 (109)
T ss_pred             ecCCceEEcCCCCEEEEEEECCCCccEEEEEEE
Confidence            456677788999999999999999999999974


No 118
>cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin. Ig_Semaphorin_class III; Immunoglobulin (Ig)-like domain of class III semaphorins. Semaphorins are classified into various classes on the basis of structural features additional to the Sema domain. Class III semaphorins are a vertebrate class having a Sema domain, an Ig domain, a short basic domain, and are secreted. They have been shown to be axonal guidance cues and have a part in the regulation of the cardiovascular, immune and respiratory systems. Sema3A, the prototype member of this class III subfamily, induces growth cone collapse and is an inhibitor of axonal sprouting. In perinatal rat cortex as a chemoattractant, it functions to direct, for pyramidal neurons, the orientated extension of apical dendrites. It may play a role, prior to the development of apical dendrites, in signaling the radial migration of newborn cortical neurons towards the upper layers. Sema3A selectively inhibits vascula
Probab=97.18  E-value=0.00069  Score=40.98  Aligned_cols=27  Identities=19%  Similarity=0.436  Sum_probs=22.3

Q ss_pred             EEecCCCCeEEEEEEcccCCCeEEEEeC
Q psy11558         29 IDFSNTTGAQVECTARGSPNPEIIWIRS   56 (74)
Q Consensus        29 v~~~~g~~v~L~C~A~G~P~P~I~W~~~   56 (74)
                      +...+|+.+.|+|.+ +.|.|.|+|++.
T Consensus         6 ~~~~eG~~v~L~C~~-~~p~p~v~Wykq   32 (91)
T cd05871           6 VYGVENNSTFLECLP-KSPQASVKWLFQ   32 (91)
T ss_pred             EEEecCCcEEEEEEC-CCCCceEEEEEE
Confidence            345578889999997 699999999973


No 119
>KOG4222|consensus
Probab=97.18  E-value=0.00034  Score=58.94  Aligned_cols=45  Identities=20%  Similarity=0.482  Sum_probs=37.7

Q ss_pred             CccceEEEcCCCcEEecCCCCeEEEEEEcccCCCeEEEEeCCCeee
Q psy11558         16 TLGPIFIKEPPNRIDFSNTTGAQVECTARGSPNPEIIWIRSDGTAV   61 (74)
Q Consensus        16 ~~~P~fv~~Pp~~v~~~~g~~v~L~C~A~G~P~P~I~W~~~dG~~i   61 (74)
                      ..+|.|...|.++.... |+.++|+|.+.|+|+|.+.|+++++..+
T Consensus       313 ~apP~f~kkp~dq~v~l-g~~vt~pc~~~gnP~PavfW~keg~q~l  357 (1281)
T KOG4222|consen  313 QAPPSFGKKPRDQKVAL-GGTVTFPCETLGNPPPAVFWLKEGSQDL  357 (1281)
T ss_pred             ecCcccccccCcccccc-CceEEeeeecCCCCCcceEEeccCccee
Confidence            57889999988776554 4569999999999999999998777654


No 120
>cd05772 IgC_SIRP Signal-regulatory protein (SIRP) immunoglobulin-like domain. IgC_SIRP: Immunoglobulin-like domain of signal-regulatory proteins (SIRP); the signal-regulatory proteins (SIRP) are Ig-like cell surface receptors detected in hematopoietic and non-hematopoietic cells. While their extracellular domains are similar, SIRP are classified as alpha or beta based on the length of the intracytoplasmic domain.  Those having a 110- to 113-amino acid tail are classified as SIRP-alpha, and those having a 5-amino acid tail as SIRP-beta. SIRP-alpha and SIRP-beta molecules are thought to have complementary roles in signal regulation:  SIRP-alpha inhibit signalling via their immunoreceptor tyrosine (IT)-based inhibition motifs while SIRP-beta are activating.  SIRP-beta lack the cytoplasmic domainof SIRP-alpha, and associate with at least one other transmembrane protein (DAP-12 or KARAP). The IT-based activation motifs within DAP-12's cytoplasmic domain may link SIRP-beta to the activating 
Probab=97.17  E-value=0.001  Score=42.05  Aligned_cols=31  Identities=23%  Similarity=0.667  Sum_probs=24.2

Q ss_pred             cCCCCeEEEEEEcc-cCC-CeEEEEeCCCeeecC
Q psy11558         32 SNTTGAQVECTARG-SPN-PEIIWIRSDGTAVGD   63 (74)
Q Consensus        32 ~~g~~v~L~C~A~G-~P~-P~I~W~~~dG~~i~~   63 (74)
                      ..|..++|.|.|.| .|+ -+|+|++ ||..+..
T Consensus        19 ~~g~~~tL~C~a~gF~P~~i~v~W~k-ng~~~~~   51 (111)
T cd05772          19 NPGQSVNFTCSAHGFSPRDITVKWLK-NGNELSA   51 (111)
T ss_pred             CCCCCEEEEEEEeeEeCCCCEEEEEE-CCEECcc
Confidence            35566999999999 564 5899997 8888653


No 121
>cd07698 IgC_MHC_I_alpha3 Class I major histocompatibility complex (MHC) alpha chain immunoglobulin domain. IgC_MHC_I_alpha3;  Immunoglobulin (Ig) domain of major histocompatibility complex (MHC) class I alpha chain. Class I MHC proteins bind antigenic peptide fragments and present them to CD8+ T lymphocytes.  Class I molecules consist of a transmembrane alpha chain and a small chain called the beta2 microglobulin. The alpha chain contains three extracellular domains, two of which fold together to form the peptide-binding cleft (alpha1 and alpha2), and one which has an Ig fold (alpha3).  Peptide binding to class I molecules occurs in the endoplasmic reticulum (ER) and involves both chaperones and dedicated factors to assist in peptide loading.  Class I MHC molecules are expressed on most nucleated cells.
Probab=97.13  E-value=0.0015  Score=39.25  Aligned_cols=25  Identities=36%  Similarity=0.846  Sum_probs=20.0

Q ss_pred             CCCeEEEEEEccc-CCC-eEEEEeCCCe
Q psy11558         34 TTGAQVECTARGS-PNP-EIIWIRSDGT   59 (74)
Q Consensus        34 g~~v~L~C~A~G~-P~P-~I~W~~~dG~   59 (74)
                      ++.+.|.|.|.|- |++ +|+|++ ||.
T Consensus        14 ~~~~~L~C~a~gF~P~~i~v~W~~-~g~   40 (93)
T cd07698          14 DGSLTLSCHATGFYPRDIEVTWLR-DGE   40 (93)
T ss_pred             CCcEEEEEEEEEEeCCCcEEEEEE-CCE
Confidence            4569999999995 655 899997 564


No 122
>cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain. IgV_L_kappa: Immunoglobulin (Ig) light chain, kappa type, variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=97.10  E-value=0.004  Score=37.80  Aligned_cols=34  Identities=21%  Similarity=0.447  Sum_probs=27.5

Q ss_pred             EEcCCCcEEecCCCCeEEEEEEcccC-CCeEEEEeC
Q psy11558         22 IKEPPNRIDFSNTTGAQVECTARGSP-NPEIIWIRS   56 (74)
Q Consensus        22 v~~Pp~~v~~~~g~~v~L~C~A~G~P-~P~I~W~~~   56 (74)
                      .+. |..+...+|++|+|.|.+.+.+ ...+.|++.
T Consensus         4 ~Q~-p~~~~v~~G~~v~L~C~~~~~~~~~~~~Wyrq   38 (106)
T cd04980           4 TQS-PATLSVSPGESATISCKASQSVSSNYLAWYQQ   38 (106)
T ss_pred             EEC-CCcEEECCCCCEEEEEEECCCCCCCcEEEEEE
Confidence            455 4555678899999999999887 788999874


No 123
>cd07699 IgC_L Immunoglobulin Constant domain. IgC_L: Immunoglobulin (Ig) light chain constant (C) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=97.04  E-value=0.0012  Score=40.60  Aligned_cols=43  Identities=23%  Similarity=0.466  Sum_probs=29.2

Q ss_pred             ceEEEcCCCcEEecCCCCeEEEEEEcc-cC-CCeEEEEeCCCeeec
Q psy11558         19 PIFIKEPPNRIDFSNTTGAQVECTARG-SP-NPEIIWIRSDGTAVG   62 (74)
Q Consensus        19 P~fv~~Pp~~v~~~~g~~v~L~C~A~G-~P-~P~I~W~~~dG~~i~   62 (74)
                      |.....||.......+..++|.|.|.| .| .-+|+|++ ||..+.
T Consensus         2 P~V~v~~p~~~~~~~~~~~~L~C~~~gfyP~~i~v~W~~-~g~~~~   46 (100)
T cd07699           2 PSVTIFPPSSEELEKSGKATLVCLINDFYPGFATVQWKV-DGATVS   46 (100)
T ss_pred             CeEEEECCCHHHHccCCCcEEEEEEEeEECCCCEEEEEE-CCEECc
Confidence            433344444433434556999999999 67 66789996 888764


No 124
>cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins. Ig2_IL1R_like: domain similar to the second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R).  IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three IG-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta. This group also contains ILIR-like 1 (IL1
Probab=97.04  E-value=0.001  Score=40.52  Aligned_cols=33  Identities=18%  Similarity=0.441  Sum_probs=25.9

Q ss_pred             ecCCCCeEEEEEEccc-----CCCeEEEEeCCCeeecCC
Q psy11558         31 FSNTTGAQVECTARGS-----PNPEIIWIRSDGTAVGDV   64 (74)
Q Consensus        31 ~~~g~~v~L~C~A~G~-----P~P~I~W~~~dG~~i~~~   64 (74)
                      ...|++++|.|.+.+.     |.|+|+|++ ||.++...
T Consensus         7 ~~~g~~~~l~Cp~~~~~~~~~~~p~i~Wyk-~~~~i~~~   44 (92)
T cd05757           7 LFSTKGGKIVCPDLDDFKNENTLPPVQWYK-DCKLLEGD   44 (92)
T ss_pred             EeeccCCEEECCChHHccCCCCCCcEEEeE-CCEECCCC
Confidence            4467789999998763     689999996 88887643


No 125
>cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain. IgV_TCR_gamma: immunoglobulin (Ig) variable (V) domain of the gamma chain of gamma/delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha/beta TCRs but a small subset contain gamma/delta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma/delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma/delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds. The variable domain of gamma/delta TCRs is responsible for antigen recognition and is
Probab=96.99  E-value=0.0044  Score=38.01  Aligned_cols=31  Identities=19%  Similarity=0.407  Sum_probs=26.4

Q ss_pred             CCcEEecCCCCeEEEEEEcc--cCCCeEEEEeC
Q psy11558         26 PNRIDFSNTTGAQVECTARG--SPNPEIIWIRS   56 (74)
Q Consensus        26 p~~v~~~~g~~v~L~C~A~G--~P~P~I~W~~~   56 (74)
                      |..+....|+.+.|.|.+.+  .+.+.+.|++.
T Consensus         5 p~~~~~~~G~~v~l~C~~~~~~~~~~~v~Wyrq   37 (116)
T cd04982           5 QLSITREESKSVTISCKVSGIDFSTTYIHWYRQ   37 (116)
T ss_pred             CCeEEeCCCCCEEEEEEEeCCCccccEEEEEEE
Confidence            45556778889999999998  78999999985


No 126
>cd05766 IgC_MHC_II_beta Class II major histocompatibility complex (MHC) beta chain immunoglobulin domain. IgC_MHC_II_beta: Immunoglobulin (Ig) domain of major histocompatibility complex (MHC) class II beta chain.  MHC class II molecules play a key role in the initiation of the antigen-specific immune reponse. In both humans and in mice these molecules have been shown to be expressed constitutively on the cell surface of professional antigen-presenting cells (APCs), for example on B-lymphocytes, monocytes, and macrophages. The expression of these molecules has been shown to be induced in nonprofessional APCs such as keratinocyctes, and they are expressed on the surface of activated human T cells and on T cells from other species. The MHC II molecules present antigenic peptides to CD4(+) T-lymphocytes. These peptides derive mostly from protelytic processing via the endocytic pathway, of antigens internalized by the APC. These peptides bind to the MHC class II molecules in the endosome be
Probab=96.98  E-value=0.0029  Score=38.57  Aligned_cols=30  Identities=17%  Similarity=0.468  Sum_probs=23.9

Q ss_pred             CCCCeEEEEEEcc-cCCC-eEEEEeCCCeeecC
Q psy11558         33 NTTGAQVECTARG-SPNP-EIIWIRSDGTAVGD   63 (74)
Q Consensus        33 ~g~~v~L~C~A~G-~P~P-~I~W~~~dG~~i~~   63 (74)
                      .+..++|.|.|.| .|+. +++|.+ ||+.+..
T Consensus        13 ~~~~~~L~C~~~gFyP~~i~v~W~~-~g~~~~~   44 (94)
T cd05766          13 LSHPHLLVCHVWGFYPPEITVKWFK-NGQEETE   44 (94)
T ss_pred             CCCCeEEEEEEeeecCCCCEEEEEE-CCeecCC
Confidence            3567999999999 7866 789996 8877644


No 127
>cd05883 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)). Ig2_Necl-2: second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)). Nectin-like molecules (Necls) have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. Necl-2 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is expressed in a wide variety of tissues, and is a putative tumour suppressor gene, which is downregulated in aggressive neuroblastoma. Ig domains are likely to participate in ligand binding and recognition.
Probab=96.96  E-value=0.0015  Score=39.62  Aligned_cols=26  Identities=23%  Similarity=0.607  Sum_probs=21.4

Q ss_pred             eEEEEEEcc-cCCCeEEEEeCCCeeecC
Q psy11558         37 AQVECTARG-SPNPEIIWIRSDGTAVGD   63 (74)
Q Consensus        37 v~L~C~A~G-~P~P~I~W~~~dG~~i~~   63 (74)
                      +.|.|.+.| .|.++|+|.+ ||.++..
T Consensus         2 ~~L~C~s~gSkP~A~I~W~k-~~~~l~~   28 (82)
T cd05883           2 IELNCTAMASKPAATIRWFK-GNKELTG   28 (82)
T ss_pred             EEEEEEecCCCCCCEEEEEE-CCEECcC
Confidence            689999986 5999999996 7777654


No 128
>cd05755 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like domain of  intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins. Ig2_ ICAM-1_like: domain similar to the second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule-1 (ICAM-1, CD54). During the inflammation process, these molecules recruit leukocytes onto the vascular endothelium before extravasation to the injured tissues. ICAM-1 may be involved in organ targeted tumor metastasis. The interaction of ICAM-1 with leukocyte function-associated antigen-1 (LFA-1) plays a part in leukocyte-endothelial cell recognition. This group also contains ICAM-2, which also interacts with LFA-1. Transmigration of immature dendritic cells across resting endothelium is dependent on the interaction of ICAM-2 with, yet unidentified, ligand(s) on the dendritic cells. ICAM-1 has five Ig-like domains and ICAM-2 has two. ICAM-1 may also act as host receptor for viruses and parasites.
Probab=96.71  E-value=0.006  Score=38.20  Aligned_cols=31  Identities=13%  Similarity=0.451  Sum_probs=25.0

Q ss_pred             cCCCCeEEEEEEcc-cCCCe--EEEEeCCCeeecC
Q psy11558         32 SNTTGAQVECTARG-SPNPE--IIWIRSDGTAVGD   63 (74)
Q Consensus        32 ~~g~~v~L~C~A~G-~P~P~--I~W~~~dG~~i~~   63 (74)
                      .+|....|.|.+.| .|.++  |+|++ ++..+..
T Consensus        14 ~eG~~~tL~C~v~g~~P~a~L~i~W~r-G~~~l~~   47 (100)
T cd05755          14 PVGKNYTLQCDVPGVAPRQNLTVVLLR-GNETLSR   47 (100)
T ss_pred             cCCCcEEEEEEEcCcCCCCcEEEEEee-CCEEccc
Confidence            57888999999997 78887  79997 6666654


No 129
>cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B. Ig_Sema4B_like; Immunoglobulin (Ig)-like domain of Sema4B_like. Sema4B is a Class IV semaphorin. Semaphorins are classified based on structural features additional to the Sema domain. Sema4B has extracellular Sema and Ig domains, a transmembrane domain and a short cytoplasmic domain. Sema4B has been shown to preferentially regulate the development of the postsynaptic specialization at the glutamatergic synapses. This cytoplasmic domain includes a PDZ-binding motif upon which the synaptic localization of Sem4B is dependent. Sema4B is a ligand of CLCP1, CLCP1 was identified in an expression profiling analysis, which compared a highly metastic lung cancer subline with its low metastic parental line. Sema4B was shown to promote CLCP1 endocytosis, and their interaction is a potential target for therapeutic intervention of metastasis.
Probab=96.71  E-value=0.0034  Score=38.13  Aligned_cols=35  Identities=14%  Similarity=0.383  Sum_probs=28.1

Q ss_pred             CcEEecCCCCeEEEEEEcccCCCeEEEEeCCCeeecC
Q psy11558         27 NRIDFSNTTGAQVECTARGSPNPEIIWIRSDGTAVGD   63 (74)
Q Consensus        27 ~~v~~~~g~~v~L~C~A~G~P~P~I~W~~~dG~~i~~   63 (74)
                      ..+.+..|+++.|.|...+. ..+++|.+ ||.++..
T Consensus         4 ~~~tv~~g~~v~L~C~~~s~-~A~v~W~~-ng~~l~~   38 (85)
T cd05872           4 KNRTVAPGADVVLPCQLRSN-LASPVWLF-NGTPLNA   38 (85)
T ss_pred             eEEEEecCCCEEEECCCCCC-CccEEEEE-CCcccCC
Confidence            34566778899999999995 77999997 7877754


No 130
>smart00407 IGc1 Immunoglobulin C-Type.
Probab=96.67  E-value=0.0035  Score=36.23  Aligned_cols=24  Identities=33%  Similarity=0.786  Sum_probs=19.8

Q ss_pred             eEEEEEEccc-CC-CeEEEEeCCCeee
Q psy11558         37 AQVECTARGS-PN-PEIIWIRSDGTAV   61 (74)
Q Consensus        37 v~L~C~A~G~-P~-P~I~W~~~dG~~i   61 (74)
                      ++|.|.|.|. |+ .+|+|++ ||.++
T Consensus         2 ~~L~C~a~gf~P~~i~v~W~k-~g~~~   27 (75)
T smart00407        2 ATLVCLVSGFYPPDITVTWLR-NGQEV   27 (75)
T ss_pred             eEEEEEEEeEeCCCCEEEEEE-CCEEC
Confidence            6899999996 55 6999997 78763


No 131
>cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)). Ig1_Necl-2: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-2, Necl-2 (also known as cell adhesion molecule 1 (CADM1), SynCAM1, IGSF4A, Tslc1, sgIGSF, and RA175).  Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region, belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-2 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-2 is expressed in a wide variety of tissues, and is a 
Probab=96.54  E-value=0.0091  Score=36.86  Aligned_cols=35  Identities=9%  Similarity=0.242  Sum_probs=29.1

Q ss_pred             CCcEEecCCCCeEEEEEEcccCCCeEEEEeCCCee
Q psy11558         26 PNRIDFSNTTGAQVECTARGSPNPEIIWIRSDGTA   60 (74)
Q Consensus        26 p~~v~~~~g~~v~L~C~A~G~P~P~I~W~~~dG~~   60 (74)
                      -+.+...+|+++.|.|.+++.....+.|++.+...
T Consensus         4 ~~nvtv~~G~ta~L~C~v~~~~~~~v~w~~~~~~~   38 (95)
T cd05881           4 TEDVTVVEGEVAIISCRVKNNDDSVIQLLNPNRQT   38 (95)
T ss_pred             cCceEEcCCCcEEEEEEEccCCccEEEEEecCCcE
Confidence            35577889999999999999999999999766443


No 132
>PF07654 C1-set:  Immunoglobulin C1-set domain;  InterPro: IPR003597 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents C1-set domains, which are classical Ig-like domains resembling the antibody constant domain. C1-set domains are found almost exclusively in molecules involved in the immune system, such as in immunoglobulin light and heavy chains, in the major histocompatibility complex (MHC) class I and II complex molecules [, ], and in various T-cell receptors.; PDB: 3BVN_D 3BXN_A 3PWV_E 3L9R_F 2XFX_B 1BMG_A 1K8I_A 3M1B_G 3M17_C 1EXU_A ....
Probab=96.42  E-value=0.0036  Score=36.66  Aligned_cols=29  Identities=21%  Similarity=0.673  Sum_probs=22.8

Q ss_pred             CCCeEEEEEEcc-cCCC-eEEEEeCCCeeecC
Q psy11558         34 TTGAQVECTARG-SPNP-EIIWIRSDGTAVGD   63 (74)
Q Consensus        34 g~~v~L~C~A~G-~P~P-~I~W~~~dG~~i~~   63 (74)
                      +..+.|.|.|.| .|.. +|+|.+ ||..+..
T Consensus         8 ~~~~~L~C~v~~f~P~~i~v~W~~-~~~~~~~   38 (83)
T PF07654_consen    8 GGSVTLTCLVSGFYPKDITVTWLK-NGKEVTE   38 (83)
T ss_dssp             TSEEEEEEEEEEEBSSTEEEEEEE-TTEEETT
T ss_pred             CCCEEEEEEEEEEECCCcEEEEEe-ccceeee
Confidence            556999999999 6766 699986 7876643


No 133
>cd07696 IgC_CH3 CH3 domain (third constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH3: The third immunoglobulin constant domain (IgC) of immunoglobulin (Ig) heavy chains. This domain is found on the Fc fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=96.29  E-value=0.0056  Score=37.63  Aligned_cols=35  Identities=20%  Similarity=0.511  Sum_probs=24.5

Q ss_pred             CCcEEecCCCCeEEEEEEccc--C-CCeEEEEeCCCee
Q psy11558         26 PNRIDFSNTTGAQVECTARGS--P-NPEIIWIRSDGTA   60 (74)
Q Consensus        26 p~~v~~~~g~~v~L~C~A~G~--P-~P~I~W~~~dG~~   60 (74)
                      |+.-++..+..++|.|.|.|-  | .=+|+|++++|..
T Consensus         6 Ps~~~l~~~~~~tLtC~v~gf~yP~~i~v~W~r~~~~~   43 (96)
T cd07696           6 PSPKQLLLTKSVKLTCLVTNLTSPEGVNVTWTRGSGEP   43 (96)
T ss_pred             cCHHHhccCCCeEEEEEEeCCCCCCCcEEEEEECCeEe
Confidence            333334456679999999999  5 4457999865554


No 134
>cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R). IG1_VEGFR: first immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGF_A interacts with both VEGFR-1 and VEGFR-2. VEGFR-1 binds strongest to VEGF, VEGF-2 binds more weakly. VEGFR-3 appears not to bind VEGF, but binds other members of the VEGF family (VEGF-C and -D). VEGFRs bind VEGFs with high affinity with the IG-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-2 is a major mediator of the mitogenic, angioge
Probab=96.28  E-value=0.0075  Score=35.82  Aligned_cols=26  Identities=23%  Similarity=0.354  Sum_probs=20.3

Q ss_pred             CCCeEEEEEEcccCCC--eEEEEeCCCe
Q psy11558         34 TTGAQVECTARGSPNP--EIIWIRSDGT   59 (74)
Q Consensus        34 g~~v~L~C~A~G~P~P--~I~W~~~dG~   59 (74)
                      |+.++|.|.|.|+|.|  .++|..+++.
T Consensus         1 Ge~~~L~C~~~~~~~~~~~~~W~~p~~~   28 (86)
T cd05862           1 GEKLVLNCTARTELNVGIDFQWDYPGKK   28 (86)
T ss_pred             CCcEEEEEEEEeCCCCcEEEEEEcCCcc
Confidence            5679999999998755  6799875543


No 135
>KOG4194|consensus
Probab=96.04  E-value=0.0052  Score=49.91  Aligned_cols=42  Identities=21%  Similarity=0.435  Sum_probs=31.4

Q ss_pred             ccceEEEcCCCcEEecCCCCeEEEEEEcccCC-CeEEEEeCCCe
Q psy11558         17 LGPIFIKEPPNRIDFSNTTGAQVECTARGSPN-PEIIWIRSDGT   59 (74)
Q Consensus        17 ~~P~fv~~Pp~~v~~~~g~~v~L~C~A~G~P~-P~I~W~~~dG~   59 (74)
                      +.|.|..-.... .+..|+.++|.|.|.|.|. |.+.|++.|+.
T Consensus       705 e~p~f~~PL~~~-~V~~get~vlqC~a~~~~a~pr~~W~k~d~p  747 (873)
T KOG4194|consen  705 ETPSFSIPLEDQ-LVVVGETLVLQCLAEGAPADPRLEWFKEDKP  747 (873)
T ss_pred             cCCcccccccce-EEEecceEEEEEecCCCCCCccccccCCCCc
Confidence            445555443333 4567888999999999998 99999986664


No 136
>cd05847 IgC_CH2_IgE CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin E (IgE). IgC_CH2_IgE: The second constant domain of the heavy chain of immunoglobulin E (IgE). The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma, and mu, all consisting of a variable domain (VH) and three (in alpha, delta, and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). The different classes of antibodies vary in their heavy chains; the IgE class has the epsilon type. This domain (Cepsilon2) of IgE is in place of the flexible hinge region found in IgG.
Probab=95.99  E-value=0.012  Score=35.99  Aligned_cols=27  Identities=30%  Similarity=0.672  Sum_probs=21.3

Q ss_pred             CCCeEEEEEEcc-cCC-CeEEEEeCCCeee
Q psy11558         34 TTGAQVECTARG-SPN-PEIIWIRSDGTAV   61 (74)
Q Consensus        34 g~~v~L~C~A~G-~P~-P~I~W~~~dG~~i   61 (74)
                      +..+.|.|.|.| .|. =+|+|.+ ||..+
T Consensus        14 ~~~~~L~C~a~gFyP~~I~vtW~~-dg~~~   42 (94)
T cd05847          14 SETIQLLCLISGYTPGTIEVEWLV-DGQVA   42 (94)
T ss_pred             CCCEEEEEEEEeEECCCCEEEEEE-CCEEC
Confidence            345999999999 664 5689996 78775


No 137
>PHA02826 IL-1 receptor-like protein; Provisional
Probab=95.87  E-value=0.011  Score=41.43  Aligned_cols=32  Identities=13%  Similarity=0.268  Sum_probs=26.1

Q ss_pred             CCcEEecCCCCeEEEEEEcccCCC-----------eEEEEeCC
Q psy11558         26 PNRIDFSNTTGAQVECTARGSPNP-----------EIIWIRSD   57 (74)
Q Consensus        26 p~~v~~~~g~~v~L~C~A~G~P~P-----------~I~W~~~d   57 (74)
                      ...+.+.+|+++.|.|.+.|.|+|           +|.|.+.|
T Consensus        29 ~~~~~v~eGe~v~L~C~~~~~~~~~~~~~~~~~~~~V~W~k~~   71 (227)
T PHA02826         29 LTPVYAKFGDPMVLLCTGKHYKKSIFFDKTFITSYNVTWSKTD   71 (227)
T ss_pred             cceEEecCCCCEEEEccccccccccccccccCCCccEEEEeCC
Confidence            455667789999999999997655           99999854


No 138
>cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain. IgV_L_lambda: Immunoglobulin (Ig) light chain, lambda type, variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=95.80  E-value=0.036  Score=33.05  Aligned_cols=27  Identities=15%  Similarity=0.378  Sum_probs=22.5

Q ss_pred             ecCCCCeEEEEEEccc--CCCeEEEEeCC
Q psy11558         31 FSNTTGAQVECTARGS--PNPEIIWIRSD   57 (74)
Q Consensus        31 ~~~g~~v~L~C~A~G~--P~P~I~W~~~d   57 (74)
                      +..|++|+|.|.+++.  ....|.|++.+
T Consensus         3 v~~G~~v~l~C~~~~~~~~~~~i~Wy~q~   31 (98)
T cd04984           3 VSPGETVTITCTGSSGNISGNYVNWYQQK   31 (98)
T ss_pred             cCCCCCEEEEEEEcCCCcCCCCEEEEEEC
Confidence            5678899999999986  67889998753


No 139
>cd00099 IgV Immunoglobulin variable domain (IgV). IgV: Immunoglobulin variable domain (IgV). Members of the IgV family are components of immunoglobulin (Ig) and T cell receptors. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. Within the variable domain, there are regions of even more variability called the hypervariable or complementarity-determining regions (CDRs) which are responsible for antigen binding. A predominant feature of most Ig domains is the disulfide bridge connecting 2 beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=95.72  E-value=0.021  Score=33.79  Aligned_cols=28  Identities=29%  Similarity=0.534  Sum_probs=23.7

Q ss_pred             EecCCCCeEEEEEEccc-CCCeEEEEeCC
Q psy11558         30 DFSNTTGAQVECTARGS-PNPEIIWIRSD   57 (74)
Q Consensus        30 ~~~~g~~v~L~C~A~G~-P~P~I~W~~~d   57 (74)
                      .+..|+.+.|.|.+.+. +...+.|.+.+
T Consensus         2 ~v~~G~~v~L~C~~~~~~~~~~v~W~k~~   30 (105)
T cd00099           2 SVSEGESVTLSCTYSGSFSSYYIFWYRQK   30 (105)
T ss_pred             eecCCCCEEEEEEEeCCcCcceEEEEEEC
Confidence            35678889999999998 88999999853


No 140
>cd05767 IgC_MHC_II_alpha Class II major histocompatibility complex (MHC) alpha chain immunoglobulin domain. IgC_MHC_II_alpha: Immunoglobulin (Ig) domain of major histocompatibility complex (MHC) class II alpha chain.  MHC class II molecules play a key role in the initiation of the antigen-specific immune reponse. In both humans and in mice these molecules have been shown to be expressed constitutively on the cell surface of professional antigen-presenting cells (APCs), for example on B-lymphocytes, monocytes, and macrophages. The expression of these molecules has been shown to be induced in nonprofessional APCs such as keratinocyctes, and they are expressed on the surface of activated human T cells and on T cells from other species. The MHC II molecules present antigenic peptides to CD4(+) T-lymphocytes. These peptides derive mostly from protelytic processing via the endocytic pathway, of antigens internalized by the APC. These peptides bind to the MHC class II molecules in the endosom
Probab=95.55  E-value=0.055  Score=33.13  Aligned_cols=29  Identities=21%  Similarity=0.533  Sum_probs=22.0

Q ss_pred             CCCeEEEEEEcc-cCC-CeEEEEeCCCeeecC
Q psy11558         34 TTGAQVECTARG-SPN-PEIIWIRSDGTAVGD   63 (74)
Q Consensus        34 g~~v~L~C~A~G-~P~-P~I~W~~~dG~~i~~   63 (74)
                      +..++|.|.|.| .|. =+|+|++ ||.++..
T Consensus        15 ~~~~tL~C~a~gFyP~~I~v~W~~-~g~~~~~   45 (94)
T cd05767          15 GEPNTLICFVDNFFPPVLNVTWLK-NGVPVTD   45 (94)
T ss_pred             CCCeEEEEEEEEEECCcCEEEEEE-CCeEccC
Confidence            445899999999 774 4579996 7887643


No 141
>PHA02785 IL-beta-binding protein; Provisional
Probab=95.49  E-value=0.014  Score=42.48  Aligned_cols=27  Identities=15%  Similarity=0.385  Sum_probs=23.0

Q ss_pred             cCCCCeEEEEEE-----cccCCCeEEEEeCCC
Q psy11558         32 SNTTGAQVECTA-----RGSPNPEIIWIRSDG   58 (74)
Q Consensus        32 ~~g~~v~L~C~A-----~G~P~P~I~W~~~dG   58 (74)
                      .+|+.+.|.|.+     .|.|.|+|+|.++++
T Consensus        39 ~~ge~~~l~C~~~~~~~~g~p~~~i~W~K~g~   70 (326)
T PHA02785         39 LENEPVILPCPQINTLSSGYNILDILWEKRGA   70 (326)
T ss_pred             hcCCCEEEECCCccccccCCCCceEEEEECCC
Confidence            467889999997     899999999998543


No 142
>cd00096 Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of this group are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as, T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as, butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=95.48  E-value=0.02  Score=29.15  Aligned_cols=23  Identities=35%  Similarity=0.980  Sum_probs=19.2

Q ss_pred             eEEEEEEcccCCCeEEEEeCCCee
Q psy11558         37 AQVECTARGSPNPEIIWIRSDGTA   60 (74)
Q Consensus        37 v~L~C~A~G~P~P~I~W~~~dG~~   60 (74)
                      +.|.|.+.+.|.+.+.|.+ ++..
T Consensus         1 ~~l~C~~~~~~~~~~~W~~-~~~~   23 (74)
T cd00096           1 VTLTCLASGPPPPTITWLK-NGKP   23 (74)
T ss_pred             CEEEEEecCCCCCcEEEEE-CCEE
Confidence            4789999999999999997 4443


No 143
>cd07697 IgC_TCR_gamma T cell receptor (TCR) gamma chain constant immunoglobulin domain. IgC_TCR_gamma;  immunoglobulin (Ig) constant (C) domain of the gamma chain of gamma-delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha-beta TCRs but a small subset contain gamma-delta TCRs. Alpha-beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma-delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma-delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds.
Probab=95.43  E-value=0.019  Score=35.52  Aligned_cols=31  Identities=10%  Similarity=0.221  Sum_probs=22.3

Q ss_pred             ecCCCCeEEEEEEcc-cCC-CeEEEEeCCCeeec
Q psy11558         31 FSNTTGAQVECTARG-SPN-PEIIWIRSDGTAVG   62 (74)
Q Consensus        31 ~~~g~~v~L~C~A~G-~P~-P~I~W~~~dG~~i~   62 (74)
                      ...+..++|.|.|.| .|. =+|+|++ ||..+.
T Consensus        13 ~~~~~~~tL~C~a~gFyP~~I~v~W~k-ng~~~~   45 (96)
T cd07697          13 IEKQGQGIYLCLLENFFPDVIQVHWRE-GNSPSI   45 (96)
T ss_pred             HccCCCEEEEEEEEEEeCCCeEEEEEE-CCEECc
Confidence            333445999999999 663 3479986 887753


No 144
>cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain. IgV_TCR_delta: immunoglobulin (Ig) variable (V) domain of the delta chain of gamma/delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha/beta TCRs but a small subset contain gamma/delta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma/delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma/delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds. The variable domain of gamma/delta TCRs is responsible for antigen recognition and is
Probab=95.34  E-value=0.047  Score=33.51  Aligned_cols=34  Identities=15%  Similarity=0.316  Sum_probs=26.5

Q ss_pred             EEcCCCcEEecCCCCeEEEEEEccc-CCCeEEEEeC
Q psy11558         22 IKEPPNRIDFSNTTGAQVECTARGS-PNPEIIWIRS   56 (74)
Q Consensus        22 v~~Pp~~v~~~~g~~v~L~C~A~G~-P~P~I~W~~~   56 (74)
                      ++. +..+....|++|.|+|...+. ....+.|++.
T Consensus         3 ~q~-~~~v~~~~G~~v~L~C~~~~~~~~~~v~Wyrq   37 (116)
T cd07706           3 TQA-QPDVSVQVGEEVTLNCRYETSWTNYYIFWYKQ   37 (116)
T ss_pred             EEe-CCceEEcCCCCEEEEEEEeCCCCceEEEEEEE
Confidence            344 556668889999999999874 5678999985


No 145
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins. Ig1_LILRB1_like: domain similar to the first immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1). This group includes, LILRA5 (LIR9), an activating natural cytotoxicity receptor NKp46, and the immune-type receptor glycoprotein VI (GPVI). LILRs are a family of immunoreceptors expressed on expressed on T and B cells, on monocytes, dendritic cells, and subgroups of natural killer (NK) cells. The human LILR family contains nine proteins (LILRA1-3,and 5, and LILRB1-5). From functional assays, and as the cytoplasmic domains of various LILRs, for example LILRB1 (LIR-1), LILRB2 (LIR-2), and LILRB3 (LIR-3) contain immunoreceptor tyrosine-based inhibitory motifs (ITIMs) it is thought that LIR proteins are inhibitory receptors. Of the eight LIR family proteins, only LIR-1(LILRB1), and LIR-2 (LILRB2),
Probab=95.26  E-value=0.073  Score=31.62  Aligned_cols=39  Identities=18%  Similarity=0.317  Sum_probs=29.2

Q ss_pred             cceEEEcCCCcEEecCCCCeEEEEEEcccCCCeEEEEeCCCee
Q psy11558         18 GPIFIKEPPNRIDFSNTTGAQVECTARGSPNPEIIWIRSDGTA   60 (74)
Q Consensus        18 ~P~fv~~Pp~~v~~~~g~~v~L~C~A~G~P~P~I~W~~~dG~~   60 (74)
                      .|.+..+|. .+ +..|+.|+|.|.+. .|...+.|.+ ||..
T Consensus         2 kP~L~a~p~-~v-V~~G~~VtL~C~~~-~~~~~f~l~k-~g~~   40 (91)
T cd05751           2 KPSLWAEPS-SV-VPLGKPVTLRCQGP-YGAVEYRLYR-EGST   40 (91)
T ss_pred             CCEEEecCC-Cc-cCCCCcEEEEEecC-CCCCEEEEEE-CCCC
Confidence            467777754 33 56788899999997 6899999986 5553


No 146
>cd07704 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3), nectin-4 (poliovirus receptor related protein 4) and similar proteins. Ig2_Nectin-3-4_like: domain similar to the second immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and nectin-4 (poliovirus receptor related protein 4). Nectin-3 and nectin-4 belong to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through 4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion.  Nectin-2 and nectin-3 localize at Sertoli-spermatid junctions where they form heterophilic trans-interactions between the cells that are essential for the formation and maintenance of the junctions and for spermatid development.  Nect
Probab=95.23  E-value=0.05  Score=33.96  Aligned_cols=32  Identities=22%  Similarity=0.617  Sum_probs=22.5

Q ss_pred             CCCcEEecCCCCeEE-EEE-EcccCCCeEEEEeC
Q psy11558         25 PPNRIDFSNTTGAQV-ECT-ARGSPNPEIIWIRS   56 (74)
Q Consensus        25 Pp~~v~~~~g~~v~L-~C~-A~G~P~P~I~W~~~   56 (74)
                      |...+...+|.++.+ .|. |.|.|.++|+|..+
T Consensus         7 ~~~~~~~~~g~~~~vA~C~sa~gkPaa~IsW~~~   40 (97)
T cd07704           7 PGPSLLIDGGNGTTLAACCAAEGRPAADVTWETN   40 (97)
T ss_pred             CCCeeEeecCcceeEEEEEccCCccCCEeEEeCC
Confidence            344455556666666 665 55999999999964


No 147
>cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR). Ig4_SCFR: The fourth Immunoglobulin (Ig)-like domain in stem cell factor receptor (SCFR). SCFR is organized as an extracellular component having five IG-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. SCFR and its ligand SCF are critical for normal hematopoiesis, mast cell development, melanocytes and gametogenesis. SCF binds to the second and third Ig-like domains of SCFR. This fourth Ig-like domain participates in SCFR dimerization, which follows ligand binding. Deletion of this fourth domain abolishes the ligand-induced dimerization of SCFR and completely inhibits signal transduction.
Probab=95.18  E-value=0.057  Score=34.06  Aligned_cols=35  Identities=17%  Similarity=0.248  Sum_probs=28.7

Q ss_pred             CcEEecCCCCeEEEEEEcccCCCe-EEEEeCCCeeec
Q psy11558         27 NRIDFSNTTGAQVECTARGSPNPE-IIWIRSDGTAVG   62 (74)
Q Consensus        27 ~~v~~~~g~~v~L~C~A~G~P~P~-I~W~~~dG~~i~   62 (74)
                      ..+.+..|+++.|.|.....|+|+ +.|.+ ++..+.
T Consensus        11 ~~~~v~~gE~~~L~V~ieAYP~p~~~~W~~-~~~~l~   46 (101)
T cd05860          11 TTIFVNAGENLDLIVEYEAYPKPEHQQWIY-MNRTLT   46 (101)
T ss_pred             ceEEEECCCCEEEEEEEEeCCCCeeeEEEc-CCcccC
Confidence            355677899999999999999998 99996 555443


No 148
>cd05770 IgC_beta2m Class I major histocompatibility complex (MHC) beta2-microglobulin. IgC_beta2m: Immunoglobulin-like domain in beta2-Microglobulin (beta2m). Beta2m is the non-covalently bound light chain of the human class I major histocompatibility complex (MHC-I). Beta2m is structured as a beta-sandwich domain composed of two facing beta-sheets (four stranded and three stranded), that is typical of the C-type immunoglobulin superfamily. This structure is stabilized by an intramolecular disulfide bridge connecting two Cys residues in the facing beta -sheets. In vivo, MHC-I continuously exposes beta2m on the cell surface, where it may be released to plasmatic fluids, transported to the kidneys, degraded and then excreted.
Probab=94.84  E-value=0.066  Score=32.82  Aligned_cols=29  Identities=24%  Similarity=0.519  Sum_probs=21.7

Q ss_pred             CCCCeEEEEEEcc-cC-CCeEEEEeCCCeeec
Q psy11558         33 NTTGAQVECTARG-SP-NPEIIWIRSDGTAVG   62 (74)
Q Consensus        33 ~g~~v~L~C~A~G-~P-~P~I~W~~~dG~~i~   62 (74)
                      .|...+|.|.|.| .| .=+|+|++ ||+++.
T Consensus        14 ~g~~~~L~C~a~gFyP~~i~v~W~~-dg~~~~   44 (93)
T cd05770          14 NGKPNVLNCYVTGFHPPDIEIRLLK-NGVKIP   44 (93)
T ss_pred             CCCceEEEEEEEEEeCCCCEEEEEE-CCEECC
Confidence            3445799999999 56 34579986 888764


No 149
>PF07686 V-set:  Immunoglobulin V-set domain;  InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents the V-set domains, which are Ig-like domains resembling the antibody variable domain. V-set domains are found in diverse protein families, including immunoglobulin light and heavy chains; in several T-cell receptors such as CD2 (Cluster of Differentiation 2), CD4, CD80, and CD86; in myelin membrane adhesion molecules; in junction adhesion molecules (JAM); in tyrosine-protein kinase receptors; and in the programmed cell death protein 1 (PD1).; PDB: 1PY9_A 2NXY_D 1U9K_B 3RNK_A 3BP6_A 3BIK_B 3SBW_A 1NPU_A 3BP5_A 3RNQ_A ....
Probab=94.70  E-value=0.058  Score=31.55  Aligned_cols=33  Identities=18%  Similarity=0.568  Sum_probs=28.0

Q ss_pred             cCCCcEEecCCCCeEEEEEEc-ccCCCeEEEEeC
Q psy11558         24 EPPNRIDFSNTTGAQVECTAR-GSPNPEIIWIRS   56 (74)
Q Consensus        24 ~Pp~~v~~~~g~~v~L~C~A~-G~P~P~I~W~~~   56 (74)
                      .+|..+....|+++.|.|... ......+.|.+.
T Consensus         6 ~~~~~v~~~~G~~v~L~C~~~~~~~~~~v~W~~~   39 (114)
T PF07686_consen    6 QPPSPVTVQEGESVTLPCSYSSSSNQSSVYWYRQ   39 (114)
T ss_dssp             EEESEEEEETTSEEEEEEEEESSSSGSEEEEEEE
T ss_pred             EeCCeEEEecCCCEEEEEEEeCCCCcceEEEEEE
Confidence            356777788999999999999 778889999984


No 150
>cd07703 Ig2_Nectin-2_like Second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112) and similar proteins. Ig2_Nectin-2_like: domain similar to the second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112). Nectin-2 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through 4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion.  Nectin-2 and nectin-3 localize at Sertoli-spermatid junctions where they form heterophilic trans-interactions between the cells that are essential for the formation and maintenance of the junctions and for spermatid development.
Probab=94.62  E-value=0.072  Score=32.81  Aligned_cols=21  Identities=24%  Similarity=0.612  Sum_probs=18.1

Q ss_pred             CeEEEEEEc-ccCCCeEEEEeC
Q psy11558         36 GAQVECTAR-GSPNPEIIWIRS   56 (74)
Q Consensus        36 ~v~L~C~A~-G~P~P~I~W~~~   56 (74)
                      -..+.|.+. |.|.++|+|.++
T Consensus        17 ~~va~C~s~~gkPaa~IsW~~~   38 (95)
T cd07703          17 VPVAKCVSANGRPPARISWSST   38 (95)
T ss_pred             cEEEEEEcCCCCCCcEEEEEcC
Confidence            389999665 999999999975


No 151
>cd05719 Ig2_PVR_like Second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins. Ig2_PVR_like: domain similar to the second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155). Poliovirus (PV) binds to its cellular receptor (PVR/CD155) to initiate infection. CD155 is a membrane-anchored, single-span glycoprotein; its extracellular region has three Ig-like domains. There are four different isotypes of CD155 (referred to as alpha, beta, gamma, and delta), these result from alternate splicing of the CD155 mRNA, and have identical extracellular domains. CD155-beta and - gamma, are secreted, CD155-alpha and delta are membrane-bound and function as PV receptors. The virus recognition site is contained in the amino-terminal domain, D1. Having the virus attachment site on the receptor distal from the plasma membrane may be important for successful initiation of infection of cells by the virus. CD155 binds in the poliovirus 
Probab=94.49  E-value=0.062  Score=32.92  Aligned_cols=21  Identities=24%  Similarity=0.593  Sum_probs=18.7

Q ss_pred             CeEEEEEE-cccCCCeEEEEeC
Q psy11558         36 GAQVECTA-RGSPNPEIIWIRS   56 (74)
Q Consensus        36 ~v~L~C~A-~G~P~P~I~W~~~   56 (74)
                      ...+.|.| .|.|.++|+|.++
T Consensus        17 ~~va~C~s~~gkP~a~ItW~~~   38 (95)
T cd05719          17 VTVATCVSANGKPPATISWETT   38 (95)
T ss_pred             cEEEEEECCCCcCCCEEEEEeC
Confidence            48999999 6999999999974


No 152
>PF06832 BiPBP_C:  Penicillin-Binding Protein C-terminus Family;  InterPro: IPR009647 This conserved region of approximately 90 residues is found in a sub-group of bacterial Penicillin-Binding Proteins (PBPs). A variable length loop region separates this region from the transpeptidase unit (IPR001460 from INTERPRO). It is predicted to be a beta fold.
Probab=94.25  E-value=0.61  Score=27.68  Aligned_cols=51  Identities=14%  Similarity=0.186  Sum_probs=32.6

Q ss_pred             CccceEEEcCCCcEEecCC---CCeEEEEEEcccCCCeEEEEeCCCeeecCCCCce
Q psy11558         16 TLGPIFIKEPPNRIDFSNT---TGAQVECTARGSPNPEIIWIRSDGTAVGDVPGLR   68 (74)
Q Consensus        16 ~~~P~fv~~Pp~~v~~~~g---~~v~L~C~A~G~P~P~I~W~~~dG~~i~~~~~~r   68 (74)
                      ..+|.++.-+...+.....   ....|.++|.|. .+.+.|+. ||+.+......+
T Consensus         8 ~~~l~I~~P~~g~~~~~~~~~~~~~~l~l~a~~~-~~~~~W~v-dg~~~g~~~~~~   61 (89)
T PF06832_consen    8 GSPLRITSPPDGAVLALDPGIPERQPLVLKAAGG-RGPVYWFV-DGEPLGTTQPGH   61 (89)
T ss_pred             CCCCEEEecCCCCEEEeCCCCCccceEEEEEeCC-CCcEEEEE-CCEEcccCCCCC
Confidence            3455555544444333321   258899999998 77999996 999985444333


No 153
>cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins. Ig_P0ex-like: domain similar to the immunoglobulin (Ig) domain of Protein zero (P0). P0 accounts for over 50% of the total protein in peripheral nervous system (PNS) myelin. P0 is a single-pass transmembrane glycoprotein with a highly basic intracellular domain and an extracellular Ig domain. The extracellular domain of P0 (P0-ED) is similar to the Ig variable domain, carrying one acceptor sequence for N-linked glycosylation. P0 plays a role in membrane adhesion in the spiral wraps of the myelin sheath. The intracellular domain is thought to mediate membrane apposition of the cytoplasmic faces and may, through electrostatic interactions, interact directly with lipid headgroups. It is thought that homophilic interactions of the P0 extracellular domain mediate membrane juxtaposition in the extracellular space of PNS myelin. This group also contains the Ig domain of Sodium channel subunit beta-2 
Probab=94.10  E-value=0.12  Score=31.93  Aligned_cols=31  Identities=19%  Similarity=0.426  Sum_probs=23.0

Q ss_pred             CCcEEecCCCCeEEEEEEcccC----CCeEEEEeC
Q psy11558         26 PNRIDFSNTTGAQVECTARGSP----NPEIIWIRS   56 (74)
Q Consensus        26 p~~v~~~~g~~v~L~C~A~G~P----~P~I~W~~~   56 (74)
                      |..+....|++|.|.|..+...    ...|.|++.
T Consensus         5 p~~v~v~~G~~vtL~C~~s~~~~~~~~~~v~W~~~   39 (116)
T cd05715           5 PREVYAVNGSDVRLKCTFSSSEPISDDISVTWSFQ   39 (116)
T ss_pred             CCeEEEEcCCCeEEEeEEeCCCCcCCceEEEEEEe
Confidence            4555677898999999887543    367999764


No 154
>cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2). Ig2_IL1R2_like: domain similar to the second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2). IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds the type II (IL1R2) represented in this group. Mature IL1R2 consists of three IG-like domains, a transmembrane domain, and a short cytoplasmic domain. It lacks the large cytoplasmic domain of Mature IL1R1, and does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta.
Probab=93.48  E-value=0.096  Score=32.30  Aligned_cols=31  Identities=16%  Similarity=0.461  Sum_probs=23.4

Q ss_pred             cCCCCeEEEEEE-c----ccCCCeEEEEeCCCeeecC
Q psy11558         32 SNTTGAQVECTA-R----GSPNPEIIWIRSDGTAVGD   63 (74)
Q Consensus        32 ~~g~~v~L~C~A-~----G~P~P~I~W~~~dG~~i~~   63 (74)
                      ..|.++.|.|.- .    -++.|+|+|++ ||.++..
T Consensus         8 ~~~~~~~l~Cp~~~~f~~~~~~~~v~WYK-d~~~l~~   43 (95)
T cd05897           8 FTSTSGKLVCPDLSDFTINRTDVELQWYK-DSVLLDK   43 (95)
T ss_pred             ccccCcEEECCCHHHcccCCCCCcEEEcc-CCEECcC
Confidence            356679999973 2    34889999996 8888753


No 155
>cd04985 IgC_CH1 CH1 domain (first constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH1: The first immunoglobulin constant domain (IgC), of immunoglobulin (Ig) heavy chains. This domain is found on the Fab antigen-binding fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=93.29  E-value=0.35  Score=29.48  Aligned_cols=38  Identities=21%  Similarity=0.385  Sum_probs=24.6

Q ss_pred             eEEEcCCCcEEecCCCCeEEEEEEcc-cCC-CeEEEEeCCCee
Q psy11558         20 IFIKEPPNRIDFSNTTGAQVECTARG-SPN-PEIIWIRSDGTA   60 (74)
Q Consensus        20 ~fv~~Pp~~v~~~~g~~v~L~C~A~G-~P~-P~I~W~~~dG~~   60 (74)
                      +|..-|...- .+ +..++|.|.|.| .|. =+|+|.+ ||..
T Consensus         4 v~~l~~~~~~-~~-~~~~~L~C~a~gFyP~~i~vtW~k-~g~~   43 (95)
T cd04985           4 VFPLVPCCSS-SS-SDSVTLGCLATGFLPEPVTFTWNS-GSNS   43 (95)
T ss_pred             EEEeCCCccc-cC-CCcEEEEEEEeeEECCCcEEEEeE-CCEE
Confidence            3444444332 23 345999999999 563 4579986 7876


No 156
>cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins. Ig_CEACAM_D1_like : immunoglobulin (IG)-like domain 1 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily-like. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surf
Probab=93.29  E-value=0.1  Score=30.22  Aligned_cols=24  Identities=13%  Similarity=0.255  Sum_probs=20.8

Q ss_pred             CCCeEEEEEEcccCCCeEEEEeCC
Q psy11558         34 TTGAQVECTARGSPNPEIIWIRSD   57 (74)
Q Consensus        34 g~~v~L~C~A~G~P~P~I~W~~~d   57 (74)
                      |++|+|.|.....+.-.|.|.+.+
T Consensus         1 G~~VtL~c~~~~~~~~~i~W~~~~   24 (92)
T cd05741           1 GESVTLPVSNLPENLQEITWYKGK   24 (92)
T ss_pred             CCcEEEEcccCCCCCEEEEEECCC
Confidence            567999999998888899999864


No 157
>cd07694 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4. Ig2_CD4; second immunoglobulin (Ig) domain of CD4.  CD4 and CD8 are the two primary co-receptor proteins found on the surface of T cells, and the presence of either CD4 or CD8 determines the function of the T cell.  CD4 is found on helper T cells, where it is required for the binding of MHC (major histocompatibility complex) class II molecules, while CD8 is found on cytotoxic T cells, where it is required for the binding of MHC class I molecules.  CD4 contains four immunoglobulin domains, with the first three included in this hierarchy.  The fourth domain has a general Ig architecture, but has slight topological changes in the arrangement of beta strands relative to the other structures in this family and is not specifically included in the hierarchy.
Probab=93.21  E-value=0.28  Score=30.41  Aligned_cols=32  Identities=9%  Similarity=0.187  Sum_probs=24.0

Q ss_pred             ecCCCCeEEEEEEcccCCC--eEEEEeCCCeeec
Q psy11558         31 FSNTTGAQVECTARGSPNP--EIIWIRSDGTAVG   62 (74)
Q Consensus        31 ~~~g~~v~L~C~A~G~P~P--~I~W~~~dG~~i~   62 (74)
                      +..|++.+|.|.+...+.|  .|+|...++..++
T Consensus        11 lL~G~sLtLtl~~~s~s~p~~~i~w~~P~n~~~~   44 (88)
T cd07694          11 VLSGTNLTLTLHGSSNSLPAFKVEWRGPGNKSKQ   44 (88)
T ss_pred             eecCCcEEEEEecCCCCCCCccEEEeCCCCccce
Confidence            3467889999999654555  9999987776544


No 158
>cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain. IgV_CD8_beta: immunoglobulin (Ig)-like domain in CD8 beta. The CD8 glycoprotein plays an essential role in the control of T-cell selection, maturation and the T-cell receptor (TCR)-mediated response to peptide antigen. CD8 is comprised of alpha and beta subunits and is expressed as either an alpha/alpha or alpha/beta dimer. Both dimeric isoforms can serve as a coreceptor for T cell activation and differentiation, however they have distinct physiological roles, different cellular distributions, unique binding partners etc. Each CD8 subunit is comprised of an extracellular domain containing a V-type Ig-like domain, a single pass transmembrane portion and a short intracellular domain.
Probab=93.13  E-value=0.2  Score=30.46  Aligned_cols=28  Identities=25%  Similarity=0.604  Sum_probs=22.1

Q ss_pred             ecCCCCeEEEEEEcccC-CCeEEEEeCCC
Q psy11558         31 FSNTTGAQVECTARGSP-NPEIIWIRSDG   58 (74)
Q Consensus        31 ~~~g~~v~L~C~A~G~P-~P~I~W~~~dG   58 (74)
                      +..|+.|+|.|.+.+.. ...+.|++-+.
T Consensus         3 v~~G~~vtL~C~~~~~~~~~~~~Wyrq~~   31 (107)
T cd07700           3 VQTNNTVKLSCEAKGISENTRIYWLRWRQ   31 (107)
T ss_pred             EcCCCCEEEEEEEecCCCCCeEEEEEECC
Confidence            45788899999998854 56899998643


No 159
>cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins. Ig_CSPGs_LP: immunoglobulin (Ig)-like domain similar to that found in chondroitin sulfate proteoglycans (CSPGs) and human cartilage link protein (LP).  Included in this group are the CSPGs aggrecan, versican, and neurocan. In CSPGs this Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggrecan and versican have a wide distribution in connective tissue and extracellular matrices. Neurocan is localized almost exclusively in nervous tissue.
Probab=93.08  E-value=0.16  Score=30.58  Aligned_cols=23  Identities=22%  Similarity=0.538  Sum_probs=19.8

Q ss_pred             CCCeEEEEEEcccC------CCeEEEEeC
Q psy11558         34 TTGAQVECTARGSP------NPEIIWIRS   56 (74)
Q Consensus        34 g~~v~L~C~A~G~P------~P~I~W~~~   56 (74)
                      |++|+|.|...+.|      .++|.|.+.
T Consensus         2 G~~V~L~C~~~~~~~~~~~~~~~i~W~k~   30 (106)
T cd05714           2 GGNVTLPCRFHLEPALSAPHGPRIKWTKL   30 (106)
T ss_pred             CCCEEEeEEeECCcccCCCCCcEEEEEEe
Confidence            66899999998875      679999986


No 160
>cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA). Ig_EVA: immunoglobulin (Ig) domain of epithelial V-like antigen 1 (EVA). EVA is also known as myelin protein zero-like 2. EVA is an adhesion molecule, which may play a role in structural organization of the thymus and early lymphocyte development.
Probab=92.97  E-value=0.23  Score=30.88  Aligned_cols=30  Identities=23%  Similarity=0.405  Sum_probs=23.3

Q ss_pred             CCcEEecCCCCeEEEEEEcccC----CCeEEEEe
Q psy11558         26 PNRIDFSNTTGAQVECTARGSP----NPEIIWIR   55 (74)
Q Consensus        26 p~~v~~~~g~~v~L~C~A~G~P----~P~I~W~~   55 (74)
                      +..+.+.+|+++.|.|.-+..+    ...|+|++
T Consensus         5 ~~~v~~~~G~~v~L~C~~s~~~~~~~~~~i~W~~   38 (115)
T cd05880           5 SKEVEAVNGTDVRLKCTFSSSAPIGDTLVITWNF   38 (115)
T ss_pred             CceEEEEcCCCEEEEEEEEeCCCCCCcEEEEEEE
Confidence            4667788999999999987544    34699975


No 161
>PHA03052 Hypothetical protein; Provisional
Probab=92.96  E-value=0.46  Score=28.31  Aligned_cols=34  Identities=21%  Similarity=0.459  Sum_probs=28.3

Q ss_pred             CcEEecCCCCeEEEEEEc---ccCCCeEEEEeCCCeee
Q psy11558         27 NRIDFSNTTGAQVECTAR---GSPNPEIIWIRSDGTAV   61 (74)
Q Consensus        27 ~~v~~~~g~~v~L~C~A~---G~P~P~I~W~~~dG~~i   61 (74)
                      +.++.+-|+..++.|+|.   |...+.|.|. .||..+
T Consensus         5 ~~i~~slGs~ltI~Ckv~lg~g~~~a~V~W~-~N~~~~   41 (69)
T PHA03052          5 EGIVTSLGSNLTITCKVSLRPPTTDADVFWI-SNGMYY   41 (69)
T ss_pred             ccEEEEccCCceEeEEEEecCCCcceEEEEE-eCCcEE
Confidence            677788899999999997   4457889998 588888


No 162
>cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain. IgV_H: Immunoglobulin (Ig) heavy chain (H), variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin: IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which can associate with any of the heavy chains. This family includes alpha, gamma, delta, epsilon, and mu heavy chains.
Probab=92.72  E-value=0.88  Score=28.30  Aligned_cols=33  Identities=18%  Similarity=0.298  Sum_probs=24.4

Q ss_pred             EcCCCcEEecCCCCeEEEEEEcccC--CCeEEEEeC
Q psy11558         23 KEPPNRIDFSNTTGAQVECTARGSP--NPEIIWIRS   56 (74)
Q Consensus        23 ~~Pp~~v~~~~g~~v~L~C~A~G~P--~P~I~W~~~   56 (74)
                      ++|+ .+.+..|+.|+|+|..++.-  ...+.|++-
T Consensus         2 ~~~~-~~~v~~G~~vtL~C~~~~~~~~~~~~~WYkQ   36 (117)
T cd04981           2 VESG-PGLVKPGQSLKLSCKASGFTFTSYGVNWVRQ   36 (117)
T ss_pred             ccCC-CeEEcCCCCEEEEEEEeCCCcccceEEEEEE
Confidence            3443 44577898999999987754  567999975


No 163
>cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI. IG_FcalphaRI : immunoglobulin (IG)-like domain of of FcalphaRI. FcalphaRI (CD89) is an IgA-specific receptor that is expressed on monocytes, eosinophils, neutrophils and macrophages. FcalphaRI mediates IgA-induced immune effector responses such as phagocytosis, antibody-dependent cell-mediated cytotoxicity and respiratory burst. Both monomeric and dimeric IgA can bind to FcalphaRI, and monomeric or dimeric IgA immune complexes can activate phagocytosis and other immune responses through the clustering of FcalphaRI. The Fc RI ectodomain is comprised of two Ig-like domains oriented at about 90 degree to each another.
Probab=92.53  E-value=0.51  Score=28.30  Aligned_cols=37  Identities=11%  Similarity=0.294  Sum_probs=26.4

Q ss_pred             ceEEEcCCCcEEecCCCCeEEEEEEcccCCCeEEEEeCCC
Q psy11558         19 PIFIKEPPNRIDFSNTTGAQVECTARGSPNPEIIWIRSDG   58 (74)
Q Consensus        19 P~fv~~Pp~~v~~~~g~~v~L~C~A~G~P~P~I~W~~~dG   58 (74)
                      |.+...| ..+ +..|+.|+|.|.+.- +.=.+.|.+++.
T Consensus         2 P~l~a~p-~~v-V~~G~~VTL~C~~~~-~~~~f~l~k~g~   38 (94)
T cd05711           2 PFLSAHP-SPV-VPSGENVTLQCHSDI-RFDRFILYKEGR   38 (94)
T ss_pred             CEEEecC-CCc-cCCCCeEEEEEecCC-CCCEEEEEECCC
Confidence            5666664 443 567888999998876 666799997443


No 164
>cd04986 IgC_CH2 CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH2: The second immunoglobulin constant domain (IgC), of immunoglobulin (Ig) heavy chains. This domain is found on the Fc fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=92.50  E-value=0.26  Score=30.77  Aligned_cols=38  Identities=26%  Similarity=0.526  Sum_probs=24.7

Q ss_pred             eEEEcCCCcEEecCCCCeEEEEEEcc-c-C-CCeEEEEeCCC
Q psy11558         20 IFIKEPPNRIDFSNTTGAQVECTARG-S-P-NPEIIWIRSDG   58 (74)
Q Consensus        20 ~fv~~Pp~~v~~~~g~~v~L~C~A~G-~-P-~P~I~W~~~dG   58 (74)
                      +++. ||..-+...+..++|.|.+.| . | .=+|+|.++++
T Consensus         6 V~l~-pPs~e~l~~~~~atLtClV~~f~~P~~i~V~W~~~g~   46 (99)
T cd04986           6 LSLQ-RPALEDLLLGSSASLTCTLSGLRDPEGAVFTWTPSGG   46 (99)
T ss_pred             EEEE-CcChHHhCcCCccEEEEEEeccCCCCCeEEEEEECCc
Confidence            4455 344333334557999999999 5 6 34699997543


No 165
>PHA02987 Ig domain OX-2-like protein; Provisional
Probab=92.34  E-value=0.27  Score=34.32  Aligned_cols=31  Identities=16%  Similarity=0.417  Sum_probs=25.2

Q ss_pred             cEEecCCCCeEEEEEEc-ccCCCeEEEEeCCC
Q psy11558         28 RIDFSNTTGAQVECTAR-GSPNPEIIWIRSDG   58 (74)
Q Consensus        28 ~v~~~~g~~v~L~C~A~-G~P~P~I~W~~~dG   58 (74)
                      .+++.+|++|+|.|.-. +...+.|+|++.++
T Consensus        24 ~v~V~ege~VtLsCs~t~s~~~~qVtWkK~~~   55 (189)
T PHA02987         24 KITVSEHVNVKISCNKTSSFNSILITWKKNNK   55 (189)
T ss_pred             EEEEcCCCCEEEEEecCCCCccceEEEEEcCC
Confidence            45677888999999984 77799999998654


No 166
>cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain. Ig_CD8_alpha: immunoglobulin (Ig)-like domain in CD8 alpha. The CD8 glycoprotein plays an essential role in the control of T-cell selection, maturation and the T-cell receptor (TCR)-mediated response to peptide antigen. CD8 is comprised of alpha and beta subunits and is expressed as either an alphaalpha or alphabeta dimer. Both dimeric isoforms can serve as a coreceptor for T cell activation and differentiation, however they have distinct physiological roles, different cellular distributions, unique binding partners etc. Each CD8 subunit is comprised of an extracellular domain containing a v-type Ig-like domain, a single pass transmembrane portion and a short intracellular domain. The Ig domain of CD8 alpha binds to antibodies.
Probab=91.91  E-value=0.77  Score=27.89  Aligned_cols=27  Identities=11%  Similarity=0.231  Sum_probs=21.9

Q ss_pred             ecCCCCeEEEEEEcccCCCeEEEEeCC
Q psy11558         31 FSNTTGAQVECTARGSPNPEIIWIRSD   57 (74)
Q Consensus        31 ~~~g~~v~L~C~A~G~P~P~I~W~~~d   57 (74)
                      +..|+.|+|+|...+.-...+.|++-.
T Consensus         3 v~~G~~vtL~C~~~~~~~~~v~Wyrq~   29 (104)
T cd05720           3 AELGQKVELKCEVLNSSPTGCSWLFQP   29 (104)
T ss_pred             ccCCCeEEEEEEecCCCCCcEEEEEeC
Confidence            356888999999987666779999864


No 167
>cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP). Ig_LP_like: immunoglobulin (Ig)-like domain similar to that that found in human cartilage link protein (LP). In cartilage, chondroitin-keratan sulfate proteoglycan (CSPG), aggrecan, forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many different tissues. Members of the vertebrate HPLN (hyaluronan/HA and proteoglycan binding link) protein family are physically linked adjacent to CSPG genes.
Probab=91.14  E-value=0.37  Score=28.86  Aligned_cols=24  Identities=13%  Similarity=0.412  Sum_probs=19.2

Q ss_pred             CCCeEEEEEEcccC------CCeEEEEeCC
Q psy11558         34 TTGAQVECTARGSP------NPEIIWIRSD   57 (74)
Q Consensus        34 g~~v~L~C~A~G~P------~P~I~W~~~d   57 (74)
                      |++|+|.|.....|      ...|.|.+.+
T Consensus         2 G~~vtL~C~~~~~~~~~~~~~~~v~W~k~~   31 (106)
T cd05877           2 GGNVTLPCRYHYEPELSAPRKIRVKWTKLE   31 (106)
T ss_pred             CCcEEEEeEeECCCcCCCCccceEEEEEec
Confidence            66799999988764      4679999864


No 168
>cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins). Ig_Siglec_N: immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins). Siglec refers to a structurally related protein family that specifically recognizes sialic acid in oligosaccharide chains of glycoproteins and glycolipids. Siglecs are type I transmembrane proteins, organized as an extracellular module composed of Ig-like domains (an N-terminal variable set of Ig-like carbohydrate recognition domains, and 1 to 16 constant Ig-like domains), followed by transmembrane and short cytoplasmic domains. Human siglecs are classified into two subgroups, one subgroup is comprised of sialoadhesin (Siglec-1), CD22 (Siglec-2), and MAG, the other subgroup is comprised of CD33-related Siglecs which include CD33 (Siglec-3) and human Siglecs 5-11.
Probab=90.59  E-value=0.63  Score=28.82  Aligned_cols=33  Identities=12%  Similarity=0.304  Sum_probs=23.8

Q ss_pred             CCCcEEecCCCCeEEEEEEcccC------CCeEEEEeCC
Q psy11558         25 PPNRIDFSNTTGAQVECTARGSP------NPEIIWIRSD   57 (74)
Q Consensus        25 Pp~~v~~~~g~~v~L~C~A~G~P------~P~I~W~~~d   57 (74)
                      .|+.+....|+.|+|.|.-.-.+      .-.+.|++.+
T Consensus         5 ~P~~v~~~~G~~VtL~C~f~~~~~~~~~~~~~~~Wykq~   43 (119)
T cd05712           5 MPKSVSVQEGLCVLIPCSFSYPADWPVSNGVHGIWYKGH   43 (119)
T ss_pred             CCCEEEEeccccEEEEEEeeCcccccCCCceEEEEEeCC
Confidence            35666788899999999765321      3569999864


No 169
>cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0). Ig_P0ex: immunoglobulin (Ig) domain of Protein zero (P0). P0 accounts for over 50% of the total protein in peripheral nervous system (PNS) myelin. P0 is a single-pass transmembrane glycoprotein with a highly basic intracellular domain and an Ig domain.  The extracellular domain of P0 (P0-ED) is similar to the Ig variable domain, carrying one acceptor sequence for N-linked glycosylation. P0 plays a role in membrane adhesion in the spiral wraps of the myelin sheath. The intracellular domain is thought to mediate membrane apposition of the cytoplasmic faces and may, through electrostatic interactions, interact directly with lipid headgroups. It is thought that homophilic interactions of the P0 extracellular domain mediate membrane juxtaposition in the extracellular space of PNS myelin.
Probab=90.56  E-value=0.63  Score=29.39  Aligned_cols=29  Identities=10%  Similarity=0.221  Sum_probs=22.3

Q ss_pred             CcEEecCCCCeEEEEEEccc----CCCeEEEEe
Q psy11558         27 NRIDFSNTTGAQVECTARGS----PNPEIIWIR   55 (74)
Q Consensus        27 ~~v~~~~g~~v~L~C~A~G~----P~P~I~W~~   55 (74)
                      ..+....|+++.|.|.-+..    +..+|+|.+
T Consensus         6 ~ev~a~~G~~v~L~C~f~~~~~~~~~~~v~W~~   38 (116)
T cd05879           6 REVYGTVGSDVTLSCSFWSSEWISDDISFTWHY   38 (116)
T ss_pred             ceEEEEcCCcEEEEEEEecCCCCCCcEEEEEEE
Confidence            44556788899999999774    457999944


No 170
>cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins. Ig1_PVR_like: domain similar to the first immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155). Poliovirus (PV) binds to its cellular receptor (PVR/CD155) to initiate infection. CD155 is a membrane-anchored, single-span glycoprotein; its extracellular region has three Ig-like domains. There are four different isotypes of CD155 (referred to as alpha, beta, gamma, and delta), that result from alternate splicing of the CD155 mRNA, and have identical extracellular domains. CD155-beta and - gamma, are secreted, CD155-alpha and delta are membrane-bound and function as PV receptors. The virus recognition site is contained in the amino-terminal domain, D1. Having the virus attachment site on the receptor distal from the plasma membrane, may be important for successful initiation of infection of cells by the virus. CD155 binds in the poliovirus "c
Probab=89.90  E-value=0.38  Score=28.14  Aligned_cols=23  Identities=17%  Similarity=0.536  Sum_probs=18.6

Q ss_pred             CeEEEEEEcccC---CCeEEEEeCCC
Q psy11558         36 GAQVECTARGSP---NPEIIWIRSDG   58 (74)
Q Consensus        36 ~v~L~C~A~G~P---~P~I~W~~~dG   58 (74)
                      +|.|.|...+.+   ...|.|.+.++
T Consensus         2 ~v~L~C~~~~~~~~~~~~v~W~k~~~   27 (98)
T cd05718           2 SVTLECSFPVPGPVQITQVTWMKITG   27 (98)
T ss_pred             CEEEEeEeeCCCCceEEEEEEeeECC
Confidence            589999999875   55799998654


No 171
>cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR). Ig_pIgR: Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR). pIgR delivers dimeric IgA and pentameric IgM to mucosal secretions. Polymeric immunoglobulin (pIgs) are the first defense against pathogens and toxins. IgA and IgM can form polymers via an 18-residue extension at their c-termini referred to as the tailpiece. pIgR transports pIgs across mucosal epithelia into mucosal secretions. Human pIgR is a glycosylated type I transmembrane protein, comprised of a 620 residue extracellular region, a 23 residue transmembrane region, and a 103 residue cytoplasmic tail. The extracellular region contains five domains that share sequence similarity with Ig variable (v) regions.
Probab=89.36  E-value=0.67  Score=27.30  Aligned_cols=28  Identities=11%  Similarity=0.133  Sum_probs=22.4

Q ss_pred             EecCCCCeEEEEEEcc-cCCCeEEEEeCC
Q psy11558         30 DFSNTTGAQVECTARG-SPNPEIIWIRSD   57 (74)
Q Consensus        30 ~~~~g~~v~L~C~A~G-~P~P~I~W~~~d   57 (74)
                      ....|++++|.|.... .+...+.|.+.+
T Consensus         3 ~~~~G~~vtl~C~~~~~~~~~~~~W~r~~   31 (98)
T cd05716           3 TGELGGSVTIPCPYPPKNRSYEKYWCKWG   31 (98)
T ss_pred             EEEeCCeEEEEeeCCCCCCCcEeEeECCC
Confidence            4567888999999876 468889999864


No 172
>cd05721 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4). IgV_CTLA-4: domain similar to the variable(v)-type immunoglobulin (Ig) domain found in cytotoxic T lymphocyte-associated antigen 4 (CTLA-4).  CTLA-4 is involved in the regulation of T cell response, acting as an inhibitor of intracellular signalling.  CTLA-4 is similar to CD28, a T cell co-receptor protein that recognizes the B7 proteins (CD80 and CD86). CD28 binding of the B7 proteins occurs after the presentation of antigen to the T cell receptor (TCR) via the peptide-MHC complex on the surface of an antigen presenting cell (APC).  CTLA-4 also binds the B7 molecules with a higher affinity than does CD28.  The B7/CTLA-4 interaction generates inhibitory signals down-regulating the response, and may prevent T cell activation by weak TCR signals. CD28 and CTLA-4 then elicit opposing signals in the regulation of T cell responsiveness and homeostasis. T cell activation leads to increased 
Probab=89.30  E-value=0.85  Score=29.43  Aligned_cols=33  Identities=9%  Similarity=0.110  Sum_probs=22.0

Q ss_pred             EcCCCcEEecCCCCeEEEEEEcccCCCe---EEEEeC
Q psy11558         23 KEPPNRIDFSNTTGAQVECTARGSPNPE---IIWIRS   56 (74)
Q Consensus        23 ~~Pp~~v~~~~g~~v~L~C~A~G~P~P~---I~W~~~   56 (74)
                      .++...+. ..|.+++|.|+++|.=..+   ++|+|.
T Consensus         3 ~~~~~~lv-~p~~sv~LsC~~sg~~~s~e~~~~wvRq   38 (115)
T cd05721           3 VQQSPVLA-SSNGAASLVCEYTYNGFSKEFRASLLKG   38 (115)
T ss_pred             eecCCeEE-cCCCCEEEEEEecCCccccEEEEEEEEe
Confidence            34444443 4455799999998866544   888873


No 173
>KOG3515|consensus
Probab=88.90  E-value=0.4  Score=39.35  Aligned_cols=31  Identities=13%  Similarity=0.438  Sum_probs=24.9

Q ss_pred             cEEecCCCCeEEEEEEcccC-CCeEEEEeCCC
Q psy11558         28 RIDFSNTTGAQVECTARGSP-NPEIIWIRSDG   58 (74)
Q Consensus        28 ~v~~~~g~~v~L~C~A~G~P-~P~I~W~~~dG   58 (74)
                      +..+..|++|.|.|.+.|+| .+++.|++++-
T Consensus        16 ~~~~~~g~~v~l~C~v~~~pp~~~~eW~h~~~   47 (741)
T KOG3515|consen   16 TVGLRLGEDVPLPCRVNSNPPEIDVEWYHSTS   47 (741)
T ss_pred             ChhhccCCcceeeeecCCCCCCcceEEEecCc
Confidence            33567888999999999887 67899998643


No 174
>cd05890 Ig2_Nectin-1_like Second immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins. Ig2_Nectin-1_like: domain similar to the second immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111). Nectin-1 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through 4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. Nectins also heterophilically trans-interact with other CAMs such as nectin-like molecules (necls); nectin-1 for example, has been shown to trans-interact with necl-1. Nectins also interact with various other proteins, including the actin filament (F-actin)-binding protein, afadin. Mutation in the human nectin-1 gene is associ
Probab=88.87  E-value=0.85  Score=28.86  Aligned_cols=23  Identities=26%  Similarity=0.596  Sum_probs=19.3

Q ss_pred             eEEEEE-EcccCCCeEEEEeC-CCe
Q psy11558         37 AQVECT-ARGSPNPEIIWIRS-DGT   59 (74)
Q Consensus        37 v~L~C~-A~G~P~P~I~W~~~-dG~   59 (74)
                      +.-.|. |.|.|+.+|+|.-+ +|.
T Consensus        23 ~VA~CiSa~GrPpa~ItW~t~l~G~   47 (98)
T cd05890          23 LVATCVSANGKPPSVVRWDTRLKGE   47 (98)
T ss_pred             EEEEEEcCCCcCCcEeEEEccCCCc
Confidence            788999 88999999999865 454


No 175
>cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan. Ig_Aggrecan: immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan. These aggregates contribute to the tissue's load bearing properties. In CSPGs, the Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Aggrecan has a wide distribution in connective tissue and extracellular matrices. Members of the vertebrate HPLN (hyaluronan/HA and proteoglycan binding link) protein family are physically linked adjacent to CSPG genes.
Probab=88.42  E-value=0.76  Score=28.86  Aligned_cols=23  Identities=17%  Similarity=0.371  Sum_probs=18.7

Q ss_pred             CCCeEEEEEEcccC------------CCeEEEEeC
Q psy11558         34 TTGAQVECTARGSP------------NPEIIWIRS   56 (74)
Q Consensus        34 g~~v~L~C~A~G~P------------~P~I~W~~~   56 (74)
                      |++++|.|.-...+            .+.|.|.+-
T Consensus         2 G~~VtLpC~~~~~~~~~~~~~~~~~~~~~I~W~k~   36 (112)
T cd05900           2 GSSLLIPCYFQDPIAKDPGAPTVAPLSPRIKWSFI   36 (112)
T ss_pred             CCcEEEeeEEeCCcCccccccccCCCCCEEEEEEe
Confidence            66799999998654            579999975


No 176
>cd07689 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106) and intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins. Ig2_ VCAM-1_like: domain similar to the second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106). During the inflammation process, these molecules recruit leukocytes onto the vascular endothelium before extravasation to the injured tissues. The interaction of VCAM-1 binding to the beta1 integrin very late antigen (VLA-4) expressed by lymphocytes and monocytes mediates the adhesion of leucocytes to blood vessel walls, and regulates migration across the endothelium. During metastasis, some circulating cancer cells extravasate to a secondary site by a similar process.  VCAM-1 may be involved in organ targeted tumor metastasis and may also act as host receptors for viruses and parasites.  VCAM-1 contains seven Ig domains.
Probab=88.24  E-value=1.3  Score=27.95  Aligned_cols=33  Identities=21%  Similarity=0.392  Sum_probs=23.2

Q ss_pred             ceEEEcCCCcEEecCCCCeEEEEEEcc-cCC--CeEEEEe
Q psy11558         19 PIFIKEPPNRIDFSNTTGAQVECTARG-SPN--PEIIWIR   55 (74)
Q Consensus        19 P~fv~~Pp~~v~~~~g~~v~L~C~A~G-~P~--P~I~W~~   55 (74)
                      |.+...++    ...|..+++.|.|.| .|.  .+|.|.+
T Consensus         4 p~i~~~~~----l~~G~~vtv~C~v~~v~P~~~l~v~Llk   39 (99)
T cd07689           4 PEILLSGP----LEEGKPVTVKCEVPDVYPFDRLEIELLK   39 (99)
T ss_pred             ccCcccCc----ccCCceEEEEEEecCcccCCceEEEEec
Confidence            44444444    357888999999995 454  6799986


No 177
>cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM). IG_CEACAM_D1: immunoglobulin (Ig)-like domain 1 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surface. This family corresponds to the D
Probab=88.21  E-value=1.4  Score=27.35  Aligned_cols=24  Identities=8%  Similarity=0.285  Sum_probs=18.9

Q ss_pred             ecCCCCeEEEEEEcccCCC--eEEEEeC
Q psy11558         31 FSNTTGAQVECTARGSPNP--EIIWIRS   56 (74)
Q Consensus        31 ~~~g~~v~L~C~A~G~P~P--~I~W~~~   56 (74)
                      ..+|.++.|+|  ++.|.+  .++|++.
T Consensus        10 ~~~G~~V~L~v--~~~p~~~~~~~W~kg   35 (105)
T cd05774          10 VAEGENVLLLV--HNLPENLLAYAWYKG   35 (105)
T ss_pred             ccCCCCEEEEe--cCCCCCceEEEEEcC
Confidence            35788899997  556777  9999984


No 178
>cd07692 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of CD3 epsilon chain. Ig_CD3_epsilon; immunoglobulin (Ig)-like domain of CD3 epsilon chain. CD3 is a T cell surface receptor that is associated with alpha/beta T cell receptors (TCRs).  The CD3 complex consists of one gamma, one delta, two epsilon, and two zeta chains.  The CD3 subunits form heterodimers as gamma/epsilon, delta/epsilon, and zeta/zeta.  The gamma, delta, and epsilon chains each contain an extracellular Ig domain, whereas the extracellular domains of the zeta chains are very small and have unknown structure. The CD3 domain participates in intracellular signalling once the TCR has bound an MHC/antigen complex.
Probab=88.02  E-value=0.52  Score=27.64  Aligned_cols=25  Identities=32%  Similarity=0.659  Sum_probs=17.8

Q ss_pred             EEecCCCCeEEEEEEcccCCCeEEEEeCC
Q psy11558         29 IDFSNTTGAQVECTARGSPNPEIIWIRSD   57 (74)
Q Consensus        29 v~~~~g~~v~L~C~A~G~P~P~I~W~~~d   57 (74)
                      |.++ |++|+|.|.-.+..   |.|.+++
T Consensus         3 Vsis-GTtVtlTCP~~~~~---i~W~~n~   27 (65)
T cd07692           3 VSIS-GTTVTVTCPLSGDD---IKWKKND   27 (65)
T ss_pred             EEEe-ccEEEEECCCCCCC---ceEEeCC
Confidence            4454 66799999866433   9999754


No 179
>cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG). Ig_Aggrecan_like: immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG)s. Included in this group are the Ig domains of other CSPGs: versican, and neurocan. In CSPGs this Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggrecan and versican have a wide distribution in connective tissue and extracellular matrices. Neurocan is localized almost exclusively in nervous tissue. Aggregates having other CSPGs substi
Probab=87.94  E-value=0.95  Score=27.89  Aligned_cols=24  Identities=21%  Similarity=0.531  Sum_probs=19.4

Q ss_pred             CCCeEEEEEEcccCC----------CeEEEEeCC
Q psy11558         34 TTGAQVECTARGSPN----------PEIIWIRSD   57 (74)
Q Consensus        34 g~~v~L~C~A~G~P~----------P~I~W~~~d   57 (74)
                      |++|+|.|..+.++.          ..|.|.+.+
T Consensus         2 G~~V~LpC~~~~~~~~~~~~~~~~~~~i~W~k~~   35 (110)
T cd05878           2 SSSVLLPCYFTLPPALPPPSNAPESPRIKWTKLS   35 (110)
T ss_pred             CCCEEEeeEeeCCccccccccCCCCCEEEEEEec
Confidence            668999999988763          669999863


No 180
>smart00406 IGv Immunoglobulin V-Type.
Probab=87.56  E-value=1  Score=24.77  Aligned_cols=21  Identities=24%  Similarity=0.591  Sum_probs=17.5

Q ss_pred             eEEEEEEcccCCC--eEEEEeCC
Q psy11558         37 AQVECTARGSPNP--EIIWIRSD   57 (74)
Q Consensus        37 v~L~C~A~G~P~P--~I~W~~~d   57 (74)
                      |.|.|...+...+  .+.|.+..
T Consensus         2 v~l~C~~~~~~~~~~~v~W~~~~   24 (81)
T smart00406        2 VTLSCKASGFTFSSYYVSWVRQP   24 (81)
T ss_pred             EEEEEEEeccccceeEEEEEEeC
Confidence            7899999987765  89999854


No 181
>cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG). Ig_MOG_like:  immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG). MOG, a minor component of the myelin sheath, is an important CNS-specific autoantigen, linked to the pathogenesis of multiple sclerosis (MS) and experimental autoimmune encephalomyelitis (EAE). It is a transmembrane protein having an extracellular Ig domain. MOG is expressed in the CNS on the outermost lamellae of the myelin sheath, and on the surface of oligodendrocytes, and may participate in the completion, compaction, and/or maintenance of myelin. This group also includes butyrophilin (BTN). BTN is the most abundant protein in bovine milk-fat globule membrane (MFGM).
Probab=86.90  E-value=1.7  Score=25.60  Aligned_cols=25  Identities=24%  Similarity=0.416  Sum_probs=17.0

Q ss_pred             CCCeEEEEEEcccC---CCeEEEEeCCC
Q psy11558         34 TTGAQVECTARGSP---NPEIIWIRSDG   58 (74)
Q Consensus        34 g~~v~L~C~A~G~P---~P~I~W~~~dG   58 (74)
                      |++|.|.|.-.+..   ...|.|.+.+.
T Consensus         1 G~~v~L~C~~~~~~~~~~~~v~W~k~~~   28 (100)
T cd05713           1 GEDAELPCHLSPKMSAEHMEVRWFRSQF   28 (100)
T ss_pred             CCcEEEEeEEcCCCCCCeeEEEEEECCC
Confidence            45799999986432   23688987553


No 182
>cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins. Ig1_ MRC-OX-2_like: domain similar to the first immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200). MRC OX-2 is a membrane glycoprotein expressed in a variety of lymphoid and non-lymphoid cells in rats. It has a similar broad distribution pattern in humans. MRC OX-2 may regulate myeloid cell activity. The protein has an extracellular portion containing two Ig-like domains, a transmembrane portion, and a cytoplasmic portion.
Probab=86.48  E-value=1.3  Score=26.30  Aligned_cols=25  Identities=12%  Similarity=0.407  Sum_probs=17.9

Q ss_pred             CCCeEEEEEEcccCCC-eEEEEeCCC
Q psy11558         34 TTGAQVECTARGSPNP-EIIWIRSDG   58 (74)
Q Consensus        34 g~~v~L~C~A~G~P~P-~I~W~~~dG   58 (74)
                      |++|+|.|.-...... .|.|.+.++
T Consensus         1 G~~vtL~C~~~~~~~~~~v~W~k~~~   26 (97)
T cd05846           1 GGNVTLSCNLTLPEEVLQVTWQKIQG   26 (97)
T ss_pred             CCcEEEEEEeCCCCeeEEEEEEEcCC
Confidence            5679999986654333 599998654


No 183
>PHA03376 BARF1; Provisional
Probab=85.63  E-value=0.64  Score=33.11  Aligned_cols=26  Identities=27%  Similarity=0.682  Sum_probs=22.0

Q ss_pred             CCCeEEEEEEcccCCCeEEEEeCCCe
Q psy11558         34 TTGAQVECTARGSPNPEIIWIRSDGT   59 (74)
Q Consensus        34 g~~v~L~C~A~G~P~P~I~W~~~dG~   59 (74)
                      -.--.+.|...|-|.|.++|..++|.
T Consensus       139 ~~~~~i~C~sggfP~P~~~Wle~~~~  164 (221)
T PHA03376        139 FSVLTVTCTVNAFPHPHVQWLMPEGV  164 (221)
T ss_pred             CCeeEEEEecCCcCCchheeccccCC
Confidence            33478999999999999999987775


No 184
>cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan. Ig_Neurocan: immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan. In CSPGs, the Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, the CSPG aggrecan (not included in this group) forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Unlike aggrecan which is widely distributed in connective tissue and extracellular matrices, neurocan is localized almost exclusively in nervous tissue. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many differen
Probab=81.44  E-value=2.4  Score=26.57  Aligned_cols=23  Identities=22%  Similarity=0.585  Sum_probs=17.3

Q ss_pred             CCCeEEEEEEcccC-------CCeEEEEeC
Q psy11558         34 TTGAQVECTARGSP-------NPEIIWIRS   56 (74)
Q Consensus        34 g~~v~L~C~A~G~P-------~P~I~W~~~   56 (74)
                      |+++.|.|.-+-.|       .|.|+|.+.
T Consensus         2 ~~~v~LpC~~~~~p~~~~~~~~~~I~W~k~   31 (110)
T cd05902           2 SSSVLLPCVFTLPPSASSPPEGPRIKWTKL   31 (110)
T ss_pred             CCcEEEeeEEEcCccccCCCCCCEEEEEEe
Confidence            55799999955333       589999974


No 185
>KOG3515|consensus
Probab=77.04  E-value=5.1  Score=33.15  Aligned_cols=36  Identities=19%  Similarity=0.329  Sum_probs=28.9

Q ss_pred             CeEEEEEEcccCCCeEEEEeCCCeeecCCCCceEEEE
Q psy11558         36 GAQVECTARGSPNPEIIWIRSDGTAVGDVPGLRKYKY   72 (74)
Q Consensus        36 ~v~L~C~A~G~P~P~I~W~~~dG~~i~~~~~~r~~~~   72 (74)
                      .++.+|.|.|.|.+..+|.+ ++.+....+.++.+-|
T Consensus       611 ~as~~~~a~~~~~~~~~~~k-~p~~~~~~~~~~~~~~  646 (741)
T KOG3515|consen  611 NASDDCVASGVPSTSFTTAK-TPLQTTEGPHIREKAT  646 (741)
T ss_pred             cccccceecccccceeeccc-CCCcccCCceEEEeee
Confidence            49999999999999999985 7777667776665433


No 186
>cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like. Ig_SLAM-CD84_like_N: The N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like. The SLAM family is a group of immune-cell specific receptors that can regulate both adaptive and innate immune responses. Members of this group include proteins such as CD84, SLAM (CD150), Ly-9 (CD229), NTB-A (ly-108, SLAM6), 19A (CRACC), and SLAMF9. The genes coding for the SLAM family are nested on chromosome 1, in humans at 1q23, and in mice at 1H2. The SLAM family is a subset of the CD2 family, which also includes CD2 and CD58 located on chromosome 1 at 1p13 in humans. In mice, CD2 is located on chromosome 3, and there is no CD58 homolog. The SLAM family proteins are organized as an extracellular domain with either two or four Ig-like domains, a single transmembrane segment, and a cytoplasmic region 
Probab=76.72  E-value=2.2  Score=25.51  Aligned_cols=24  Identities=8%  Similarity=0.077  Sum_probs=19.6

Q ss_pred             CCCCeEEEEEEcc-cCCCeEEEEeC
Q psy11558         33 NTTGAQVECTARG-SPNPEIIWIRS   56 (74)
Q Consensus        33 ~g~~v~L~C~A~G-~P~P~I~W~~~   56 (74)
                      .|++|+|.|...- ...-.|.|++.
T Consensus         3 ~G~sVtL~c~~~~~~~~~~v~W~~~   27 (97)
T cd05775           3 LGGSVTLPLNIPDGTEIESITWSFN   27 (97)
T ss_pred             cCCeEEEeCCCCCCcEEEEEEEecC
Confidence            4778999998865 66778999975


No 187
>cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1). Ig1_ IL1RAPL-1_like: domain similar to the first immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1).  IL-1 alpha and IL-1 beta are cytokines which participates in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three Ig-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of 
Probab=76.14  E-value=5.3  Score=25.25  Aligned_cols=28  Identities=14%  Similarity=0.374  Sum_probs=20.1

Q ss_pred             EEecCCCCeEEEEEE------c-----ccCCCeEEEEeC
Q psy11558         29 IDFSNTTGAQVECTA------R-----GSPNPEIIWIRS   56 (74)
Q Consensus        29 v~~~~g~~v~L~C~A------~-----G~P~P~I~W~~~   56 (74)
                      ..+.+|+.+.|.|..      +     -++.-+|+|.++
T Consensus        10 ~~~~~GE~v~l~C~~~~~~~~~~~~~~~~~~~~v~WyK~   48 (104)
T cd05896          10 YMVLAGEPVRIKCALFYGYIRTNYSMAQSAGLSLMWYKS   48 (104)
T ss_pred             EEEcCCCeEEEECCCccccccccccccccCCceEEEEEC
Confidence            445678889999997      1     223458999984


No 188
>cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican. Ig_Versican: immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican. In CSPGs, the Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, the CSPG aggrecan (not included in this group) forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Like aggrecan, versican has a wide distribution in connective tissue and extracellular matrices. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many different tissues. Members of the vertebrate HPLN (hyaluronan/HA
Probab=68.67  E-value=8.5  Score=24.62  Aligned_cols=23  Identities=17%  Similarity=0.420  Sum_probs=18.0

Q ss_pred             CCCeEEEEEEcccCC-----------CeEEEEeC
Q psy11558         34 TTGAQVECTARGSPN-----------PEIIWIRS   56 (74)
Q Consensus        34 g~~v~L~C~A~G~P~-----------P~I~W~~~   56 (74)
                      |++++|.|.-+-.|.           +.|+|.+-
T Consensus         2 ~g~v~LPC~f~~~p~~p~~~~~~~~~~rIkW~~~   35 (117)
T cd05901           2 SGSVVLPCRFSTLPTLPPSVITTSEFLRIKWTKI   35 (117)
T ss_pred             CCCEEEeeEEEecCCCCCcccCCCCCcEEEEEEe
Confidence            456999999997662           48999874


No 189
>PHA03112 IL-18 binding protein; Provisional
Probab=63.04  E-value=11  Score=25.18  Aligned_cols=25  Identities=20%  Similarity=0.534  Sum_probs=20.0

Q ss_pred             CCCCeEEEEEEccc-CC-CeEEEEeCC
Q psy11558         33 NTTGAQVECTARGS-PN-PEIIWIRSD   57 (74)
Q Consensus        33 ~g~~v~L~C~A~G~-P~-P~I~W~~~d   57 (74)
                      +++.+.|+|.|-+. |. --+-|...|
T Consensus        37 ~~~~vvL~C~gcs~fp~fS~lYWl~gn   63 (141)
T PHA03112         37 ETEKVVLECRGCSYFPKFSYVYWLIGN   63 (141)
T ss_pred             CCCEEEEEEECccCCCCceEEEEEcCC
Confidence            45569999999987 74 678999665


No 190
>PF11910 NdhO:  Cyanobacterial and plant NDH-1 subunit O;  InterPro: IPR020905 NAD(P)H-quinone oxidoreductase (NDH-1) shuttles electrons from an unknown electron donor, via FMN and iron-sulphur (Fe-S) centres, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. It couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon-concentration. NDH-1 can be composed of about 15 different subunits, although different subcomplexes with different compositions have been identified which probably have different functions. This entry represents subunit O. ; GO: 0016655 oxidoreductase activity, acting on NADH or NADPH, quinone or similar compound as acceptor, 0055114 oxidation-reduction process, 0005886 plasma membrane
Probab=61.94  E-value=13  Score=22.03  Aligned_cols=40  Identities=33%  Similarity=0.533  Sum_probs=25.1

Q ss_pred             CCCccceEEEcCCCcEEecCCCCeEEEEEEcccCCCeEEEEeCC
Q psy11558         14 DDTLGPIFIKEPPNRIDFSNTTGAQVECTARGSPNPEIIWIRSD   57 (74)
Q Consensus        14 ~~~~~P~fv~~Pp~~v~~~~g~~v~L~C~A~G~P~P~I~W~~~d   57 (74)
                      ++...|..+-+-+-.+....|.-+.+.-   +.|.|.| |.+-|
T Consensus        23 SD~~~P~Yife~~GEvl~ikgdYa~vr~---~~PtP~v-WLr~d   62 (67)
T PF11910_consen   23 SDPRPPSYIFEGPGEVLDIKGDYAQVRF---RVPTPDV-WLRLD   62 (67)
T ss_pred             cCCCCCcceecCCCeEEEecCCEEEEEe---cCCCCch-hhhhh
Confidence            4555565555544544455565566653   8899999 98644


No 191
>cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins. Ig1_Nectin-1_like: domain similar to the first immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111). Nectin-1 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. In addition nectins heterophilically trans-interact with other CAMs such as nectin-like molecules (Necls), nectin-1 for example, has been shown to trans-interact with Necl-1. Nectins also interact with various other proteins, including the actin filament (F-actin)-binding protein, afadin. Mutation in the human nectin-1 gene is 
Probab=52.72  E-value=30  Score=21.03  Aligned_cols=20  Identities=20%  Similarity=0.649  Sum_probs=14.7

Q ss_pred             CeEEEEEEcccCCC-----eEEEEeC
Q psy11558         36 GAQVECTARGSPNP-----EIIWIRS   56 (74)
Q Consensus        36 ~v~L~C~A~G~P~P-----~I~W~~~   56 (74)
                      +|.|.|.=.. +.|     +|+|.+.
T Consensus         2 ~v~L~C~f~~-~~~~~~~~~V~W~k~   26 (99)
T cd05886           2 DVVLHCSFIN-PLPPVKITQVTWQKL   26 (99)
T ss_pred             cEEEEeEeec-CCCCCCeEEEEEEEC
Confidence            5899999874 333     6999875


No 192
>KOG4597|consensus
Probab=52.43  E-value=10  Score=30.28  Aligned_cols=30  Identities=7%  Similarity=0.132  Sum_probs=23.8

Q ss_pred             ecCCCCeEEEEEEcccCCCeEEEEeC--CCee
Q psy11558         31 FSNTTGAQVECTARGSPNPEIIWIRS--DGTA   60 (74)
Q Consensus        31 ~~~g~~v~L~C~A~G~P~P~I~W~~~--dG~~   60 (74)
                      +..+++.+++|-+.|.|.|.|+|-+-  |+..
T Consensus       208 vg~wetcS~tCg~~G~q~r~V~c~qv~anr~~  239 (560)
T KOG4597|consen  208 VGDWETCSSTCGVQGRQYRVVTCEQVFANREN  239 (560)
T ss_pred             cccchhhcccccccCCcCceeeeehhhccccc
Confidence            45666799999999999999999643  5543


No 193
>KOG1026|consensus
Probab=49.91  E-value=15  Score=30.65  Aligned_cols=25  Identities=20%  Similarity=0.579  Sum_probs=21.5

Q ss_pred             cCCCCeEEEEEEcccCCCeEEEEeC
Q psy11558         32 SNTTGAQVECTARGSPNPEIIWIRS   56 (74)
Q Consensus        32 ~~g~~v~L~C~A~G~P~P~I~W~~~   56 (74)
                      ..+..+++.|++.|.|.|.+.|+..
T Consensus       205 ~~~~~~~~~c~~~~~~vp~~~~~~~  229 (774)
T KOG1026|consen  205 EEGSSITLKCSQAGIPVPCHYWFPN  229 (774)
T ss_pred             cccchheeeeecccCCCcceeeecc
Confidence            3455699999999999999999964


No 194
>cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins. Ig1_Nectin-4_like: domain similar to the first immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor). Nectin-4 belongs to the nectin family, which is comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which participate in adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. For example nectin-4 trans-interacts with nectin-1. Nectin-4 has also been shown to interact with the actin filament-binding protein, afadin. Unlike the other nectins, which are widely expressed in adult tissues, nectin-4 is mainly expressed during embryogenesis, and is not detected in normal adult 
Probab=48.77  E-value=24  Score=20.96  Aligned_cols=21  Identities=24%  Similarity=0.601  Sum_probs=16.2

Q ss_pred             CeEEEEEEcccC---CCeEEEEeC
Q psy11558         36 GAQVECTARGSP---NPEIIWIRS   56 (74)
Q Consensus        36 ~v~L~C~A~G~P---~P~I~W~~~   56 (74)
                      +|.|.|.=.-.+   .-.|+|.+.
T Consensus         2 ~v~L~C~~~~~~~~~~~~v~W~k~   25 (100)
T cd05888           2 DTRLPCRYNVSDGETVVQVLWIRE   25 (100)
T ss_pred             CEEEEeEEecCCCCcEEEEEEEEc
Confidence            589999887554   448999974


No 195
>PF06328 Lep_receptor_Ig:  Ig-like C2-type domain;  InterPro: IPR010457 This entry represents a ligand-binding domain that displays similarity to C2-set immunoglobulin domains (antibody constant domain 2) []. The two cysteine residues form a disulphide bridge.; PDB: 3L5H_A 1P9M_A 1I1R_A 2D9Q_B.
Probab=48.60  E-value=59  Score=19.59  Aligned_cols=36  Identities=19%  Similarity=0.563  Sum_probs=24.0

Q ss_pred             cCCCcEEecCCCCeEEEEEEc-----ccCCCeEEEEeCCCeee
Q psy11558         24 EPPNRIDFSNTTGAQVECTAR-----GSPNPEIIWIRSDGTAV   61 (74)
Q Consensus        24 ~Pp~~v~~~~g~~v~L~C~A~-----G~P~P~I~W~~~dG~~i   61 (74)
                      .|+..+ +..|+.++..|.-.     +.....|-|+. |+..+
T Consensus         9 ~p~~pv-v~lGS~vtasC~l~~~c~~~~~a~~I~Wkl-n~~~i   49 (89)
T PF06328_consen    9 SPPSPV-VSLGSNVTASCVLKQNCSHSVNASQIVWKL-NGEKI   49 (89)
T ss_dssp             ECSSSE-EETTS-EEEEEEE-CCCHCT-STTCEEEEC-SSCES
T ss_pred             ecCCCE-EeCCCCEEEEEEEECCCCCCcccceEEEEE-CCEEC
Confidence            345554 56788899999887     34778899997 55543


No 196
>cd07691 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain of CD3 gamma and delta chains. Ig_CD3_gamma_delta; immunoglobulin (Ig)-like domain of CD3 gamma and delta chains. CD3 is a T cell surface receptor that is associated with alpha/beta T cell receptors (TCRs).  The CD3 complex consists of one gamma, one delta, two epsilon, and two zeta chains.  The CD3 subunits form heterodimers as gamma/epsilon, delta/epsilon, and zeta/zeta.  The gamma, delta, and epsilon chains each contain an extracellular Ig domain, whereas the extracellular domains of the zeta chains are very small and have unknown structure. The CD3 domain participates in intracellular signalling once the TCR has bound an MHC/antigen complex.
Probab=48.41  E-value=28  Score=20.63  Aligned_cols=22  Identities=18%  Similarity=0.585  Sum_probs=15.6

Q ss_pred             CeEEEEEEcccCCCeEEEEeCCCeeecC
Q psy11558         36 GAQVECTARGSPNPEIIWIRSDGTAVGD   63 (74)
Q Consensus        36 ~v~L~C~A~G~P~P~I~W~~~dG~~i~~   63 (74)
                      +|.|.|.+.    -+|+|++  |..+..
T Consensus         8 ~V~L~C~~~----tsi~W~k--G~~~~~   29 (69)
T cd07691           8 KVFLKCNGA----TNITWKK--GKEILE   29 (69)
T ss_pred             eEEEEecCC----CcEEEec--Cccccc
Confidence            599999762    4599996  554443


No 197
>cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins. Ig1_DNAM-1_like: domain similar to the first immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226). DNAM-1 is a transmembrane protein having two Ig-like domains. It is an adhesion molecule which plays a part in tumor-directed cytotoxicity and adhesion in natural killer (NK) cells and T lymphocytes. It has been shown to regulate the NK cell killing of several tumor types, including myeloma cells and ovarian carcinoma cells. DNAM-1 interacts specifically with poliovirus receptor (PVR; CD155) and nectin -2 (CD211), other members of the Ig superfamily. DNAM-1 is expressed in most peripheral T cells, NK cells, monocytes and a subset of B lymphocytes.
Probab=40.09  E-value=41  Score=20.38  Aligned_cols=23  Identities=17%  Similarity=0.499  Sum_probs=16.7

Q ss_pred             CeEEEEEEccc-CCCeEEEEeCCC
Q psy11558         36 GAQVECTARGS-PNPEIIWIRSDG   58 (74)
Q Consensus        36 ~v~L~C~A~G~-P~P~I~W~~~dG   58 (74)
                      +++|.|.-... ...+|+|.+.++
T Consensus         2 ~vtL~C~~~~~~~~~qV~W~k~~~   25 (96)
T cd05889           2 KMKLECVYPKTGVLIQVSWTKHNG   25 (96)
T ss_pred             CEEEEeEcCCCCcEEEEEEEEcCC
Confidence            58899987632 367788998754


No 198
>PF03921 ICAM_N:  Intercellular adhesion molecule (ICAM), N-terminal domain;  InterPro: IPR013768 Intercellular adhesion molecules (ICAMs) and vascular cell adhesion molecule-1 (VCAM-1) are part of the immunoglobulin superfamily. They are important in inflammation, immune responses and in intracellular signalling events []. The ICAM family consists of five members, designated ICAM-1 to ICAM-5. They are known to bind to leucocyte integrins CD11/CD18 during inflammation and in immune responses. In addition, ICAMs may exist in soluble forms in human plasma, due to activation and proteolysis mechanisms at cell surfaces. ICAM-1 (CD54) contains five Ig-like domains. It is expressed on leucocytes, endothelial and epithelial cells, and is upregulated in response to bacterial invasion. The protein is a ligand for lymphocyte-function associated (LFA) antigens and also a receptor for CD11a,b/CD18, fibrinogen, human rhinovirus and Plasmodium falciparum-infected erythrocytes. ICAM-1 binding sites for CD11a/CD18 and its other binding partners are located in the first domain and are overlapping. ICAM-1 domain 2 seems to play an important role in maintaining the conformation of domain 1 and particularly the structural integrity of the LFA-1 ligand-binding site []. The 3-dimensional atomic structure of the tandem N-terminal Ig-like domains (D1 and D2) of ICAM-1 has been determined to 2.2A resolution and fitted into a cryoelectron microscopy reconstruction of a rhinovirus-ICAM-1 complex []. Extensive charge interactions between ICAM-1 and human rhinovirusesare largely conserved in major and minor receptor groups of rhinoviruses. The interaction of ICAMs with LFA-1 is mediated by a divalent cation bound to the insertion (I)-domain on the alpha chain of LFA-1 and the carboxyl group of a conserved glutamic acid residue on ICAMs. ICAM-2 (CD102) has two Ig-like domains. It is expressed on endothelial cells, leucocytes and platelets, and binds to CD11a'b/CD18. The protein is refractory to proinflammatory cytokines, and plays an important role in the adhesion of leucocytes to the uninduced endothelium []. ICAM-3 (CD50) contains five Ig-like domains and binds to leucocyte integrins CD11a'd/CD18. The protein plays an important role in the immune response and perhaps in signal transduction []. ICAM-4 (LW blood group Ag) is red blood cell (RBC) specific and binds to CD11a'b/CD18. It is associated with the RBC Rh antigens and could be important in retaining immature red cells in the bone marrow, or in the uptake of senescent cells into the spleen []. ICAM-5 (telencephalin) has nine Ig-like domains and is confined to the telencephalon of the brain. The role of this CD11a/CD18 binding molecule is not yet known []. VCAM-1 was first described as a cytokine-inducible endothelial adhesion molecule. It can bind to leucocyte integrin VL-4 (very late antigen-4) to recruit leucocytes to sites of inflammation []. The predominant form of VCAM-1 in vivo has an N-terminal extracellular region comprising seven Ig-like domains []. A conserved integrin-binding motif has been identified in domains 1 and 4, variants of which are present in the N-terminal domain of all members of the integrin-binding subgroup of the immunoglobulin superfamily. The structure of a VLA-4-binding fragment comprising the first two domains of VCAM-1 has been determined to 1.8A resolution. The integrin-binding motif is exposed and forms the N-terminal region of the loop between beta-strands C and D of domain 1 []. VCAM-1 domains 1 and 2 are structurally similar to ICAM-1 and ICAM-2 []. This entry represents the N-terminal domain of ICAM proteins such as ICAM-2, ICAM-3 and ICAM-4.; PDB: 3BN3_B 1T0P_B 1ZXQ_A 3TCX_A 1MQ8_A 1Z7Z_I 1IC1_A 1IAM_A.
Probab=37.82  E-value=37  Score=20.86  Aligned_cols=31  Identities=23%  Similarity=0.305  Sum_probs=19.7

Q ss_pred             EcCCCcEEecCCCCeEEEEEEcccCCCe-EEEEe
Q psy11558         23 KEPPNRIDFSNTTGAQVECTARGSPNPE-IIWIR   55 (74)
Q Consensus        23 ~~Pp~~v~~~~g~~v~L~C~A~G~P~P~-I~W~~   55 (74)
                      ..| +...+..|+++.++|+.+= |+|. +.|-.
T Consensus         8 v~P-~~~vV~~G~Sv~VNCStsC-~~p~~~GLET   39 (91)
T PF03921_consen    8 VSP-EEPVVPPGGSVWVNCSTSC-PQPEKIGLET   39 (91)
T ss_dssp             EES-SEEEEETTEEEEEEEEESS-SS-SEEEEES
T ss_pred             EEC-CccEECCCCCEEEEEcCCC-CCCCcceEEE
Confidence            344 4445677888999999853 6664 45543


No 199
>smart00089 PKD Repeats in polycystic kidney disease 1 (PKD1) and other proteins. Polycystic kidney disease 1 protein contains 14 repeats, present elsewhere such as in microbial collagenases.
Probab=36.43  E-value=78  Score=17.46  Aligned_cols=28  Identities=18%  Similarity=0.247  Sum_probs=20.7

Q ss_pred             CCCCeEEEEEEcc-cCCCeEEEEeCCCee
Q psy11558         33 NTTGAQVECTARG-SPNPEIIWIRSDGTA   60 (74)
Q Consensus        33 ~g~~v~L~C~A~G-~P~P~I~W~~~dG~~   60 (74)
                      .+..+.|.+...+ .....++|.+.||..
T Consensus        13 ~~~~v~f~~~~~~~~~~~~~~W~fgdg~~   41 (79)
T smart00089       13 AGESVTFTATSSDDGSIVSYTWDFGDGTS   41 (79)
T ss_pred             CCCEEEEEEECCCCCCeEEEEEEeCCCCc
Confidence            3556888888776 456788999888854


No 200
>PF05428 CRF-BP:  Corticotropin-releasing factor binding protein (CRF-BP);  InterPro: IPR008435 This family consists of several eukaryotic corticotropin-releasing factor binding proteins (CRF-BP or CRH-BP). Corticotropin-releasing hormone (CRH) plays multiple roles in vertebrate species. In mammals, it is the major hypothalamic releasing factor for pituitary adrenocorticotropin secretion, and is a neurotransmitter or neuromodulator at other sites in the central nervous system. In non-mammalian vertebrates, CRH not only acts as a neurotransmitter and hypophysiotropin, it also acts as a potent thyrotropin-releasing factor, allowing CRH to regulate both the adrenal and thyroid axes, especially in development. CRH-BP is thought to play an inhibitory role in which it binds CRH and other CRH-like ligands and prevents the activation of CRH receptors. There is however evidence that CRH-BP may also exhibit diverse extra and intracellular roles in a cell specific fashion and at specific times in development [].
Probab=36.16  E-value=61  Score=24.37  Aligned_cols=32  Identities=19%  Similarity=0.376  Sum_probs=22.6

Q ss_pred             cCCCccceEEEcCCCcEEecCCCCeEEEEEEcc
Q psy11558         13 EDDTLGPIFIKEPPNRIDFSNTTGAQVECTARG   45 (74)
Q Consensus        13 ~~~~~~P~fv~~Pp~~v~~~~g~~v~L~C~A~G   45 (74)
                      ....-+-.|+-+|.+.+++.-. .+.++|.+.|
T Consensus        77 pq~~Ca~y~iaePd~~IeI~~~-~vdidC~~G~  108 (311)
T PF05428_consen   77 PQLVCAAYFIAEPDELIEIEFD-HVDIDCEGGD  108 (311)
T ss_pred             CCceeEEEEEeCCCeEEEEEEE-EeeccCCCCC
Confidence            3334466899998877766543 5999999865


No 201
>PHA02865 MHC-like TNF binding protein; Provisional
Probab=35.92  E-value=59  Score=24.66  Aligned_cols=21  Identities=19%  Similarity=0.319  Sum_probs=16.3

Q ss_pred             CeEEEEEEcccCCC--eEEEEeC
Q psy11558         36 GAQVECTARGSPNP--EIIWIRS   56 (74)
Q Consensus        36 ~v~L~C~A~G~P~P--~I~W~~~   56 (74)
                      .+.|.|.|.|-=+.  +++|.++
T Consensus       216 ~~tL~C~A~GFYP~~I~v~W~kd  238 (338)
T PHA02865        216 NTTLFCTFDSHYPSSVAAKWYNS  238 (338)
T ss_pred             CceEEEEEEeEeCCccEEEEEec
Confidence            47999999996444  4679975


No 202
>PF08204 V-set_CD47:  CD47 immunoglobulin-like domain;  InterPro: IPR013270 This family represents the CD47 leukocyte antigen V-set like Ig domain [, ].; PDB: 2VSC_B 2JJS_D 2JJT_C.
Probab=33.92  E-value=40  Score=22.09  Aligned_cols=26  Identities=8%  Similarity=0.232  Sum_probs=16.3

Q ss_pred             CCeEEEEEEccc-----CCCeEEEEeCCCeee
Q psy11558         35 TGAQVECTARGS-----PNPEIIWIRSDGTAV   61 (74)
Q Consensus        35 ~~v~L~C~A~G~-----P~P~I~W~~~dG~~i   61 (74)
                      ++|.|+|.+..-     +.=.|+|++ +|..|
T Consensus        28 ~tV~IPC~v~n~~~~ni~~m~VkWk~-~~~~I   58 (130)
T PF08204_consen   28 DTVVIPCFVNNLEANNISEMYVKWKF-KNKDI   58 (130)
T ss_dssp             SEEEE--BBSS---SSGGGEEEEEEE-TTEEE
T ss_pred             CCEEEEeEeccccccccceEEEEEEE-CCeEE
Confidence            359999999862     333499998 56654


No 203
>PRK14051 negative regulator GrlR; Provisional
Probab=33.88  E-value=41  Score=21.92  Aligned_cols=22  Identities=23%  Similarity=0.338  Sum_probs=17.6

Q ss_pred             cCCCCeEEEEEEcccCCCeEEE
Q psy11558         32 SNTTGAQVECTARGSPNPEIIW   53 (74)
Q Consensus        32 ~~g~~v~L~C~A~G~P~P~I~W   53 (74)
                      +++.+++|+|.+.|+-.=.|.-
T Consensus        81 sn~~~~~l~~HV~~Nekl~vdv  102 (123)
T PRK14051         81 SNDNNLTLHCHVRGNEKLFVDV  102 (123)
T ss_pred             eCCCCeEEEEEEcCCcEEEEEE
Confidence            4677799999999998766653


No 204
>cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins. Ig1_Nectin-3_like: domain similar to the first immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3). Nectin-3 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which participate in adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. For example, during spermatid development, the nectin-3,-2 trans-interaction is required for the formation of Sertoli cell-spermatid junctions in testis, and during morphogenesis of the ciliary body, the nectin-3,-1 trans-interaction is important for apex-apex adhesion between the pigment and non-pigment layers of the ciliary epithelia. Nectins also
Probab=31.94  E-value=76  Score=19.22  Aligned_cols=23  Identities=13%  Similarity=0.398  Sum_probs=16.5

Q ss_pred             CeEEEEEEcccC-CCeEEEEeCCC
Q psy11558         36 GAQVECTARGSP-NPEIIWIRSDG   58 (74)
Q Consensus        36 ~v~L~C~A~G~P-~P~I~W~~~dG   58 (74)
                      ++.|.|.=...+ ...|+|.+.++
T Consensus         2 ~vtL~C~~~~~~~~~qV~W~k~~~   25 (96)
T cd05887           2 NVTLKCRIQVNETITQSSWEKIHG   25 (96)
T ss_pred             CEEEEEEecCCCcEEEEEEEEcCC
Confidence            489999987533 45799987643


No 205
>PF01681 C6:  C6 domain;  InterPro: IPR002601 This domain of unknown function is found at the C terminus in a number of Caenorhabditis elegans and Caenorhabditis briggsae proteins. It may be an extracellular domain. Most copies of the C6 domain contain six conserved cysteine residues. However some copies of the domain are missing cysteine residues 1 and 3 suggesting that these form a disulphide bridge. In Q19522 from SWISSPROT there are 18 copies of the domain.
Probab=30.63  E-value=58  Score=19.27  Aligned_cols=21  Identities=24%  Similarity=0.681  Sum_probs=16.4

Q ss_pred             eEEEEEEcccCCCeEEEEeCCCeeecC
Q psy11558         37 AQVECTARGSPNPEIIWIRSDGTAVGD   63 (74)
Q Consensus        37 v~L~C~A~G~P~P~I~W~~~dG~~i~~   63 (74)
                      +.|.|.+.|      .|....|..|+.
T Consensus        69 ~~ltCn~~g------~W~y~~g~~Its   89 (92)
T PF01681_consen   69 ITLTCNADG------QWVYTYGRVITS   89 (92)
T ss_pred             EEEEecCCC------EEEECCCEEEEE
Confidence            889998888      498657777754


No 206
>COG3908 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=27.84  E-value=75  Score=19.09  Aligned_cols=14  Identities=36%  Similarity=0.653  Sum_probs=12.0

Q ss_pred             eEEEEEEcccCCCe
Q psy11558         37 AQVECTARGSPNPE   50 (74)
Q Consensus        37 v~L~C~A~G~P~P~   50 (74)
                      -.+.|.++|.|.|-
T Consensus        29 sfV~CAVtgk~IPl   42 (77)
T COG3908          29 SFVLCAVTGKPIPL   42 (77)
T ss_pred             cEEEEEecCCcccH
Confidence            47889999999884


No 207
>PF02124 Marek_A:  Marek's disease glycoprotein A;  InterPro: IPR001038  Equid herpesvirus 1 (Equine herpesvirus 1, EHV-1) glycoprotein 13 (EHV-1 gp13) has the characteristic features of a membrane-spanning protein: an N-terminal signal sequence; a hydrophobic membrane anchor region; a charged C-terminal cytoplasmic tail; and an exterior domain with nine potential N-glycosylation sites []. EHV-1 gp13 is the structural homologue of the gC-like glycoproteins of the Human herpesvirus 1 (HHV-1) and Human herpesvirus 2 (HHV-2) (gC-1 and gC-2 respectively), Pseudorabies virus (strain Indiana-Funkhauser/Becker) (PRV) (gIII) and Human herpesvirus 3 (HHV-3) (gp66).  Secretory glycoprotein GP57-65 precursor (glycoprotein A - GA) is similar to Herpesvirus glycoprotein C, and belongs to the immunoglobulin gene superfamily [, ]. GA is thought to play an immunoevasive role in the pathogenesis of Marek's disease. It is a candidate for causing the early-stage immunosuppression that occurs after MDHV infection.
Probab=27.63  E-value=1.5e+02  Score=21.08  Aligned_cols=41  Identities=27%  Similarity=0.488  Sum_probs=29.8

Q ss_pred             CccceEEEcCCCcEEecCCCCeEEEEEEcccCCC--eEEEEeCCCe
Q psy11558         16 TLGPIFIKEPPNRIDFSNTTGAQVECTARGSPNP--EIIWIRSDGT   59 (74)
Q Consensus        16 ~~~P~fv~~Pp~~v~~~~g~~v~L~C~A~G~P~P--~I~W~~~dG~   59 (74)
                      ...|.....|.-++.|.+   ...-|.|.=.|..  +++|..+|+.
T Consensus        74 ~~~P~Vy~~P~vsv~F~~---g~AVC~A~CVP~~~v~l~W~v~d~~  116 (211)
T PF02124_consen   74 TATPSVYPKPRVSVRFED---GYAVCTARCVPRGNVTLRWSVGDDP  116 (211)
T ss_pred             ccccceecCCEEEEEecC---CEEEEEcceeeCCCeEEEEEECCcc
Confidence            346677777766777743   4788999998855  8999986653


No 208
>TIGR02073 PBP_1c penicillin-binding protein 1C. This subfamily of the penicillin binding proteins includes the member from E. coli designated penicillin-binding protein 1C. Members have both transglycosylase and transpeptidase domains and are involved in forming cross-links in the late stages of peptidoglycan biosynthesis. All members of this subfamily are presumed to have the same basic function.
Probab=27.10  E-value=2.8e+02  Score=22.81  Aligned_cols=45  Identities=20%  Similarity=0.380  Sum_probs=30.2

Q ss_pred             ceEEEcCCCcEEecCC-----CCeEEEEEEcccCCCeEEEEeCCCeeecCCC
Q psy11558         19 PIFIKEPPNRIDFSNT-----TGAQVECTARGSPNPEIIWIRSDGTAVGDVP   65 (74)
Q Consensus        19 P~fv~~Pp~~v~~~~g-----~~v~L~C~A~G~P~P~I~W~~~dG~~i~~~~   65 (74)
                      |..+..|++...+...     ....|.+.|.| ....+.|+. ||.++...+
T Consensus       644 ~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~W~~-dg~~~~~~~  693 (727)
T TIGR02073       644 SLIISPPLDGIYILRDPDGPKAALLLVLIAAG-GASGLYWFL-DGKLLGEAL  693 (727)
T ss_pred             CcEEecCCCCcEEecCCCCCcccceEEEEecC-CCCceEEEE-CCEEecccC
Confidence            5556665555444322     23678888887 778899996 899986543


No 209
>cd00146 PKD polycystic kidney disease I (PKD) domain; similar to other cell-surface modules, with an IG-like fold; domain probably functions as a ligand binding site in protein-protein or protein-carbohydrate interactions; a single instance of the repeat is presented here. The domain is also found in microbial collagenases and chitinases.
Probab=26.58  E-value=1.2e+02  Score=16.69  Aligned_cols=25  Identities=12%  Similarity=0.198  Sum_probs=18.7

Q ss_pred             CCCeEEEEEEccc-CCCeEEEEeCCC
Q psy11558         34 TTGAQVECTARGS-PNPEIIWIRSDG   58 (74)
Q Consensus        34 g~~v~L~C~A~G~-P~P~I~W~~~dG   58 (74)
                      +..+.++....+. ....++|.+.||
T Consensus        14 ~~~v~~~~~~~~~~~~~~~~W~fgdg   39 (81)
T cd00146          14 GASVTFSASDSSGGSIVSYKWDFGDG   39 (81)
T ss_pred             CccEEEEEEeCCCCCEEEEEEEeCCC
Confidence            4567787777764 567889999887


No 210
>PF10094 DUF2332:  Uncharacterized protein conserved in bacteria (DUF2332);  InterPro: IPR011200 This is a family of uncharacterised bacterial proteins.
Probab=23.66  E-value=72  Score=24.03  Aligned_cols=29  Identities=21%  Similarity=0.418  Sum_probs=21.2

Q ss_pred             CCCCeEEEEEEcccC----CCeEEEEeCCCeeecC
Q psy11558         33 NTTGAQVECTARGSP----NPEIIWIRSDGTAVGD   63 (74)
Q Consensus        33 ~g~~v~L~C~A~G~P----~P~I~W~~~dG~~i~~   63 (74)
                      .++.++|.|...|.+    .|.|.|..  |-.+++
T Consensus       168 ~~s~v~l~~~~~G~~pp~~~p~V~~R~--G~Dl~P  200 (343)
T PF10094_consen  168 ADSPVRLSPEWRGPPPPLPDPEVVSRA--GCDLNP  200 (343)
T ss_pred             CCCCcEecccccCCCCCCCCCceEEEE--ecCCCC
Confidence            344599999999986    46788875  655554


No 211
>PF09866 DUF2093:  Uncharacterized protein conserved in bacteria (DUF2093);  InterPro: IPR018661  This family of various hypothetical prokaryotic proteins has no known function. 
Probab=22.50  E-value=75  Score=17.14  Aligned_cols=13  Identities=38%  Similarity=0.859  Sum_probs=11.2

Q ss_pred             eEEEEEEcccCCC
Q psy11558         37 AQVECTARGSPNP   49 (74)
Q Consensus        37 v~L~C~A~G~P~P   49 (74)
                      ....|.++|.+-|
T Consensus         6 ~~V~CAVTg~~Ip   18 (42)
T PF09866_consen    6 SFVRCAVTGQPIP   18 (42)
T ss_pred             CEEEEEeeCCccc
Confidence            5789999999877


No 212
>PF11386 VERL:  Vitelline envelope receptor for lysin;  InterPro: IPR021526  VERL, the egg vitelline envelope (VE) receptor for lysin, is a giant unbranched glycoprotein comprising 30% of the vitelline envelope. Lysin binds to VERL and creates a hole as VERL molecules lose cohesion and splay apart. These proteins are important in the mediation of fertilisation [].
Probab=21.99  E-value=78  Score=19.20  Aligned_cols=12  Identities=33%  Similarity=0.659  Sum_probs=10.7

Q ss_pred             eEEEEEEcccCC
Q psy11558         37 AQVECTARGSPN   48 (74)
Q Consensus        37 v~L~C~A~G~P~   48 (74)
                      .+++|-..|+|.
T Consensus        61 ~si~C~v~ks~~   72 (78)
T PF11386_consen   61 LSIECYVPKSPT   72 (78)
T ss_pred             eEEEEeccCCCC
Confidence            899999999883


Done!