Query         psy11568
Match_columns 116
No_of_seqs    103 out of 1488
Neff          10.7
Searched_HMMs 46136
Date          Fri Aug 16 21:49:03 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy11568.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/11568hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3513|consensus               99.7 3.9E-16 8.4E-21  112.6  10.5   99    1-115   360-461 (1051)
  2 KOG3513|consensus               99.7 5.5E-16 1.2E-20  111.8  10.7   96    1-115   270-366 (1051)
  3 KOG4221|consensus               99.6 4.3E-14 9.3E-19  102.9   9.7   97    1-116   266-364 (1381)
  4 KOG4222|consensus               99.5 2.9E-14 6.3E-19  103.2   6.8   98    2-115   162-260 (1281)
  5 KOG4194|consensus               99.5 7.6E-14 1.7E-18   96.3   8.3   97    1-115   641-742 (873)
  6 cd05867 Ig4_L1-CAM_like Fourth  99.5   1E-12 2.3E-17   69.3   8.1   58    1-65     15-74  (76)
  7 cd05892 Ig_Myotilin_C C-termin  99.5 8.7E-13 1.9E-17   69.5   7.5   53    1-61     12-69  (75)
  8 cd05850 Ig1_Contactin-2 First   99.4 3.2E-12   7E-17   70.1   8.7   60    1-66     33-92  (94)
  9 PHA02785 IL-beta-binding prote  99.4 6.4E-12 1.4E-16   83.0  11.5   95    1-115   155-258 (326)
 10 cd05852 Ig5_Contactin-1 Fifth   99.4 1.7E-12 3.7E-17   68.0   7.1   52    1-61     15-67  (73)
 11 cd05848 Ig1_Contactin-5 First   99.4 2.2E-12 4.8E-17   70.8   7.8   57    1-63     33-89  (94)
 12 cd05893 Ig_Palladin_C C-termin  99.4 2.1E-12 4.5E-17   68.0   7.2   53    1-61     12-69  (75)
 13 cd05874 Ig6_NrCAM Sixth immuno  99.4 4.3E-12 9.4E-17   67.1   8.1   63    1-66     12-76  (77)
 14 cd04976 Ig2_VEGFR Second immun  99.4 2.7E-12 5.9E-17   66.9   7.1   56    1-65     12-68  (71)
 15 cd05868 Ig4_NrCAM Fourth immun  99.4 3.8E-12 8.3E-17   67.2   7.6   54    1-61     15-69  (76)
 16 cd05863 Ig2_VEGFR-3 Second imm  99.4   2E-12 4.3E-17   66.6   6.2   53    1-66     12-65  (67)
 17 cd05864 Ig2_VEGFR-2 Second imm  99.4   3E-12 6.5E-17   66.5   6.8   51    1-61     12-62  (70)
 18 cd04971 Ig_TrKABC_d5 Fifth dom  99.4 3.9E-12 8.4E-17   67.9   7.4   54    1-61     12-74  (81)
 19 cd05853 Ig6_Contactin-4 Sixth   99.4 4.1E-12   9E-17   68.3   7.2   61    2-69     17-84  (85)
 20 PHA02826 IL-1 receptor-like pr  99.4 1.3E-11 2.9E-16   77.6  10.4   67   26-115    97-169 (227)
 21 cd05744 Ig_Myotilin_C_like Imm  99.4   8E-12 1.7E-16   65.8   7.8   54    1-61     12-69  (75)
 22 cd05748 Ig_Titin_like Immunogl  99.4 8.6E-12 1.9E-16   65.4   7.9   54    1-61     13-68  (74)
 23 cd05760 Ig2_PTK7 Second immuno  99.4 8.1E-12 1.8E-16   66.1   7.7   54    1-61     12-66  (77)
 24 cd04978 Ig4_L1-NrCAM_like Four  99.4 8.1E-12 1.8E-16   65.7   7.6   58    1-65     15-74  (76)
 25 cd05745 Ig3_Peroxidasin Third   99.4   5E-12 1.1E-16   66.3   6.7   53    1-61     16-68  (74)
 26 cd05762 Ig8_MLCK Eighth immuno  99.4 1.1E-11 2.4E-16   68.5   8.3   61    1-68     29-92  (98)
 27 cd05723 Ig4_Neogenin Fourth im  99.4 9.5E-12 2.1E-16   64.8   7.6   53    1-61     13-65  (71)
 28 cd05876 Ig3_L1-CAM Third immun  99.4 6.1E-12 1.3E-16   65.5   6.6   58    1-66     12-70  (71)
 29 cd05855 Ig_TrkB_d5 Fifth domai  99.3 5.5E-12 1.2E-16   66.9   6.5   54    1-61     12-72  (79)
 30 cd05875 Ig6_hNeurofascin_like   99.3 1.7E-11 3.6E-16   64.9   8.3   63    1-66     12-76  (77)
 31 cd04975 Ig4_SCFR_like Fourth i  99.3 6.6E-12 1.4E-16   69.7   6.8   59    1-66     33-99  (101)
 32 cd05733 Ig6_L1-CAM_like Sixth   99.3 8.2E-12 1.8E-16   66.1   6.7   62    1-65     12-75  (77)
 33 cd05849 Ig1_Contactin-1 First   99.3 1.7E-11 3.7E-16   67.1   8.1   57    1-64     33-89  (93)
 34 KOG4221|consensus               99.3 1.5E-11 3.3E-16   90.0   9.8  101    2-115   170-272 (1381)
 35 cd05738 Ig2_RPTP_IIa_LAR_like   99.3 1.7E-11 3.8E-16   64.3   7.7   55    1-62     12-67  (74)
 36 cd05851 Ig3_Contactin-1 Third   99.3 1.1E-11 2.4E-16   67.2   6.9   52    1-61     30-81  (88)
 37 KOG4194|consensus               99.3 6.6E-12 1.4E-16   87.0   7.1   73   28-115   575-647 (873)
 38 cd04969 Ig5_Contactin_like Fif  99.3 1.4E-11 2.9E-16   64.5   6.8   53    1-61     15-67  (73)
 39 cd05737 Ig_Myomesin_like_C C-t  99.3 1.6E-11 3.5E-16   67.0   7.3   54    1-61     30-86  (92)
 40 cd05740 Ig_CEACAM_D4 Fourth im  99.3 2.2E-11 4.7E-16   66.4   7.8   56    1-64     31-86  (91)
 41 PHA02785 IL-beta-binding prote  99.3 4.1E-11 8.8E-16   79.2  10.2   94    2-115    61-161 (326)
 42 cd05724 Ig2_Robo Second immuno  99.3 2.8E-11 6.1E-16   65.1   7.6   55    1-62     26-80  (86)
 43 cd05763 Ig_1 Subgroup of the i  99.3 2.4E-11 5.3E-16   63.8   7.1   58    1-65     12-73  (75)
 44 cd05725 Ig3_Robo Third immunog  99.3 2.4E-11 5.2E-16   62.9   6.9   52    1-61     12-63  (69)
 45 cd05746 Ig4_Peroxidasin Fourth  99.3 2.5E-11 5.4E-16   62.9   7.0   52    1-61     12-64  (69)
 46 cd05728 Ig4_Contactin-2-like F  99.3 2.9E-11 6.4E-16   65.1   6.9   52    1-61     28-79  (85)
 47 cd04973 Ig1_FGFR First immunog  99.3 2.5E-11 5.4E-16   64.5   6.6   50    2-60     23-72  (79)
 48 cd05859 Ig4_PDGFR-alpha Fourth  99.3 2.5E-11 5.4E-16   67.4   6.7   59    1-66     32-99  (101)
 49 cd05894 Ig_C5_MyBP-C C5 immuno  99.3 6.6E-11 1.4E-15   63.9   8.1   54    1-61     24-80  (86)
 50 cd05730 Ig3_NCAM-1_like Third   99.3 6.1E-11 1.3E-15   65.0   8.0   59    1-67     32-93  (95)
 51 cd04967 Ig1_Contactin First Ig  99.3 3.9E-11 8.5E-16   65.4   7.0   56    1-62     33-88  (91)
 52 cd05735 Ig8_DSCAM Eight immuno  99.3 8.2E-11 1.8E-15   63.8   8.1   60    1-68     15-83  (88)
 53 cd07702 Ig2_VEGFR-1 Second imm  99.3 5.8E-11 1.3E-15   61.9   6.9   49    1-57     12-60  (72)
 54 KOG4222|consensus               99.2   2E-11 4.3E-16   88.9   6.7   96    1-115   254-350 (1281)
 55 cd05857 Ig2_FGFR Second immuno  99.2 6.5E-11 1.4E-15   63.6   7.0   54    1-61     23-79  (85)
 56 cd05743 Ig_Perlecan_D2_like Im  99.2 8.2E-11 1.8E-15   62.3   7.2   54    1-61     15-70  (78)
 57 cd05731 Ig3_L1-CAM_like Third   99.2 5.7E-11 1.2E-15   61.6   6.4   57    1-65     12-69  (71)
 58 cd05854 Ig6_Contactin-2 Sixth   99.2 8.3E-11 1.8E-15   63.4   7.2   59    3-68     18-83  (85)
 59 cd05771 IgC_Tapasin_R Tapasin-  99.2 1.9E-10 4.2E-15   67.3   9.3   71   28-115     2-75  (139)
 60 cd05866 Ig1_NCAM-2 First immun  99.2 1.7E-10 3.8E-15   63.0   8.3   56    2-64     29-87  (92)
 61 cd05865 Ig1_NCAM-1 First immun  99.2 1.5E-10 3.3E-15   63.7   7.9   52    2-60     31-88  (96)
 62 cd04970 Ig6_Contactin_like Six  99.2   1E-10 2.3E-15   62.9   7.0   59    3-68     18-83  (85)
 63 cd05736 Ig2_Follistatin_like S  99.2 2.3E-10 5.1E-15   60.2   8.1   59    1-66     12-73  (76)
 64 cd04968 Ig3_Contactin_like Thi  99.2 1.7E-10 3.7E-15   62.4   7.3   52    1-61     30-81  (88)
 65 cd05764 Ig_2 Subgroup of the i  99.2 1.9E-10 4.2E-15   60.2   7.1   54    1-61     15-68  (74)
 66 cd05739 Ig3_RPTP_IIa_LAR_like   99.2   2E-10 4.3E-15   59.5   6.6   50    1-61     15-64  (69)
 67 PF07679 I-set:  Immunoglobulin  99.2 3.8E-10 8.3E-15   61.0   8.0   58    1-65     29-89  (90)
 68 cd05726 Ig4_Robo Fhird immunog  99.2 2.9E-10 6.2E-15   61.8   7.3   61    1-68     15-83  (90)
 69 cd04977 Ig1_NCAM-1_like First   99.2   4E-10 8.8E-15   61.5   7.9   55    1-61     28-85  (92)
 70 cd05856 Ig2_FGFRL1-like Second  99.2 9.8E-11 2.1E-15   62.3   5.3   54    1-61     23-76  (82)
 71 cd05722 Ig1_Neogenin First imm  99.2 3.9E-10 8.6E-15   61.8   7.8   63    1-65     28-92  (95)
 72 cd05891 Ig_M-protein_C C-termi  99.2 3.3E-10 7.2E-15   61.9   7.3   54    1-61     30-86  (92)
 73 cd05757 Ig2_IL1R_like Second i  99.2 4.2E-10 9.2E-15   61.4   7.5   51    1-60     29-79  (92)
 74 cd05734 Ig7_DSCAM Seventh immu  99.1 6.8E-10 1.5E-14   58.9   7.8   57    1-63     12-74  (79)
 75 cd05756 Ig1_IL1R_like First im  99.1 2.8E-10   6E-15   62.4   6.4   53    2-61     34-88  (94)
 76 cd04972 Ig_TrkABC_d4 Fourth do  99.1 6.8E-10 1.5E-14   60.3   7.7   54    1-61     29-84  (90)
 77 cd05747 Ig5_Titin_like M5, fif  99.1 7.7E-10 1.7E-14   60.3   7.7   54    1-61     32-87  (92)
 78 cd05750 Ig_Pro_neuregulin Immu  99.1   6E-10 1.3E-14   58.3   6.7   54    1-61     13-71  (75)
 79 cd05869 Ig5_NCAM-1 Fifth immun  99.1 1.4E-09   3E-14   59.9   7.3   54    1-61     31-91  (97)
 80 cd04974 Ig3_FGFR Third immunog  99.1 8.8E-10 1.9E-14   59.9   6.3   33   27-65     55-88  (90)
 81 cd05749 Ig2_Tyro3_like Second   99.1 8.5E-10 1.9E-14   58.9   6.0   50    2-64     28-78  (81)
 82 cd07693 Ig1_Robo First immunog  99.1 1.5E-09 3.3E-14   59.6   7.2   59    1-61     30-92  (100)
 83 cd05873 Ig_Sema4D_like Immunog  99.0 6.7E-10 1.5E-14   60.0   5.3   47    2-56     25-71  (87)
 84 cd05773 Ig8_hNephrin_like Eigh  99.0 2.5E-09 5.4E-14   60.2   7.8   60    1-67     37-105 (109)
 85 cd05858 Ig3_FGFR-2 Third immun  99.0 1.6E-09 3.5E-14   58.9   6.5   29   27-61     55-83  (90)
 86 cd05895 Ig_Pro_neuregulin-1 Im  99.0 1.4E-09 3.1E-14   57.2   5.4   53    2-61     14-72  (76)
 87 cd05897 Ig2_IL1R2_like Second   99.0 2.4E-09 5.3E-14   58.7   5.7   50    2-59     30-81  (95)
 88 cd05732 Ig5_NCAM-1_like Fifth   99.0 5.1E-09 1.1E-13   57.4   7.1   54    1-61     30-90  (96)
 89 cd05870 Ig5_NCAM-2 Fifth immun  98.9 6.2E-09 1.4E-13   57.4   6.9   55    1-61     30-92  (98)
 90 cd05765 Ig_3 Subgroup of the i  98.9 7.1E-09 1.5E-13   55.0   6.5   30   26-61     46-75  (81)
 91 cd05758 Ig5_KIRREL3-like Fifth  98.9 8.7E-09 1.9E-13   56.8   6.6   54    2-61     31-93  (98)
 92 cd04979 Ig_Semaphorin_C Immuno  98.9 1.5E-08 3.3E-13   54.8   7.0   52    2-60     25-78  (89)
 93 cd05727 Ig2_Contactin-2-like S  98.9   5E-09 1.1E-13   57.5   4.4   52    1-59     33-86  (96)
 94 smart00408 IGc2 Immunoglobulin  98.8 3.6E-08 7.9E-13   49.1   6.0   47    2-57     17-63  (63)
 95 PHA02826 IL-1 receptor-like pr  98.8 2.4E-08 5.3E-13   62.9   5.6   52    2-60    164-216 (227)
 96 cd05742 Ig1_VEGFR_like First i  98.8   5E-08 1.1E-12   52.2   6.0   53    2-61     18-77  (84)
 97 cd05729 Ig2_FGFR_like Second i  98.7 1.2E-07 2.7E-12   50.4   7.1   53    1-60     23-78  (85)
 98 cd05754 Ig3_Perlecan_like Thir  98.7 8.3E-08 1.8E-12   51.4   5.2   49    2-61     32-80  (85)
 99 cd05896 Ig1_IL1RAPL-1_like Fir  98.6 2.1E-07 4.5E-12   51.6   6.2   51    3-60     42-97  (104)
100 cd05753 Ig2_FcgammaR_like Seco  98.6 8.7E-08 1.9E-12   51.3   4.6   50    2-64     30-79  (83)
101 cd05871 Ig_Semaphorin_classIII  98.6 2.9E-07 6.3E-12   50.1   6.6   53    2-60     25-81  (91)
102 cd05882 Ig1_Necl-1 First (N-te  98.6 2.9E-07 6.3E-12   50.5   6.5   49    1-56     26-85  (95)
103 cd05845 Ig2_L1-CAM_like Second  98.6 8.5E-08 1.9E-12   52.5   4.2   49    1-57     33-83  (95)
104 cd05851 Ig3_Contactin-1 Third   98.5 3.8E-07 8.1E-12   49.3   5.1   35   80-115     2-36  (88)
105 cd05885 Ig2_Necl-4 Second immu  98.5 2.9E-07 6.4E-12   48.8   4.5   52    1-59     14-69  (80)
106 cd05752 Ig1_FcgammaR_like Frst  98.5 2.5E-07 5.3E-12   49.0   4.0   38    2-55     31-68  (78)
107 cd05861 Ig1_PDGFR-alphabeta Fr  98.5 2.2E-06 4.9E-11   45.9   7.4   25   27-57     46-70  (84)
108 PF00047 ig:  Immunoglobulin do  98.4 4.6E-07 9.9E-12   45.8   4.0   43    2-52     17-64  (64)
109 cd07701 Ig1_Necl-3 First (N-te  98.4 4.4E-06 9.4E-11   45.8   7.0   26   27-58     62-87  (95)
110 cd07693 Ig1_Robo First immunog  98.3 1.2E-06 2.6E-11   48.0   4.5   36   80-116     2-37  (100)
111 cd05872 Ig_Sema4B_like Immunog  98.3 3.5E-06 7.5E-11   45.3   6.2   49    2-60     25-73  (85)
112 cd05759 Ig2_KIRREL3-like Secon  98.3 4.7E-06   1E-10   44.3   6.4   48    2-56     15-69  (82)
113 cd05717 Ig1_Necl-1-3_like Firs  98.3 8.2E-06 1.8E-10   44.5   7.3   25   28-58     63-87  (95)
114 cd05749 Ig2_Tyro3_like Second   98.3 1.6E-06 3.4E-11   46.2   4.0   28   88-115     6-34  (81)
115 smart00409 IG Immunoglobulin.   98.3 1.4E-05 3.1E-10   41.7   7.8   53    2-61     24-79  (86)
116 smart00410 IG_like Immunoglobu  98.3 1.4E-05 3.1E-10   41.7   7.8   53    2-61     24-79  (86)
117 cd04972 Ig_TrkABC_d4 Fourth do  98.3 1.7E-06 3.7E-11   46.8   4.0   31   86-116     6-36  (90)
118 cd05747 Ig5_Titin_like M5, fif  98.3 2.5E-06 5.4E-11   46.4   4.6   36   80-116     4-39  (92)
119 cd04968 Ig3_Contactin_like Thi  98.3 2.3E-06   5E-11   46.1   4.4   36   80-116     2-37  (88)
120 cd05862 Ig1_VEGFR First immuno  98.2 5.2E-06 1.1E-10   44.7   5.6   29   27-61     50-78  (86)
121 cd05762 Ig8_MLCK Eighth immuno  98.2 3.5E-06 7.6E-11   46.5   4.7   35   80-115     1-35  (98)
122 PF13895 Ig_2:  Immunoglobulin   98.2 1.6E-05 3.4E-10   41.5   6.3   48    2-64     29-76  (80)
123 cd05848 Ig1_Contactin-5 First   98.2 5.7E-06 1.2E-10   45.2   4.5   35   80-115     2-39  (94)
124 PF07679 I-set:  Immunoglobulin  98.1 4.9E-06 1.1E-10   44.7   4.1   36   80-116     1-36  (90)
125 cd05898 Ig5_KIRREL3 Fifth immu  98.1 1.6E-05 3.6E-10   43.8   6.1   53    3-61     33-93  (98)
126 cd05870 Ig5_NCAM-2 Fifth immun  98.1 6.8E-06 1.5E-10   45.2   4.6   34   80-115     3-36  (98)
127 PF13927 Ig_3:  Immunoglobulin   98.1 8.3E-06 1.8E-10   42.0   4.5   25   24-54     51-75  (75)
128 cd05737 Ig_Myomesin_like_C C-t  98.1 9.1E-06   2E-10   44.1   4.7   31   86-116     7-37  (92)
129 cd05728 Ig4_Contactin-2-like F  98.1 5.5E-06 1.2E-10   44.4   3.6   28   88-115     7-34  (85)
130 cd05850 Ig1_Contactin-2 First   98.1   8E-06 1.7E-10   44.6   4.3   36   80-116     2-40  (94)
131 cd05849 Ig1_Contactin-1 First   98.1 1.1E-05 2.3E-10   44.1   4.4   35   80-115     2-39  (93)
132 cd05722 Ig1_Neogenin First imm  98.0 1.2E-05 2.6E-10   43.9   4.4   33   82-115     2-34  (95)
133 PHA03376 BARF1; Provisional     98.0 3.4E-05 7.3E-10   47.1   6.5   71   28-115    88-159 (221)
134 cd05774 Ig_CEACAM_D1 First imm  98.0 9.7E-05 2.1E-09   41.3   7.7   30   23-58     66-95  (105)
135 cd05758 Ig5_KIRREL3-like Fifth  98.0 2.3E-05 5.1E-10   43.0   4.8   35   81-116     3-38  (98)
136 cd05894 Ig_C5_MyBP-C C5 immuno  98.0 1.7E-05 3.7E-10   42.6   4.1   28   88-115     3-30  (86)
137 cd05869 Ig5_NCAM-1 Fifth immun  98.0 2.4E-05 5.2E-10   42.9   4.8   35   80-115     3-37  (97)
138 cd07690 Ig1_CD4 First immunogl  98.0 1.8E-05   4E-10   43.3   4.1   25   28-58     66-90  (94)
139 cd05775 Ig_SLAM-CD84_like_N N-  97.9 0.00022 4.9E-09   39.1   8.1   30   27-62     61-90  (97)
140 cd05741 Ig_CEACAM_D1_like Firs  97.9 0.00026 5.7E-09   38.1   8.0   31   25-61     55-85  (92)
141 cd05732 Ig5_NCAM-1_like Fifth   97.9 3.5E-05 7.6E-10   42.0   4.2   34   80-115     3-36  (96)
142 cd05730 Ig3_NCAM-1_like Third   97.9 3.4E-05 7.5E-10   42.0   4.1   28   88-115    11-38  (95)
143 cd05713 Ig_MOG_like Immunoglob  97.8 0.00014 3.1E-09   39.9   6.2   27   28-60     66-92  (100)
144 cd05860 Ig4_SCFR Fourth immuno  97.8  0.0003 6.5E-09   39.0   6.8   58    2-66     33-99  (101)
145 cd05718 Ig1_PVR_like First imm  97.8 0.00047   1E-08   37.6   7.7   29   27-61     62-91  (98)
146 cd05891 Ig_M-protein_C C-termi  97.7 5.9E-05 1.3E-09   41.0   3.9   29   87-115     8-36  (92)
147 cd05857 Ig2_FGFR Second immuno  97.7 5.4E-05 1.2E-09   40.3   3.6   27   89-115     3-29  (85)
148 cd05865 Ig1_NCAM-1 First immun  97.7 7.3E-05 1.6E-09   41.1   3.9   28   88-115     8-36  (96)
149 cd04975 Ig4_SCFR_like Fourth i  97.7 9.2E-05   2E-09   41.1   4.0   28   88-115    11-39  (101)
150 cd05887 Ig1_Nectin-3_like Firs  97.7 0.00062 1.3E-08   37.4   7.1   30   26-61     59-89  (96)
151 cd05886 Ig1_Nectin-1_like Firs  97.7 0.00023   5E-09   39.3   5.5   28   27-60     63-91  (99)
152 cd04967 Ig1_Contactin First Ig  97.6 0.00015 3.2E-09   39.3   4.5   36   80-116     2-40  (91)
153 cd05882 Ig1_Necl-1 First (N-te  97.6 0.00012 2.6E-09   40.2   4.1   28   88-115     5-32  (95)
154 cd05724 Ig2_Robo Second immuno  97.6  0.0001 2.2E-09   39.2   3.8   29   88-116     4-33  (86)
155 cd07701 Ig1_Necl-3 First (N-te  97.6 0.00013 2.8E-09   40.0   4.0   28   88-115     5-32  (95)
156 cd05889 Ig1_DNAM-1_like First   97.6  0.0022 4.9E-08   35.2   8.4   29   26-60     59-88  (96)
157 cd05714 Ig_CSPGs_LP Immunoglob  97.5 0.00038 8.3E-09   38.7   5.2   34   28-67     69-103 (106)
158 cd05888 Ig1_Nectin-4_like Frst  97.5  0.0009 1.9E-08   36.9   6.6   27   27-59     64-91  (100)
159 cd05845 Ig2_L1-CAM_like Second  97.5 0.00022 4.8E-09   39.1   4.1   36   80-115     3-39  (95)
160 cd05883 Ig2_Necl-2 Second immu  97.5  0.0013 2.8E-08   35.1   6.9   49    1-56     14-67  (82)
161 cd05877 Ig_LP_like Immunoglobu  97.5 0.00033 7.1E-09   38.9   4.9   34   28-67     69-103 (106)
162 cd05856 Ig2_FGFRL1-like Second  97.5 0.00015 3.2E-09   38.1   3.2   26   90-115     4-29  (82)
163 cd05752 Ig1_FcgammaR_like Frst  97.5 0.00037   8E-09   36.8   4.6   29   88-116     8-37  (78)
164 cd05754 Ig3_Perlecan_like Thir  97.5 0.00043 9.3E-09   36.9   4.8   30   86-115     7-37  (85)
165 cd05881 Ig1_Necl-2 First (N-te  97.5  0.0017 3.8E-08   35.6   7.0   23   28-56     63-85  (95)
166 cd05859 Ig4_PDGFR-alpha Fourth  97.4 0.00024 5.2E-09   39.4   3.7   28   88-115    11-38  (101)
167 cd05761 Ig2_Necl-1-4_like Seco  97.4   0.001 2.2E-08   35.3   5.7   48    2-57     15-69  (82)
168 cd05740 Ig_CEACAM_D4 Fourth im  97.4 0.00036 7.7E-09   37.9   4.0   27   88-115    11-37  (91)
169 cd05900 Ig_Aggrecan Immunoglob  97.4  0.0032 6.9E-08   35.6   7.9   25   27-57     74-98  (112)
170 cd05773 Ig8_hNephrin_like Eigh  97.4  0.0004 8.7E-09   39.0   4.2   36   80-115     5-43  (109)
171 cd05751 Ig1_LILRB1_like First   97.4 0.00028   6E-09   38.3   3.2   24   27-56     53-76  (91)
172 cd05866 Ig1_NCAM-2 First immun  97.3 0.00052 1.1E-08   37.4   4.0   27   88-115     8-34  (92)
173 KOG3515|consensus               97.3  0.0004 8.8E-09   50.5   4.4   74   28-115   164-242 (741)
174 cd05878 Ig_Aggrecan_like Immun  97.3   0.005 1.1E-07   34.6   7.7   33   28-66     73-106 (110)
175 cd05898 Ig5_KIRREL3 Fifth immu  97.2  0.0015 3.3E-08   36.0   5.1   28   88-115     9-37  (98)
176 cd07705 Ig2_Necl-1 Second immu  97.2  0.0018 3.8E-08   34.5   5.0   51    2-56     15-69  (83)
177 cd04979 Ig_Semaphorin_C Immuno  97.2 0.00088 1.9E-08   36.0   3.9   28   88-116     4-31  (89)
178 cd05873 Ig_Sema4D_like Immunog  97.1 0.00098 2.1E-08   36.0   3.9   28   88-116     4-31  (87)
179 cd04977 Ig1_NCAM-1_like First   97.1  0.0013 2.7E-08   35.7   4.3   27   88-115     8-34  (92)
180 cd05879 Ig_P0 Immunoglobulin (  97.1  0.0016 3.4E-08   37.1   4.6   24   28-57     81-104 (116)
181 cd05756 Ig1_IL1R_like First im  97.1 0.00093   2E-08   36.5   3.4   29   88-116     7-40  (94)
182 cd05717 Ig1_Necl-1-3_like Firs  97.0  0.0017 3.6E-08   35.3   4.2   28   88-115     5-32  (95)
183 cd05901 Ig_Versican Immunoglob  97.0  0.0044 9.5E-08   35.3   5.9   34   28-67     80-114 (117)
184 cd00098 IgC Immunoglobulin Con  97.0 0.00074 1.6E-08   36.6   2.5   49    2-57     30-86  (95)
185 cd00096 Ig Immunoglobulin doma  97.0  0.0023 5.1E-08   31.4   4.2   48    2-56     13-66  (74)
186 cd05902 Ig_Neurocan Immunoglob  97.0  0.0089 1.9E-07   33.7   6.7   23   28-56     73-95  (110)
187 cd04973 Ig1_FGFR First immunog  96.9  0.0021 4.6E-08   33.7   4.0   27   88-115     2-28  (79)
188 PHA02633 hypothetical protein;  96.9   0.004 8.6E-08   31.2   4.6   37   26-68     17-54  (63)
189 PF07354 Sp38:  Zona-pellucida-  96.9  0.0024 5.3E-08   41.0   4.5   48    2-56     13-60  (271)
190 cd05729 Ig2_FGFR_like Second i  96.9  0.0025 5.5E-08   33.5   3.9   26   90-115     4-29  (85)
191 PF13895 Ig_2:  Immunoglobulin   96.7  0.0032   7E-08   32.5   3.7   34   80-116     2-35  (80)
192 cd05884 Ig2_Necl-3 Second immu  96.7  0.0085 1.8E-07   31.9   5.0   48    2-56     15-69  (83)
193 cd05846 Ig1_MRC-OX-2_like Firs  96.7   0.007 1.5E-07   33.0   4.8   28   28-61     62-90  (97)
194 cd05880 Ig_EVA1 Immunoglobulin  96.6  0.0028 6.1E-08   35.9   3.1   24   28-57     80-103 (115)
195 cd07691 Ig_CD3_gamma_delta Imm  96.6   0.012 2.7E-07   30.1   4.9   37    3-54     18-54  (69)
196 PHA02987 Ig domain OX-2-like p  96.6   0.023 4.9E-07   34.9   6.8   39   25-69     83-124 (189)
197 smart00408 IGc2 Immunoglobulin  96.6  0.0029 6.4E-08   30.7   2.7   23   94-116     1-23  (63)
198 cd00099 IgV Immunoglobulin var  96.5  0.0028   6E-08   34.9   2.5   24   28-57     68-91  (105)
199 cd05715 Ig_P0-like Immunoglobu  96.4  0.0046 9.9E-08   35.0   3.1   24   28-57     81-104 (116)
200 cd04983 IgV_TCR_alpha_like Imm  96.4  0.0045 9.7E-08   34.4   2.9   23   28-56     71-93  (109)
201 cd05871 Ig_Semaphorin_classIII  96.2    0.01 2.3E-07   32.1   3.7   26   89-115     5-30  (91)
202 PF11465 Receptor_2B4:  Natural  96.2   0.057 1.2E-06   30.2   6.4   38   23-66     67-104 (108)
203 cd05727 Ig2_Contactin-2-like S  96.2   0.011 2.5E-07   32.4   3.7   28   88-115    11-39  (96)
204 cd07694 Ig2_CD4 Second immunog  96.1   0.076 1.6E-06   28.7   6.6   24   26-55     50-73  (88)
205 smart00409 IG Immunoglobulin.   96.1   0.017 3.8E-07   29.6   4.1   29   88-116     2-30  (86)
206 smart00410 IG_like Immunoglobu  96.1   0.017 3.8E-07   29.6   4.1   29   88-116     2-30  (86)
207 PF07686 V-set:  Immunoglobulin  96.0   0.022 4.8E-07   31.3   4.6   22   28-55     80-101 (114)
208 PF13927 Ig_3:  Immunoglobulin   96.0   0.011 2.4E-07   29.9   2.9   34   80-115     2-36  (75)
209 PF00047 ig:  Immunoglobulin do  95.8   0.014   3E-07   29.0   2.8   22   95-116     1-23  (64)
210 cd04980 IgV_L_kappa Immunoglob  95.8   0.037 7.9E-07   30.6   4.7   28   88-115     8-36  (106)
211 PF08205 C2-set_2:  CD80-like C  95.8  0.0093   2E-07   31.9   2.2   22   95-116    14-36  (89)
212 KOG3515|consensus               95.7   0.024 5.1E-07   41.8   4.7   96    2-116    38-135 (741)
213 cd05899 IgV_TCR_beta Immunoglo  95.6   0.013 2.9E-07   32.6   2.6   23   28-56     73-95  (110)
214 cd04980 IgV_L_kappa Immunoglob  95.6   0.011 2.4E-07   32.7   2.2   22   28-55     72-93  (106)
215 cd05716 Ig_pIgR Immunoglobulin  95.6   0.026 5.6E-07   30.7   3.5   23   28-56     65-87  (98)
216 smart00407 IGc1 Immunoglobulin  95.5   0.073 1.6E-06   27.6   5.0   47    3-56     17-71  (75)
217 cd04984 IgV_L_lambda Immunoglo  95.5   0.018 3.8E-07   31.4   2.8   22   28-55     64-85  (98)
218 smart00406 IGv Immunoglobulin   95.3   0.011 2.4E-07   30.6   1.5   18   28-51     63-80  (81)
219 cd05753 Ig2_FcgammaR_like Seco  95.3   0.049 1.1E-06   28.9   3.9   26   90-115     9-35  (83)
220 cd05711 Ig_FcalphaRI Immunoglo  95.1   0.049 1.1E-06   29.6   3.6   22   28-55     56-77  (94)
221 KOG1480|consensus               95.0   0.012 2.6E-07   43.2   1.3   51    3-61    161-211 (909)
222 cd05755 Ig2_ICAM-1_like Second  94.9   0.065 1.4E-06   29.7   3.8   26   90-115    11-39  (100)
223 cd05770 IgC_beta2m Class I maj  94.9   0.081 1.7E-06   28.9   4.1   48    3-55     33-82  (93)
224 cd04982 IgV_TCR_gamma Immunogl  94.7   0.027 5.9E-07   31.6   2.1   22   28-55     78-99  (116)
225 cd05881 Ig1_Necl-2 First (N-te  94.7   0.092   2E-06   28.8   4.0   28   88-115     5-32  (95)
226 cd05755 Ig2_ICAM-1_like Second  94.6    0.11 2.4E-06   28.8   4.3   48    4-58     36-87  (100)
227 cd05872 Ig_Sema4B_like Immunog  94.6   0.054 1.2E-06   29.1   3.0   28   88-116     4-31  (85)
228 cd05720 Ig_CD8_alpha Immunoglo  94.4   0.033 7.2E-07   30.8   1.9   21   28-54     70-90  (104)
229 cd07700 IgV_CD8_beta Immunoglo  94.4   0.071 1.5E-06   29.6   3.2   22   28-55     73-94  (107)
230 cd05766 IgC_MHC_II_beta Class   94.3    0.13 2.9E-06   28.0   4.1   50    3-56     32-83  (94)
231 cd07706 IgV_TCR_delta Immunogl  94.3   0.041 8.9E-07   31.0   2.1   22   28-55     73-94  (116)
232 cd07692 Ig_CD3_epsilon Immunog  94.1   0.097 2.1E-06   26.6   3.1   37    4-56     21-57  (65)
233 cd05767 IgC_MHC_II_alpha Class  94.1    0.11 2.3E-06   28.4   3.5   49    3-56     33-84  (94)
234 cd05712 Ig_Siglec_N Immunoglob  94.1   0.071 1.5E-06   30.2   2.9   22   28-55     81-102 (119)
235 PF08205 C2-set_2:  CD80-like C  93.8    0.34 7.4E-06   25.7   5.2   13   44-56     72-84  (89)
236 cd07704 Ig2_Nectin-3-4_like Se  93.4    0.27 5.8E-06   27.1   4.2   27   89-115    10-38  (97)
237 cd07698 IgC_MHC_I_alpha3 Class  93.3    0.27 5.9E-06   26.5   4.2   13   44-56     71-83  (93)
238 cd05772 IgC_SIRP Signal-regula  93.3    0.26 5.7E-06   27.8   4.2   13    3-16     39-51  (111)
239 cd05860 Ig4_SCFR Fourth immuno  92.9    0.35 7.6E-06   26.9   4.2   28   88-115    11-39  (101)
240 cd07694 Ig2_CD4 Second immunog  92.8    0.28 6.2E-06   26.5   3.7   26   90-115     9-36  (88)
241 cd00098 IgC Immunoglobulin Con  92.2    0.23 4.9E-06   26.6   3.0   23   93-115    11-35  (95)
242 PF07654 C1-set:  Immunoglobuli  92.1    0.24 5.2E-06   26.1   2.9   44    3-56     26-77  (83)
243 cd07699 IgC_L Immunoglobulin C  92.0    0.19 4.1E-06   27.7   2.5   50    3-56     35-89  (100)
244 cd04981 IgV_H Immunoglobulin (  91.9    0.15 3.3E-06   28.9   2.1   21   28-54     77-97  (117)
245 cd05757 Ig2_IL1R_like Second i  91.6    0.23 5.1E-06   26.9   2.5   27   89-115     4-35  (92)
246 cd07697 IgC_TCR_gamma T cell r  91.3     0.3 6.6E-06   26.8   2.8   13    3-16     34-46  (96)
247 cd05719 Ig2_PVR_like Second im  90.8    0.37   8E-06   26.3   2.8   21   95-115    15-36  (95)
248 cd05847 IgC_CH2_IgE CH2 domain  90.7    0.84 1.8E-05   24.9   4.2   13   44-56     74-86  (94)
249 cd05751 Ig1_LILRB1_like First   90.2    0.73 1.6E-05   24.7   3.7   33   80-115     3-35  (91)
250 cd07703 Ig2_Nectin-2_like Seco  89.9    0.44 9.5E-06   26.1   2.7   20   96-115    16-36  (95)
251 PF08204 V-set_CD47:  CD47 immu  89.9    0.51 1.1E-05   27.5   3.0   22   45-66     97-119 (130)
252 PHA02982 hypothetical protein;  89.2     4.1 8.9E-05   25.9   7.0   29   26-60     99-127 (251)
253 cd05711 Ig_FcalphaRI Immunoglo  87.0     1.6 3.6E-05   23.6   3.7   33   80-115     2-34  (94)
254 PHA02987 Ig domain OX-2-like p  86.5     1.7 3.7E-05   26.9   3.9   29   88-116    23-52  (189)
255 cd05768 IgC_CH4 CH4 domain (fo  86.1    0.69 1.5E-05   25.6   1.9   22   94-115    15-38  (102)
256 cd04985 IgC_CH1 CH1 domain (fi  85.2    0.73 1.6E-05   25.2   1.7   10    3-13     34-43  (95)
257 cd07698 IgC_MHC_I_alpha3 Class  83.5     1.8 3.8E-05   23.3   2.8   21   95-115    14-36  (93)
258 PHA03042 CD47-like protein; Pr  83.0     3.1 6.7E-05   27.4   4.1   43    3-57     52-94  (286)
259 cd05890 Ig2_Nectin-1_like Seco  82.8     1.7 3.6E-05   24.0   2.4   20   96-115    21-41  (98)
260 PF05790 C2-set:  Immunoglobuli  81.6       6 0.00013   20.9   6.6   23   28-56     44-67  (80)
261 PHA03189 UL14 tegument protein  80.4     5.2 0.00011   26.9   4.4   23   44-66    144-167 (348)
262 cd07696 IgC_CH3 CH3 domain (th  79.2     1.7 3.8E-05   23.7   1.8   24   92-115    11-37  (96)
263 PHA02914 Immunoglobulin-like d  74.0      16 0.00036   25.7   5.5   27   24-56    343-369 (500)
264 cd04986 IgC_CH2 CH2 domain (se  73.8     4.9 0.00011   22.2   2.6   24   92-115    16-42  (99)
265 cd05769 IgC_TCR_beta T cell re  71.6     4.4 9.6E-05   23.0   2.2   22   94-115    17-40  (115)
266 PF11049 KSHV_K1:  Glycoprotein  70.8     6.8 0.00015   20.0   2.5   36    3-56     12-47  (71)
267 cd07689 Ig2_VCAM-1 Second immu  70.3     8.2 0.00018   21.4   3.0   23   93-115    13-38  (99)
268 cd05721 IgV_CTLA-4 Immunoglobu  69.7     5.7 0.00012   22.7   2.3   22   28-55     75-96  (115)
269 PF02480 Herpes_gE:  Alphaherpe  66.7     6.5 0.00014   27.9   2.6   86   25-116    87-189 (439)
270 PHA03052 Hypothetical protein;  66.7      16 0.00035   18.8   3.7   28   88-115     5-35  (69)
271 PHA03269 envelope glycoprotein  66.3      48   0.001   24.1   6.7   71   28-115   290-365 (566)
272 PHA03273 envelope glycoprotein  65.6      48   0.001   23.9   7.5   70   29-115   200-273 (486)
273 KOG4597|consensus               59.9     5.4 0.00012   28.5   1.2   28   88-115   204-231 (560)
274 PHA03270 envelope glycoprotein  59.7      62  0.0013   23.2   7.3   70   29-115   184-257 (466)
275 PHA03282 envelope glycoprotein  58.4      12 0.00025   26.9   2.6   31   19-55    116-146 (540)
276 PHA03283 envelope glycoprotein  46.9 1.2E+02  0.0025   22.5   9.9   36   27-68    134-170 (542)
277 PHA02914 Immunoglobulin-like d  46.1      92   0.002   22.2   5.2   22   28-55     82-103 (500)
278 PF15096 G6B:  G6B family        43.8      21 0.00045   22.4   1.8   15   42-56     83-97  (224)
279 PF06328 Lep_receptor_Ig:  Ig-l  36.9      72  0.0016   17.2   3.6   27   90-116    13-44  (89)
280 COG3738 Uncharacterized protei  36.4      36 0.00078   21.0   2.0   34    3-36    146-179 (200)
281 COG5475 Uncharacterized small   34.8      63  0.0014   15.9   4.2   26   28-61     19-44  (60)
282 PF06832 BiPBP_C:  Penicillin-B  32.1      84  0.0018   16.5   6.1   44    2-61     43-86  (89)
283 PHA02935 Hypothetical protein;  31.9 1.3E+02  0.0029   19.2   4.1   32   29-66    104-135 (349)
284 PF13220 DUF4028:  Protein of u  31.8      44 0.00095   16.3   1.5   16   44-59      9-24  (65)
285 PF04004 Leo1:  Leo1-like prote  31.1 1.1E+02  0.0023   18.8   3.5   29    2-31     47-79  (171)
286 COG4953 PbpC Membrane carboxyp  30.0 2.1E+02  0.0045   22.1   5.3   24   43-66    708-731 (733)
287 PHA02865 MHC-like TNF binding   29.6      69  0.0015   22.1   2.7   14   43-56    291-304 (338)
288 PHA03281 envelope glycoprotein  25.9 2.9E+02  0.0063   20.8  10.4   84   26-116   297-394 (642)
289 KOG1026|consensus               25.8      50  0.0011   25.5   1.7   27   89-115   201-227 (774)
290 PHA03286 envelope glycoprotein  25.3 2.7E+02  0.0059   20.3   9.2   83   27-116   127-225 (492)
291 TIGR00864 PCC polycystin catio  25.2 5.6E+02   0.012   23.8   7.8   62   44-115  1838-1902(2740)
292 PHA03270 envelope glycoprotein  24.3 2.8E+02  0.0061   20.1   6.8   12    3-15    253-264 (466)
293 PF01688 Herpes_gI:  Alphaherpe  23.5      89  0.0019   19.1   2.2   23   28-56    125-147 (161)
294 PF10461 Peptidase_S68:  Peptid  23.5      36 0.00077   15.0   0.4    7  110-116    24-30  (35)
295 PF10430 Ig_Tie2_1:  Tie-2 Ig-l  21.4      98  0.0021   16.9   1.9   13   44-56     74-87  (96)
296 PRK14051 negative regulator Gr  20.4 1.3E+02  0.0028   17.1   2.2   19   92-110    80-98  (123)
297 PF02440 Adeno_E3_CR1:  Adenovi  20.4 1.4E+02   0.003   15.1   2.3   19   93-115     3-21  (63)

No 1  
>KOG3513|consensus
Probab=99.69  E-value=3.9e-16  Score=112.59  Aligned_cols=99  Identities=27%  Similarity=0.552  Sum_probs=81.2

Q ss_pred             CcEEEEEccCCeeeecc-ccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE-EEEEEEeCcEeeeeccC
Q psy11568          1 MYVLLWLIRDNTVIAYV-KDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS-RFVHVKAGSVVSLLDIQ   78 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~-~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~-~~~~v~~~~~~~~~~~~   78 (116)
                      .|.|+| ++||+++... .+.+.....++|.|.++...      |+|.|+|.|+|.+|...+ ..|.|.+.        +
T Consensus       360 ~p~v~W-lkNg~pl~~~~r~~~~~i~~g~L~is~v~~~------dsg~YQC~A~Nk~G~i~anA~L~V~a~--------~  424 (1051)
T KOG3513|consen  360 NPTVKW-LKNGEPLEPAERDPRYKIDDGTLIISNVQES------DSGVYQCIAENKYGTIYANAELKVLAS--------A  424 (1051)
T ss_pred             CCceEE-eeCCeecCccCCCcceEEeCCEEEEEecccc------cCeEEEeeeecccceEeeeeEEEEEcc--------C
Confidence            389999 9999999742 33458889999999999765      999999999999999986 55666554        3


Q ss_pred             CCceEecCC-CeEEEeCCCcEEEEeeecCcCCceeEEe
Q psy11568         79 GPLFRIEPP-YRFEFSNESGGRLDCAAQGSPTPKIEWL  115 (116)
Q Consensus        79 ~p~~~~~~~-~~~~~~~g~~~~l~C~~~g~P~p~i~W~  115 (116)
                       |.|...+. ....+..|.++.+.|...+.|.|.++|.
T Consensus       425 -P~f~~~p~~~~~~a~~g~~v~i~C~~~asP~p~~~W~  461 (1051)
T KOG3513|consen  425 -PVFPLNPVERKVMAVVGGTVTIDCKPFASPKPKVSWL  461 (1051)
T ss_pred             -CCCCCCccceEEEEEeCCeEEEeeccCCCCcceEEEE
Confidence             77766662 3346677999999999999999999996


No 2  
>KOG3513|consensus
Probab=99.68  E-value=5.5e-16  Score=111.83  Aligned_cols=96  Identities=25%  Similarity=0.380  Sum_probs=77.1

Q ss_pred             CcEEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE-EEEEEEeCcEeeeeccCC
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS-RFVHVKAGSVVSLLDIQG   79 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~-~~~~v~~~~~~~~~~~~~   79 (116)
                      .|+|.|++.+|+++..  ..+....+..|.|.++..+      |+|.|+|.|.|..|.... ..+.|.+.          
T Consensus       270 ~P~i~W~k~~g~~~~~--r~~~~~~~~vL~I~nv~~~------D~G~Y~C~AeN~~G~~~~~~~v~v~a~----------  331 (1051)
T KOG3513|consen  270 TPQIKWRKVDGKPPPR--RATYSNYGKVLKIPNVQYE------DAGEYECIAENSRGSATHSGHVTVYAP----------  331 (1051)
T ss_pred             CCcEEEEeCCCCCCCc--ceeeeccccEEEecccCcC------CCeEEEEEEecccccceeeEEEEEecC----------
Confidence            4899995555655541  2233344568999999655      999999999999996664 66767775          


Q ss_pred             CceEecCCCeEEEeCCCcEEEEeeecCcCCceeEEe
Q psy11568         80 PLFRIEPPYRFEFSNESGGRLDCAAQGSPTPKIEWL  115 (116)
Q Consensus        80 p~~~~~~~~~~~~~~g~~~~l~C~~~g~P~p~i~W~  115 (116)
                      |.++..+ ++..+..|+++.+.|.+.|.|.|.++|+
T Consensus       332 P~w~~~~-~d~~~~~gs~v~~eC~a~g~P~p~v~Wl  366 (1051)
T KOG3513|consen  332 PYWLQKP-QDTEADTGSNVTLECKASGKPNPTVKWL  366 (1051)
T ss_pred             chhhccc-ceeEecCCCCeEEEEEecCCCCCceEEe
Confidence            8998887 8889999999999999999999999997


No 3  
>KOG4221|consensus
Probab=99.55  E-value=4.3e-14  Score=102.85  Aligned_cols=97  Identities=28%  Similarity=0.461  Sum_probs=79.5

Q ss_pred             CcEEEEEccCCeeeeccccceEEee-CCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceE-EEEEEEEeCcEeeeeccC
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIALS-NGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVIL-SRFVHVKAGSVVSLLDIQ   78 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~~~-~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~-~~~~~v~~~~~~~~~~~~   78 (116)
                      .|+|.| ++||+.+...+ .++.+. .+.|.|++++..      |+|.|+|.|+|..-... +..|+|.++         
T Consensus       266 ~p~v~W-lrng~~i~~ds-~rivl~g~~slliS~a~~~------dSg~YtC~Atn~~D~idasaev~V~a~---------  328 (1381)
T KOG4221|consen  266 KPSVKW-LRNGEKISVDS-YRIVLVGGSSLLISNATDD------DSGKYTCRATNTNDSIDASAEVTVLAP---------  328 (1381)
T ss_pred             CCceEE-eeCCeeeeecc-eEEEEecccceEEeccccc------cCceEEEEecCCCcccccceEEEEEcC---------
Confidence            489999 99999998644 565554 568999999776      99999999999655555 366777775         


Q ss_pred             CCceEecCCCeEEEeCCCcEEEEeeecCcCCceeEEeC
Q psy11568         79 GPLFRIEPPYRFEFSNESGGRLDCAAQGSPTPKIEWLI  116 (116)
Q Consensus        79 ~p~~~~~~~~~~~~~~g~~~~l~C~~~g~P~p~i~W~~  116 (116)
                       |-|...| ..+.+.++..+.|+|.+.|.|.|.+.|+.
T Consensus       329 -P~~~~~p-~~l~A~e~~die~ec~~~g~p~p~v~w~k  364 (1381)
T KOG4221|consen  329 -PGFTKAP-TTLVAHESMDIEFECPVSGKPIPTVRWYK  364 (1381)
T ss_pred             -CCCCCCC-cceeeeeccceeEeCCCCCCCcceEEEEe
Confidence             7777776 78888889999999999999999999973


No 4  
>KOG4222|consensus
Probab=99.52  E-value=2.9e-14  Score=103.17  Aligned_cols=98  Identities=21%  Similarity=0.442  Sum_probs=78.5

Q ss_pred             cEEEEEccCCeeeecc-ccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEEEEEEEEeCcEeeeeccCCC
Q psy11568          2 YVLLWLIRDNTVIAYV-KDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILSRFVHVKAGSVVSLLDIQGP   80 (116)
Q Consensus         2 p~v~W~~~~g~~~~~~-~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~~~~~v~~~~~~~~~~~~~p   80 (116)
                      |.|+| .|+|+++... ...+....+|.|.|.++++.      |+|+|.|+++|.+|...+..      +.+.++.  .|
T Consensus       162 ptvSw-~Kdg~pl~~~~~~~~~lisgG~LlIsnvrks------D~GtY~CVatNmvG~ReS~~------A~lsv~e--~P  226 (1281)
T KOG4222|consen  162 PTVSW-VKDGKPLDHYDVPIIALISGGNLLISNVRKS------DEGTYACVATNMVGERESIP------ARLSVQE--KP  226 (1281)
T ss_pred             Cccee-ecCCCccccccceeEEEecCCcEEEeccccC------CCceeeeeeccccccccccc------ceeeecc--CC
Confidence            78999 9999998742 23344677889999999776      99999999999999888743      2333332  27


Q ss_pred             ceEecCCCeEEEeCCCcEEEEeeecCcCCceeEEe
Q psy11568         81 LFRIEPPYRFEFSNESGGRLDCAAQGSPTPKIEWL  115 (116)
Q Consensus        81 ~~~~~~~~~~~~~~g~~~~l~C~~~g~P~p~i~W~  115 (116)
                      .|...+ .+..+..|..+.+.|.+.|.|.|.+.|.
T Consensus       227 ~f~~rp-~~~~v~~g~~~~f~c~v~GdP~P~Vrwk  260 (1281)
T KOG4222|consen  227 WFWKRP-KDLAVLVGAAAEFDCRVGGDPQPTVRWK  260 (1281)
T ss_pred             cccccc-ccceeecccccccccccCCCCCCceeee
Confidence            776666 8888999999999999999999999995


No 5  
>KOG4194|consensus
Probab=99.52  E-value=7.6e-14  Score=96.34  Aligned_cols=97  Identities=23%  Similarity=0.417  Sum_probs=74.3

Q ss_pred             CcEEEEEccCCee-eeccccce-EEe-eCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE-EEEEEEeCcEeeeec
Q psy11568          1 MYVLLWLIRDNTV-IAYVKDLR-IAL-SNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS-RFVHVKAGSVVSLLD   76 (116)
Q Consensus         1 ~p~v~W~~~~g~~-~~~~~~~~-~~~-~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~-~~~~v~~~~~~~~~~   76 (116)
                      .|+|.| -|+|.. ++.....| ... +++...|.|++.+      |+|.|+|.|.|.+|...+ .++.|-..       
T Consensus       641 ~PeIaw-qkdggtdFPAA~eRRl~Vmpedd~f~Itnvk~e------D~GiYtC~A~n~AG~isanAtL~V~e~-------  706 (873)
T KOG4194|consen  641 RPEIAW-QKDGGTDFPAARERRLHVMPEDDVFFITNVKIE------DQGIYTCTAQNVAGQISANATLTVLET-------  706 (873)
T ss_pred             Ccceee-hhcCCCCCchhhhheeeecCCCCEEEEeccccc------ccceeEEeeeccccceeeceEEEEecC-------
Confidence            489999 666554 55433223 333 3558999999777      999999999999998886 45544442       


Q ss_pred             cCCCceEecCCCeEEEeCCCcEEEEeeecCcCC-ceeEEe
Q psy11568         77 IQGPLFRIEPPYRFEFSNESGGRLDCAAQGSPT-PKIEWL  115 (116)
Q Consensus        77 ~~~p~~~~~~~~~~~~~~g~~~~l~C~~~g~P~-p~i~W~  115 (116)
                         |.+..+. ....+..|+++.+.|.+.|.|+ |.+.|+
T Consensus       707 ---p~f~~PL-~~~~V~~get~vlqC~a~~~~a~pr~~W~  742 (873)
T KOG4194|consen  707 ---PSFSIPL-EDQLVVVGETLVLQCLAEGAPADPRLEWF  742 (873)
T ss_pred             ---Ccccccc-cceEEEecceEEEEEecCCCCCCcccccc
Confidence               6776665 7788889999999999999997 999997


No 6  
>cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig4_L1-CAM_like:  fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM.
Probab=99.46  E-value=1e-12  Score=69.30  Aligned_cols=58  Identities=28%  Similarity=0.498  Sum_probs=45.0

Q ss_pred             CcEEEEEccCCeeeeccc-cceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE-EEEE
Q psy11568          1 MYVLLWLIRDNTVIAYVK-DLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS-RFVH   65 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~-~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~-~~~~   65 (116)
                      .|.++| +++|.++.... ..+....++.|.|.++..+      |+|.|.|.|.|..|...+ ..|.
T Consensus        15 ~p~i~W-~k~g~~i~~~~~~~~~~~~~~~L~I~~~~~~------D~G~Y~C~a~N~~G~~~~~~~l~   74 (76)
T cd05867          15 TPNITW-SINGAPIEGTDPDPRRHVSSGALILTDVQPS------DTAVYQCEARNRHGNLLANAHVH   74 (76)
T ss_pred             CCeEEE-EECCEECCCCCCCceEEeeCCEEEECCCChh------hCEEEEEEEECCCCeEEEEEEEE
Confidence            378999 89999886432 2245566789999999765      999999999999998875 4343


No 7  
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin. Ig_Myotilin_C: C-terminal immunoglobulin (Ig)-like domain of myotilin. Mytolin belongs to the palladin-myotilin-myopalladin family. Proteins belonging to the latter family contain multiple Ig-like domains and function as scaffolds, modulating actin cytoskeleton. Myotilin is most abundant in skeletal and cardiac muscle, and is involved in maintaining sarcomere integrity. It binds to alpha-actinin, filamin and actin. Mutations in myotilin lead to muscle disorders.
Probab=99.45  E-value=8.7e-13  Score=69.46  Aligned_cols=53  Identities=32%  Similarity=0.548  Sum_probs=40.8

Q ss_pred             CcEEEEEccCCeeeeccccceEE--eeC-C--eEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIA--LSN-G--SLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~--~~~-~--~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      +|.|+| +++|+++....+ ++.  ..+ +  +|.|.++..+      |+|.|+|.|.|..|...+
T Consensus        12 ~P~i~W-~k~~~~i~~~~~-r~~~~~~~~g~~~L~I~~~~~~------D~G~Y~C~A~N~~G~~~~   69 (75)
T cd05892          12 PPKIFW-KRNNEMVQYNTD-RISLYQDNSGRVTLLIKNVNKK------DAGWYTVSAVNEAGVATC   69 (75)
T ss_pred             CCeEEE-EECCEECcCCCC-eEEEEEcCCCcEEEEECCCChh------hCEEEEEEEEcCcCeEEE
Confidence            489999 889998864222 332  222 2  6999999766      999999999999998875


No 8  
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2. Ig1_Contactin-2: First Ig domain of the neural cell adhesion molecule contactin-2-like. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. It may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module by contacts between IG domains 1 and 4, and domains 2 and 3. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-2 is also expressed in retinal amacrine cells in the developing c
Probab=99.42  E-value=3.2e-12  Score=70.11  Aligned_cols=60  Identities=23%  Similarity=0.396  Sum_probs=46.1

Q ss_pred             CcEEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEEEEEEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILSRFVHV   66 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~~~~~v   66 (116)
                      +|.++| ++||.++....+.++...++.|.|.++..     ..|+|.|.|.|.|..|...+..+.+
T Consensus        33 ~p~i~W-~~~g~~l~~~~~~~~~~~~g~L~I~~~~~-----~~D~G~Y~C~A~N~~G~~~s~~a~l   92 (94)
T cd05850          33 PATYRW-KMNGTEIKFAPESRYTLVAGNLVINNPQK-----ARDAGSYQCLAINRCGTVVSREANL   92 (94)
T ss_pred             CCEEEE-EECCEECccCCCceEEEECCeEEEccCCc-----cCcCEEEEEEEEcCcCcEEEEEEEE
Confidence            488999 89999886444445666778999988642     2399999999999999988754443


No 9  
>PHA02785 IL-beta-binding protein; Provisional
Probab=99.42  E-value=6.4e-12  Score=82.95  Aligned_cols=95  Identities=16%  Similarity=0.231  Sum_probs=64.8

Q ss_pred             CcEEEEEccCCeeeeccccceEE-eeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE-E--E--EEEEeCcEeee
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIA-LSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS-R--F--VHVKAGSVVSL   74 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~-~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~-~--~--~~v~~~~~~~~   74 (116)
                      +|.|+| ++++. +.   ..+.. ..++.|.|.++..+      |+|.|+|.+.|..|.... .  .  |.|..+     
T Consensus       155 ~~~i~W-~k~~~-~~---~~r~~~~~~~~L~i~~v~~~------d~G~Y~C~~~n~~g~~~~~~t~~v~l~V~~~-----  218 (326)
T PHA02785        155 NADIIW-SGHRR-LR---NKRLKQRTPGIITIEDVRKN------DAGYYTCVLKYIYGDKTYNVTRIVKLEVRDR-----  218 (326)
T ss_pred             CceEEE-ccCCc-cC---CcceEecCCCeEEEeecChh------hCeEEEEEEEeccCCEEEeEEEEEEEEEecc-----
Confidence            368999 66643 22   22332 34578999999766      999999999999876542 2  2  222211     


Q ss_pred             eccCCCceEecCCCeEEEeCCCcEEEEeeecCcCCc---eeEEe
Q psy11568         75 LDIQGPLFRIEPPYRFEFSNESGGRLDCAAQGSPTP---KIEWL  115 (116)
Q Consensus        75 ~~~~~p~~~~~~~~~~~~~~g~~~~l~C~~~g~P~p---~i~W~  115 (116)
                        . .|..+..| ....+..|+.+.|.|.+.|.|.|   .+.|+
T Consensus       219 --~-~pp~~~~p-~~~~~~~G~~v~L~C~a~g~P~~~~~~v~W~  258 (326)
T PHA02785        219 --I-IPPTMQLP-EGVVTSIGSNLTIACRVSLRPPTTDADVFWI  258 (326)
T ss_pred             --C-CCceecCC-CcEEecCCCcEEEEEEEECCCCCCCceEEEE
Confidence              1 13334444 66777889999999999998864   79996


No 10 
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig5_Contactin-1: fifth Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=99.42  E-value=1.7e-12  Score=68.02  Aligned_cols=52  Identities=23%  Similarity=0.376  Sum_probs=41.7

Q ss_pred             CcEEEEEccCCeeeeccccceEE-eeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIA-LSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~-~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      .|.|+| ++++..+..  +.++. ..+++|.|.++..+      |+|.|+|.|.|..|...+
T Consensus        15 ~p~v~W-~k~~~~l~~--~~r~~~~~~g~L~I~~v~~~------D~G~Y~C~A~N~~G~~~~   67 (73)
T cd05852          15 KPKFSW-SKGTELLVN--NSRISIWDDGSLEILNITKL------DEGSYTCFAENNRGKANS   67 (73)
T ss_pred             CCEEEE-EeCCEeccc--CCCEEEcCCCEEEECcCChh------HCEEEEEEEECCCCceeE
Confidence            378999 888887753  23443 45679999999766      999999999999998875


No 11 
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5. Ig1_Contactin-5: First Ig domain of the neural cell adhesion molecule contactin-5. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains, anchored to the membrane by glycosylphosphatidylinositol. The different contactins show different expression patterns in the central nervous system. In rats, a lack of contactin-5 (NB-2) results in an impairment of the neuronal activity in the auditory system. Contactin-5 is expressed specifically in the postnatal nervous system, peaking at about 3 weeks postnatal. Contactin-5 is highly expressed in the adult human brain in the occipital lobe and in the amygdala; lower levels of expression have been detected in the corpus callosum, caudate nucleus, and spinal cord.
Probab=99.41  E-value=2.2e-12  Score=70.78  Aligned_cols=57  Identities=35%  Similarity=0.511  Sum_probs=44.1

Q ss_pred             CcEEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEEEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILSRF   63 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~~~   63 (116)
                      .|.|+| ++||.++......++...++.|.|.++..     ..|+|.|+|.|.|..|...+..
T Consensus        33 ~P~i~W-~k~g~~l~~~~~~~~~~~~g~L~i~~~~~-----~~D~G~Y~C~A~N~~G~~~S~~   89 (94)
T cd05848          33 VPTYRW-LRNGTEIDTESDYRYSLIDGNLIISNPSE-----VKDSGRYQCLATNSIGSILSRE   89 (94)
T ss_pred             CCEEEE-EECCeECccCCCceEEeeCCeEEEccCCc-----cCcCEEEEEEEEcCCCeEEecc
Confidence            489999 89999886433445566678899988742     2399999999999999887643


No 12 
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin. Ig_Palladin_C: C-terminal immunoglobulin (Ig)-like domain of palladin. Palladin belongs to the palladin-myotilin-myopalladin family. Proteins belonging to this family contain multiple Ig-like domains and function as scaffolds, modulating actin cytoskeleton. Palladin binds to alpha-actinin ezrin, vasodilator-stimulated phosphoprotein VASP, SPIN90 (DIP, mDia interacting protein), and Src. Palladin also binds F-actin directly, via its Ig3 domain. Palladin is expressed as several alternatively spliced isoforms, having various combinations of Ig-like domains, in a cell-type-specific manner. It has been suggested that palladin's different Ig-like domains may be specialized for distinct functions.
Probab=99.41  E-value=2.1e-12  Score=68.03  Aligned_cols=53  Identities=23%  Similarity=0.442  Sum_probs=40.4

Q ss_pred             CcEEEEEccCCeeeeccccceEEe--eC-C--eEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIAL--SN-G--SLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~~--~~-~--~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      .|+|+| ++++.++.... .++..  .+ +  .|.|.++..+      |+|.|+|.|.|..|...+
T Consensus        12 ~P~v~W-~k~~~~l~~~~-~~~~~~~~~~~~~~L~I~~v~~~------D~G~Y~C~A~N~~G~~~~   69 (75)
T cd05893          12 HPQIFW-KKENESLTHNT-DRVSMHQDNCGYICLLIQGATKE------DAGWYTVSAKNEAGIVSC   69 (75)
T ss_pred             CCEEEE-EECCEECCCCC-CeEEEEEcCCCEEEEEECCCCHH------HCEEEEEEEEcCCCEEEE
Confidence            489999 89988886422 23333  22 2  5899999766      999999999999998875


No 13 
>cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule). Ig6_NrCAM: sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule). NrCAM belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region, and an intracellular domain. NrCAM is primarily expressed in the nervous system.
Probab=99.40  E-value=4.3e-12  Score=67.15  Aligned_cols=63  Identities=24%  Similarity=0.404  Sum_probs=44.4

Q ss_pred             CcEEEEEccCCeeeeccccceE--EeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEEEEEEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRI--ALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILSRFVHV   66 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~--~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~~~~~v   66 (116)
                      +|+|+| +++|.++...++.+.  ...++.|.|..+..++  ...|+|.|+|.|.|..|...+..++|
T Consensus        12 ~P~i~W-~k~g~~l~~~~~~~~~~~~~~g~l~i~~~~~~~--~~~d~G~Y~C~A~N~~G~~~s~~~~~   76 (77)
T cd05874          12 PPSFSW-TRNGTHFDIDKDPKVTMKPNTGTLVINIMNGEK--AEAYEGVYQCTARNERGAAVSNNIVI   76 (77)
T ss_pred             CCeEEE-EECCeECCCcCCCCEEEeCCCceEEEeccccCC--CCCCCEEEEEEEEcCCCeEEeeEEEE
Confidence            489999 899998743333233  3346788888876431  13478999999999999888765543


No 14 
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR). Ig2_VEGFR: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-2 is a major mediator of the mitogenic, angiogenic and microvascular permeability-enhancing effects of VEGF-A. VEGFR-1 may play an inhibitory part in these processes by binding VEGF and interfering with its interaction with VEGFR-2. VEGFR-1 has a signa
Probab=99.40  E-value=2.7e-12  Score=66.90  Aligned_cols=56  Identities=16%  Similarity=0.162  Sum_probs=43.7

Q ss_pred             CcEEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceE-EEEEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVIL-SRFVH   65 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~-~~~~~   65 (116)
                      +|.++| ++||+++...  .+....++.|.|.++..+      |+|.|+|.|.|..|... ..++.
T Consensus        12 ~p~v~W-~k~g~~l~~~--~~~~~~~~~L~I~~v~~~------D~G~YtC~a~N~~g~~~~~~~~~   68 (71)
T cd04976          12 PPEIQW-YKNGKLISEK--NRTKKSGHSLTIKDVTEE------DAGNYTVVLTNKQAKLEKRLTFT   68 (71)
T ss_pred             CCEEEE-EECCEECCCC--CEEEcCCCEEEECcCCHH------HCEEEEEEEEcCCccEEEEEEEE
Confidence            488999 8899988642  345556678999999766      99999999999998765 34443


No 15 
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule). Ig4_ NrCAM: fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule). NrCAM belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six IG-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. NrCAM is primarily expressed in the nervous system.
Probab=99.39  E-value=3.8e-12  Score=67.17  Aligned_cols=54  Identities=26%  Similarity=0.496  Sum_probs=41.9

Q ss_pred             CcEEEEEccCCeeeecccc-ceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKD-LRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~-~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      +|.|+| +++|+++...+. ......++.|.|.++...      |+|.|+|.|.|..|...+
T Consensus        15 ~P~i~W-~k~g~~i~~~~~~~~~~~~~~~l~i~~v~~~------D~G~Y~C~A~N~~G~~~~   69 (76)
T cd05868          15 KPSISW-LTNGVPIEIAPTDPSRKVDGDTIIFSKVQER------SSAVYQCNASNEYGYLLA   69 (76)
T ss_pred             CCeEEE-EECCEEccccCCCceEEecCCEEEECCCCHh------hCEEEEEEEEcCCCEEEE
Confidence            489999 889998864222 223345568999999655      999999999999998885


No 16 
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3). Ig2_VEGFR-3: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-3 (Flt-4) binds two members of the VEGF family (VEGF-C and -D) and is involved in tumor angiogenesis and growth.
Probab=99.39  E-value=2e-12  Score=66.59  Aligned_cols=53  Identities=19%  Similarity=0.182  Sum_probs=41.1

Q ss_pred             CcEEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE-EEEEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS-RFVHV   66 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~-~~~~v   66 (116)
                      +|.++| +|||+++..  +    ...+.|.|.++..+      |+|.|+|.|.|..|.... .++.|
T Consensus        12 ~P~v~W-~kdg~~l~~--~----~~~~~L~i~~v~~~------D~G~YtC~a~N~~g~~~~~~~~~l   65 (67)
T cd05863          12 PPEFQW-YKDGKLISG--K----HSQHSLQIKDVTEA------SAGTYTLVLWNSAAGLEKRISLEL   65 (67)
T ss_pred             CCEEEE-EECCEECcc--c----CCcCEEEECCCCHH------HCEEEEEEEEECCccEEEEEEEEE
Confidence            489999 999998852  1    13458999999766      999999999999987653 44443


No 17 
>cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2). Ig2_VEGF-2: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-2 (KDR/Flk-1) is a major mediator of the mitogenic, angiogenic and microvascular permeability-enhancing effects of VEGF-A; VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGF-A also interacts with VEGFR-1, which it binds more strongly than VEGFR-2.  VEGFR-2 and -1 may mediate a chemotactic and a survival signal in hematopoietic stem cells or leukemia cells.
Probab=99.39  E-value=3e-12  Score=66.52  Aligned_cols=51  Identities=12%  Similarity=0.056  Sum_probs=40.1

Q ss_pred             CcEEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      +|.++| ++||+++...  .+ ...+..|.|.++..+      |+|.|+|.|.|..|....
T Consensus        12 ~P~v~W-~k~g~~l~~~--~~-~~~~~~L~I~~v~~~------D~G~YtC~a~N~~G~~~~   62 (70)
T cd05864          12 PPEVKW-YKNGQLIVLN--HT-FKRGVHLTIYEVTEK------DAGNYTVVLTNPITKEEQ   62 (70)
T ss_pred             CCEEEE-EECCEECCCC--CE-EccCCEEEECcCCHH------HCEEEEEEEEECCCceee
Confidence            489999 9999998632  22 233458999999766      999999999999997663


No 18 
>cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC. TrkABC_d5: the fifth domain of Trk receptors TrkA, TrkB and TrkC, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors. They are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkA, TrkB, and TrkC share significant sequence homology and domain organization. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrkA, Band C mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. TrkA is recognized by NGF. TrkB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. TrkC is recognized by NT-3. NT-3 is promiscuous as in some cell systems it activates TrkA and TrkB receptors. TrkA is a receptor foun
Probab=99.39  E-value=3.9e-12  Score=67.94  Aligned_cols=54  Identities=24%  Similarity=0.282  Sum_probs=40.4

Q ss_pred             CcEEEEEccCCeeeeccccceEE--e-------eCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIA--L-------SNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~--~-------~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      .|.|+| ++||+++.........  .       ..+.|.|.++..+      |+|.|+|.|.|..|...+
T Consensus        12 ~P~v~W-~k~g~~i~~~~~~~~~~~~~~~~~~~~~~~L~I~~~~~~------D~G~YtC~A~N~~G~~~~   74 (81)
T cd04971          12 KPTLTW-YHNGAVLNESDYIRTEIHYEVTTPTEYHGCLQFDNPTHV------NNGNYTLVASNEYGQDSK   74 (81)
T ss_pred             CCcEEE-EECCEECcCCCceeEEEEeecccccccEEEEEECCCCcc------cCeEEEEEEEeCCCCeee
Confidence            489999 9999998753322111  1       1236999999765      999999999999998774


No 19 
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig6_Contactin-4: sixth Ig domain of the neural cell adhesion molecule contactin-4. Contactins are neural cell adhesion molecules, and are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The different contactins show different expression patterns in the central nervous system. Highest expresson of contactin-4 is in testes, thyroid, small intestine, uterus and brain. Contactin-4 plays a role in the response of neuroblastoma cells to differentiating agents, such as retinoids. The contactin 4 gene is associated with cerebellar degeneration in spinocerebellar ataxia type 16.
Probab=99.38  E-value=4.1e-12  Score=68.30  Aligned_cols=61  Identities=18%  Similarity=0.310  Sum_probs=45.8

Q ss_pred             cEEEEEccCCeeeec-cccceEEe-----eCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE-EEEEEEeC
Q psy11568          2 YVLLWLIRDNTVIAY-VKDLRIAL-----SNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS-RFVHVKAG   69 (116)
Q Consensus         2 p~v~W~~~~g~~~~~-~~~~~~~~-----~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~-~~~~v~~~   69 (116)
                      +.+.| ++||+++.. ..+.++..     ..+.|.|.++...      |+|.|+|.|.|..+...+ ..|.|..+
T Consensus        17 ~~~~W-~~dg~~i~~~~~~~~~~~~~~~~~~~~L~I~nv~~~------dsG~YtC~a~n~~~~~~a~a~L~V~~p   84 (85)
T cd05853          17 IVFTW-SFNGHLIDFQKDGDHFERVGGQDSAGDLMIRSIQLK------HAGKYVCMVQTSVDKLSAAADLIVRGP   84 (85)
T ss_pred             cEEEE-EECCEECcccCCCccEEEeccCCCCCcEEEecCCHH------HCEEEEEEEEcccCceEEEEEEEEecC
Confidence            67899 999999963 22323333     3458999999766      999999999999988874 55666543


No 20 
>PHA02826 IL-1 receptor-like protein; Provisional
Probab=99.38  E-value=1.3e-11  Score=77.59  Aligned_cols=67  Identities=13%  Similarity=0.245  Sum_probs=49.3

Q ss_pred             CCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE-EEEEEEeCcEeeeeccCCCceEecCCCeEEEeCCCcEEEEeee
Q psy11568         26 NGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS-RFVHVKAGSVVSLLDIQGPLFRIEPPYRFEFSNESGGRLDCAA  104 (116)
Q Consensus        26 ~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~-~~~~v~~~~~~~~~~~~~p~~~~~~~~~~~~~~g~~~~l~C~~  104 (116)
                      ++.|.|.++..+      |+|.|.|.+.|..+.... ..|.|..           +.      ....+.+|+.+.|.|.+
T Consensus        97 ~~~L~I~~v~~~------DsG~Y~C~a~N~~~~~~~~i~L~V~~-----------~~------~~~~~~~G~~v~L~C~~  153 (227)
T PHA02826         97 SENLWIGNVINI------DEGIYICTISSGNICEESTIRLTFDS-----------GT------INYQFNSGKDSKLHCYG  153 (227)
T ss_pred             CCeEEECCCChH------HCEEEEEEEEECCcceEEEEEEEEec-----------CC------ccceEecCCCEEEEeeC
Confidence            458999999766      999999999998776543 3333321           11      23456679999999998


Q ss_pred             c-----CcCCceeEEe
Q psy11568        105 Q-----GSPTPKIEWL  115 (116)
Q Consensus       105 ~-----g~P~p~i~W~  115 (116)
                      .     +.|.|.++|+
T Consensus       154 ~~~~~~~~p~p~I~Wy  169 (227)
T PHA02826        154 TDGISSTFKDYTLTWY  169 (227)
T ss_pred             CCCccccCCCceEEEE
Confidence            6     3468999997


No 21 
>cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin. Ig_Myotilin_like_C: immunoglobulin (Ig)-like domain in myotilin, palladin, and myopalladin.  Myotilin, palladin, and myopalladin function as scaffolds that regulate actin organization. Myotilin and myopalladin are most abundant in skeletal and cardiac muscle; palladin is ubiquitously expressed in the organs of developing vertebrates and  plays a key role in cellular morphogenesis. The three family members each interact with specific molecular partners: all three bind to alpha-actinin; in addition, palladin also binds to vasodilator-stimulated phosphoprotein (VASP) and ezrin, myotilin binds to filamin and actin, and myopalladin also binds to nebulin and cardiac ankyrin repeat protein (CARP).
Probab=99.37  E-value=8e-12  Score=65.79  Aligned_cols=54  Identities=26%  Similarity=0.486  Sum_probs=40.0

Q ss_pred             CcEEEEEccCCeeeecccc-ceEEeeC-C--eEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKD-LRIALSN-G--SLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~-~~~~~~~-~--~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      +|.|+| +++|..+..... ......+ +  .|.|.++..+      |+|.|+|.|.|..|...+
T Consensus        12 ~P~v~W-~k~~~~i~~~~~r~~~~~~~~~~~~L~I~~~~~~------D~G~Y~C~a~N~~G~~~~   69 (75)
T cd05744          12 PPQIFW-KKNNEMLTYNTDRISLYQDNCGRICLLIQNANKE------DAGWYTVSAVNEAGVVSC   69 (75)
T ss_pred             CCeEEE-EECCEECCCCCCcEEEEEcCCCeEEEEECCCCcc------cCEEEEEEEEcCCCcEEE
Confidence            489999 889988864222 1221122 2  5999999766      999999999999998875


No 22 
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins. Ig_Titin_like: immunoglobulin (Ig)-like domain found in titin-like proteins. Titin (also called connectin) is a fibrous sarcomeric protein specifically found in vertebrate striated muscle. Titin is gigantic, depending on isoform composition it ranges from 2970 to 3700 kDa, and is of a length that spans half a sarcomere. Titin largely consists of multiple repeats of Ig-like and fibronectin type 3 (FN-III)-like domains. Titin connects the ends of myosin thick filaments to Z disks and extends along the thick filament to the H zone.  It appears to function similarly to an elastic band, keeping the myosin filaments centered in the sarcomere during muscle contraction or stretching. Within the sarcomere, titin is also attached to or is associated with myosin binding protein C (MyBP-C). MyBP-C appears to contribute to the generation of passive tension by titin, and similar to titin has repeated Ig-like and FN-
Probab=99.37  E-value=8.6e-12  Score=65.39  Aligned_cols=54  Identities=19%  Similarity=0.254  Sum_probs=40.4

Q ss_pred             CcEEEEEccCCeeeeccccceEEee--CCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIALS--NGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~~~--~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      +|.++| +++|.++....+......  ...|.|.++..+      |+|.|+|.|.|..|....
T Consensus        13 ~p~v~W-~k~g~~l~~~~~~~~~~~~~~~~L~I~~~~~~------D~G~Y~C~a~N~~G~~~~   68 (74)
T cd05748          13 TPTVTW-SKDGKPLKLSGRVQIETTASSTSLVIKNAERS------DSGKYTLTLKNPAGEKSA   68 (74)
T ss_pred             CCeEEE-EECCEEcCCCCeEEEEECCCeEEEEECCCCcC------cCEEEEEEEECCCccEEE
Confidence            489999 899998853332222222  237999999766      999999999999998764


No 23 
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4. Ig2_PTK7: domain similar to the second immunoglobulin (Ig)-like domain in protein tyrosine kinase (PTK) 7, also known as CCK4. PTK7 is a subfamily of the receptor protein tyrosine kinase family, and is referred to as an RPTK-like molecule. RPTKs transduce extracellular signals across the cell membrane, and play important roles in regulating cell proliferation, migration, and differentiation. PTK7 is organized as an extracellular portion having seven Ig-like domains, a single transmembrane region, and a cytoplasmic tyrosine kinase-like domain. PTK7 is considered a pseudokinase as it has several unusual residues in some of the highly conserved tyrosine kinase (TK) motifs; it is predicted to lack TK activity. PTK7 may function as a cell-adhesion molecule. PTK7 mRNA is expressed at high levels in placenta, melanocytes, liver, lung, pancreas, and kidney. PTK7 is overexpressed in s
Probab=99.36  E-value=8.1e-12  Score=66.08  Aligned_cols=54  Identities=22%  Similarity=0.318  Sum_probs=40.6

Q ss_pred             CcEEEEEccCCeeeeccccc-eEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDL-RIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~-~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      .|.|+| +++|.++...... .....++.|.|.++..+      |+|.|.|.|.|..|...+
T Consensus        12 ~p~v~W-~k~g~~l~~~~~~~~~~~~~~~L~I~~~~~~------D~G~Y~C~a~N~~G~~~s   66 (77)
T cd05760          12 RPTYQW-FRDGTPLSDGQGNYSVSSKERTLTLRSAGPD------DSGLYYCCAHNAFGSVCS   66 (77)
T ss_pred             CCcEEE-EECCEECCCCCccEEEeCCCCEEEEeeCCcc------cCEEEEEEEEeCCCeEee
Confidence            378999 8999988643221 22223458999999766      999999999999998753


No 24 
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related). Ig4_L1-NrCAM_like: fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related). These proteins belong to the L1 subfamily of cell adhesion molecules (CAMs) and are comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. These molecules are primarily expressed in the nervous system. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth.
Probab=99.36  E-value=8.1e-12  Score=65.72  Aligned_cols=58  Identities=28%  Similarity=0.506  Sum_probs=44.0

Q ss_pred             CcEEEEEccCCeeeeccccc-eEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE-EEEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDL-RIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS-RFVH   65 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~-~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~-~~~~   65 (116)
                      .|.|+| +++|.++...... .....++.|.|.++..+      |+|.|+|.|.|..|...+ ..|.
T Consensus        15 ~p~i~W-~~~g~~~~~~~~~~~~~~~~~~L~i~~v~~~------D~G~Y~C~A~N~~G~~~~~~~l~   74 (76)
T cd04978          15 QPTITW-RLNGVPIEELPPDPRRRVDGGTLILSNVQPN------DTAVYQCNASNVHGYLLANAFVH   74 (76)
T ss_pred             CCEEEE-EECCEECCCCCCcceEEccCCEEEECCCChh------hCEEEEEEEEccCCeEEEeEEEE
Confidence            378999 8899888643322 34455678999999766      999999999999998775 4443


No 25 
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin. Ig3_Peroxidasin: the third immunoglobulin (Ig)-like domain in peroxidasin. Peroxidasin has a peroxidase domain and interacting extracellular motifs containing four Ig-like domains. It has been suggested that peroxidasin is secreted and has functions related to the stabilization of the extracellular matrix. It may play a part in various other important processes such as removal and destruction of cells which have undergone programmed cell death, and protection of the organism against non-self.
Probab=99.36  E-value=5e-12  Score=66.35  Aligned_cols=53  Identities=21%  Similarity=0.401  Sum_probs=41.7

Q ss_pred             CcEEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      .|.|+| +++|.++..... .....++.|.|.++..+      |+|.|+|.|.|..|...+
T Consensus        16 ~p~i~W-~k~g~~~~~~~~-~~~~~~~~L~I~~v~~~------D~G~Y~C~A~N~~G~~~~   68 (74)
T cd05745          16 QPVIAW-TKGGSQLSVDRR-HLVLSSGTLRISRVALH------DQGQYECQAVNIVGSQRT   68 (74)
T ss_pred             CCEEEE-EECCEECCCCCC-eEEccCCeEEEeeCCHH------hCEEEEEEEEeCCCceeE
Confidence            489999 889988763221 23345678999999766      999999999999998775


No 26 
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK). Ig8_MLCK: the eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK). MLCK is a key regulator of different forms of cell motility involving actin and myosin II.  Agonist stimulation of smooth muscle cells increases cytosolic Ca2+, which binds calmodulin.  This Ca2+-calmodulin complex in turn binds to and activates MLCK. Activated MLCK leads to the phosphorylation of the 20 kDa myosin regulatory light chain (RLC) of myosin II and the stimulation of actin-activated myosin MgATPase activity. MLCK is widely present in vertebrate tissues; it phosphorylates the 20 kDa RLC of both smooth and nonmuscle myosin II. Phosphorylation leads to the activation of the myosin motor domain and altered structural properties of myosin II. In smooth muscle MLCK it is involved in initiating contraction. In nonmuscle cells, MLCK may participate in cell division and cell motility; it has
Probab=99.36  E-value=1.1e-11  Score=68.50  Aligned_cols=61  Identities=15%  Similarity=0.177  Sum_probs=46.2

Q ss_pred             CcEEEEEccCCeeeeccccceEEe--eCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE-EEEEEEe
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIAL--SNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS-RFVHVKA   68 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~~--~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~-~~~~v~~   68 (116)
                      +|.+.| +++|.++....+.+...  ....|.|.++.++      |+|.|+|.+.|..|...+ ..|.|..
T Consensus        29 ~p~v~W-~kdg~~l~~~~~~~~~~~~~~s~L~I~~~~~~------D~G~Ytc~a~N~~G~~~~~~~l~V~~   92 (98)
T cd05762          29 PITCTW-MKFRKQIQEGEGIKIENTENSSKLTITEGQQE------HCGCYTLEVENKLGSRQAQVNLTVVD   92 (98)
T ss_pred             CCceEE-EECCEEecCCCcEEEEecCCeeEEEECCCChh------hCEEEEEEEEcCCCceeEEEEEEEec
Confidence            488999 99999986433333332  2347999999766      999999999999999885 6666654


No 27 
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins. Ig4_Neogenin: fourth immunoglobulin (Ig)-like domain in neogenin and related proteins. Neogenin  is a cell surface protein which is expressed in the developing nervous system of vertebrate embryos in the growing nerve cells. It is also expressed in other embryonic tissues, and may play a general role in developmental processes such as cell migration, cell-cell recognition, and tissue growth regulation. Included in this group is the tumor suppressor protein DCC, which is deleted in colorectal carcinoma . DCC and neogenin each have four Ig-like domains followed by six fibronectin type III domains, a transmembrane domain, and an intracellular domain.
Probab=99.36  E-value=9.5e-12  Score=64.80  Aligned_cols=53  Identities=13%  Similarity=0.307  Sum_probs=40.7

Q ss_pred             CcEEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      .|.++| +++|.++..... .....++.|.|.++..+      |+|.|+|.|.|..|...+
T Consensus        13 ~p~v~W-~k~g~~~~~~~~-~~~~~~~~l~i~~v~~~------D~G~Y~C~A~N~~G~~~~   65 (71)
T cd05723          13 TPTVKW-VKNGDMVIPSDY-FKIVKEHNLQVLGLVKS------DEGFYQCIAENDVGNVQA   65 (71)
T ss_pred             CCEEEE-EECCeECCCCCC-EEEEecCCEEEEcCCcc------cCEEEEEEEEcCCCEEEE
Confidence            489999 888887753222 22345667889999665      999999999999998875


No 28 
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig3_L1-CAM:  third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains, five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM.
Probab=99.35  E-value=6.1e-12  Score=65.54  Aligned_cols=58  Identities=21%  Similarity=0.210  Sum_probs=42.6

Q ss_pred             CcEEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE-EEEEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS-RFVHV   66 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~-~~~~v   66 (116)
                      +|.|.| ++++..+... .......++.|.|.++..+      |+|.|+|.|.|..|...+ ..|.|
T Consensus        12 ~P~v~W-~k~~~~~~~~-~~~~~~~~~~L~I~~v~~~------D~G~Y~C~a~N~~G~~~~~~~l~V   70 (71)
T cd05876          12 TPEVHW-DRIDGPLSPN-RTKKLNNNKTLQLDNVLES------DDGEYVCTAENSEGSARHHYTVTV   70 (71)
T ss_pred             CCeEEE-EECCcCCCCC-ceeEEcCCCEEEEcccCHH------hCEEEEEEEEcCCCeEEEEEEEEE
Confidence            489999 7887766431 2223445679999999766      999999999999998764 44443


No 29 
>cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB. TrkB_d5: the fifth domain of Trk receptor TrkB, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors, which mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. The Trks are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkB shares significant sequence homology and domain organization with TrkA, and TrkC. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrKB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. In some cell systems NT-3 can activate TrkA and TrkB receptors. TrKB transcripts are found throughout multiple structures of the central and peripheral nervous systems.
Probab=99.35  E-value=5.5e-12  Score=66.92  Aligned_cols=54  Identities=17%  Similarity=0.211  Sum_probs=40.4

Q ss_pred             CcEEEEEccCCeeeeccccceE---E----eeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRI---A----LSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~---~----~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      .|.|+| ++||+++........   .    ...+.|.|.++..+      |+|.|+|.|+|..|....
T Consensus        12 ~Pti~W-~kng~~l~~~~~~~~~~~~~~~~~~~~~L~i~~~~~~------D~G~YtC~A~N~~G~~~~   72 (79)
T cd05855          12 KPTLQW-FHEGAILNESEYICTKIHVINNTEYHGCLQLDNPTHL------NNGIYTLVAKNEYGEDEK   72 (79)
T ss_pred             CCceEE-EECCEECCCCcceeeeeEeecccceEEEEEECCCCcc------cCEEEEEEEEcCCcccce
Confidence            489999 999999964322111   1    12247999999766      999999999999997764


No 30 
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF). Ig6_hNeurofascin_like:  the sixth immunoglobulin (Ig)-like domain of human neurofascin (NF). NF belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region, and a cytoplasmic domain. NF has many alternatively spliced isoforms having different temporal expression patterns during development. NF participates in axon subcellular targeting and synapse formation, however little is known of the functions of the different isoforms.
Probab=99.35  E-value=1.7e-11  Score=64.87  Aligned_cols=63  Identities=24%  Similarity=0.380  Sum_probs=43.8

Q ss_pred             CcEEEEEccCCeeeeccccceE--EeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEEEEEEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRI--ALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILSRFVHV   66 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~--~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~~~~~v   66 (116)
                      .|.|+| +++|+++....+.++  ...++.|.|.++....  ...|+|.|.|.|.|..|.+.+..++|
T Consensus        12 ~P~v~W-~k~g~~~~~~~~~~~~~~~~~~~L~i~~~~~~~--~~~d~G~Y~C~A~N~~G~~~s~~~~~   76 (77)
T cd05875          12 VPTFQW-TRNGKFFNVAKDPRVSMRRRSGTLVIDFSGGGR--PEDYEGEYQCFARNNLGTALSNKILL   76 (77)
T ss_pred             CCEEEE-EECCEEccCcCCCcEEEeCCCceEEEeccCCCC--CCCCCEEEEEEEEeccceEEEEEEEE
Confidence            489999 899987643223333  3356789998874210  12379999999999999888765543


No 31 
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins. Ig4_SCFR_like; fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR). In addition to SCFR this group also includes the fourth Ig domain of platelet-derived growth factor receptors (PDGFR), alpha and beta, the fourth Ig domain of macrophage colony stimulating factor (M-CSF), and the Ig domain of the receptor tyrosine kinase KIT. SCFR and the PDGFR alpha and beta have similar organization: an extracellular component having five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. SCFR and its ligand SCF are critical for normal hematopoiesis, mast cell development, melanocytes and gametogenesis. SCF binds to the second and third Ig-like domains of SCFR, this fourth Ig-like domain participates in SCFR dimerization, which follows ligand binding. Deletion of this fourth SCFR_Ig-like domain abolishes
Probab=99.34  E-value=6.6e-12  Score=69.71  Aligned_cols=59  Identities=17%  Similarity=0.095  Sum_probs=42.6

Q ss_pred             CcEEEEEccCCeeeeccccceEEee-------CCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE-EEEEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIALS-------NGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS-RFVHV   66 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~~~-------~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~-~~~~v   66 (116)
                      +|.++| +|||+++...........       ...|.|.++..+      |+|.|+|.|.|..|.... ..|.|
T Consensus        33 ~p~v~W-~Kdg~~i~~~~~~~~~~~~~~~~~~~~~L~i~~v~~~------D~G~Ytc~A~N~~G~~~~t~~L~V   99 (101)
T cd04975          33 PPHINW-TYDNRTLTNKLTEIVTSENESEYRYVSELKLVRLKES------EAGTYTFLASNSDASKSLTFELYV   99 (101)
T ss_pred             CCccEE-EeCCeeCCCCcceeEEEeccCcceEEEEEEEeecCHh------hCeeEEEEEECCCccEEEEEEEEE
Confidence            478999 999999874222111211       247999999766      999999999999997763 44444


No 32 
>cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins. Ig6_L1-CAM_like: domain similar to the sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM).  L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains NrCAM [Ng(neuronglia)CAM-related cell adhesion molecule], which is primarily expressed in the nervous system, and human neurofascin.
Probab=99.34  E-value=8.2e-12  Score=66.06  Aligned_cols=62  Identities=27%  Similarity=0.408  Sum_probs=43.3

Q ss_pred             CcEEEEEccCCeeeeccccceE--EeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEEEEEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRI--ALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILSRFVH   65 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~--~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~~~~~   65 (116)
                      +|+|+| ++||.++......++  ...++.|.|.++....  ...|+|.|.|.|.|..|...+..++
T Consensus        12 ~P~v~W-~k~g~~l~~~~~~~~~~~~~~g~L~i~~~~~~~--~~~d~G~Y~C~A~N~~G~~~s~~~~   75 (77)
T cd05733          12 PPTFSW-TRNGTHFDPEKDPRVTMKPDSGTLVIDNMNGGR--AEDYEGEYQCYASNELGTAISNEIH   75 (77)
T ss_pred             CCeEEE-EECCeECCCCCCCCEEEeCCCCEEEEeccCCCC--CcCCCEEEEEEEEcCCCcEEccccE
Confidence            489999 899998753222233  3346789998875310  1248999999999999988775443


No 33 
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1. Ig1_Contactin-1: First Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may, through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=99.34  E-value=1.7e-11  Score=67.11  Aligned_cols=57  Identities=23%  Similarity=0.311  Sum_probs=43.5

Q ss_pred             CcEEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEEEEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILSRFV   64 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~~~~   64 (116)
                      +|.|+| ++++.++... ..++...++.|.|.++.+     ..|+|.|.|.|.|..|...+..+
T Consensus        33 ~P~i~W-~k~~~~i~~~-~~~~~~~~g~L~I~~~~~-----~~D~G~Y~C~A~N~~G~~~s~~a   89 (93)
T cd05849          33 FPIYKW-RKNNLDIDLT-NDRYSMVGGNLVINNPDK-----YKDAGRYVCIVSNIYGKVRSREA   89 (93)
T ss_pred             CCEEEE-EECCEEccCC-CCeEEEECCEEEECcCCc-----CCCCEEEEEEEEeCcceEEEccE
Confidence            489999 8898887532 235566778999988742     23999999999999998887543


No 34 
>KOG4221|consensus
Probab=99.33  E-value=1.5e-11  Score=90.03  Aligned_cols=101  Identities=22%  Similarity=0.414  Sum_probs=74.9

Q ss_pred             cEEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE--EEEEEEeCcEeeeeccCC
Q psy11568          2 YVLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS--RFVHVKAGSVVSLLDIQG   79 (116)
Q Consensus         2 p~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~--~~~~v~~~~~~~~~~~~~   79 (116)
                      |.|.| .+|..++...+ ..+.+.+|.|.|.++..      +|.|.|+|.+++......+  ..|.|.....  ...  .
T Consensus       170 p~i~w-~kn~~pl~~~~-r~i~lpsG~L~I~~~qp------~d~g~yrc~vt~g~~~r~S~~a~ltv~s~~~--~~~--~  237 (1381)
T KOG4221|consen  170 PTIMW-LKNDQPLPLDS-RVIVLPSGALEISGLQP------SDTGEYRCVVTGGASQRTSNEAELTVLSDPG--ALN--K  237 (1381)
T ss_pred             ceeEE-ecccccccCCC-cEEEcCCCcEEeccccc------CCCceEEEEEecCCcCCccceeEEEecCCcc--ccc--c
Confidence            68999 99999876544 45677899999999954      4999999999998765554  3444441100  000  1


Q ss_pred             CceEecCCCeEEEeCCCcEEEEeeecCcCCceeEEe
Q psy11568         80 PLFRIEPPYRFEFSNESGGRLDCAAQGSPTPKIEWL  115 (116)
Q Consensus        80 p~~~~~~~~~~~~~~g~~~~l~C~~~g~P~p~i~W~  115 (116)
                      -.|...| ....+..|+.+.|+|.+.|-|.|.+.|.
T Consensus       238 ~~fl~~p-~~~~v~~g~~v~leCvvs~~p~p~v~Wl  272 (1381)
T KOG4221|consen  238 LVFLDEP-SNAVVVEGDDVVLECVVSGVPKPSVKWL  272 (1381)
T ss_pred             eeeecCC-CccccccCCcEEEEEEecCCCCCceEEe
Confidence            2344455 7788889999999999999999999996


No 35 
>cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of  the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. Ig2_RPTP_IIa_LAR_like: domain similar to the second immunoglobulin (Ig)-like domain found in the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. LAR belongs to the RPTP type IIa subfamily. Members of this subfamily are cell adhesion molecule-like proteins involved in central nervous system (CNS) development. They have large extracellular portions, comprised of multiple Ig-like domains and two to nine fibronectin type III (FNIII) domains, and a cytoplasmic portion having two tandem phosphatase domains.
Probab=99.33  E-value=1.7e-11  Score=64.30  Aligned_cols=55  Identities=27%  Similarity=0.398  Sum_probs=41.9

Q ss_pred             CcEEEEEccCCeeeeccccceEE-eeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIA-LSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILSR   62 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~-~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~~   62 (116)
                      .|.|+| ++++.++......++. ..++.|.|.++..+      |+|.|+|.|.|..|...+.
T Consensus        12 ~p~v~W-~k~~~~~~~~~~~~~~~~~~g~L~i~~~~~~------D~G~Y~C~a~N~~G~~~s~   67 (74)
T cd05738          12 DPEITW-FKDFLPVDTTSNGRIKQLRSGALQIENSEES------DQGKYECVATNSAGTRYSA   67 (74)
T ss_pred             CCEEEE-EECCEECccCCCCCEEEcCCcEEEECCCChh------hCEEEEEEEECCCCceEcc
Confidence            478999 8999887632233333 34668999999655      9999999999999987653


No 36 
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig3_Contactin-1: Third Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=99.33  E-value=1.1e-11  Score=67.19  Aligned_cols=52  Identities=19%  Similarity=0.251  Sum_probs=41.1

Q ss_pred             CcEEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      .|.|+| ++++.++..  ..+....++.|.|.++..+      |+|.|+|.|.|..|...+
T Consensus        30 ~P~v~W-~k~~~~~~~--~~~~~~~~~~L~I~~v~~~------D~G~Y~C~A~N~~G~~~~   81 (88)
T cd05851          30 VPVIRW-RKILEPMPA--TAEISMSGAVLKIFNIQPE------DEGTYECEAENIKGKDKH   81 (88)
T ss_pred             CCEEEE-EECCcCCCC--CCEEecCCCEEEECcCChh------hCEEEEEEEEcCCCceEE
Confidence            489999 888877653  2344455668999999766      999999999999998774


No 37 
>KOG4194|consensus
Probab=99.32  E-value=6.6e-12  Score=87.00  Aligned_cols=73  Identities=27%  Similarity=0.499  Sum_probs=61.1

Q ss_pred             eEEecCCCCCCCCCCCCceEEEEEEEcCCCceEEEEEEEEeCcEeeeeccCCCceEecCCCeEEEeCCCcEEEEeeecCc
Q psy11568         28 SLMFPPFPETGFRPDVHSTVYRCRASNEAGVILSRFVHVKAGSVVSLLDIQGPLFRIEPPYRFEFSNESGGRLDCAAQGS  107 (116)
Q Consensus        28 ~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~~~~~v~~~~~~~~~~~~~p~~~~~~~~~~~~~~g~~~~l~C~~~g~  107 (116)
                      .|.+.+|.-+      |+|.|+|.++|.+|..++..+.+...       . .|.|...| .+..+..|++++|.|.+.|.
T Consensus       575 ~L~L~nVt~t------d~grYQCVvtN~FGStysqk~KltV~-------~-~PsFtktP-~dltl~tg~mArl~CaAtG~  639 (873)
T KOG4194|consen  575 ILHLDNVTFT------DEGRYQCVVTNHFGSTYSQKAKLTVN-------Q-APSFTKTP-EDLTLRTGQMARLECAATGH  639 (873)
T ss_pred             eeeeeeeecc------cCceEEEEEecccCcchhheeEEEee-------c-cCccccCc-ccceeecccceeeeeeccCC
Confidence            4888999766      99999999999999998744333321       1 28888887 78889999999999999999


Q ss_pred             CCceeEEe
Q psy11568        108 PTPKIEWL  115 (116)
Q Consensus       108 P~p~i~W~  115 (116)
                      |.|+|.|.
T Consensus       640 P~PeIawq  647 (873)
T KOG4194|consen  640 PRPEIAWQ  647 (873)
T ss_pred             CCcceeeh
Confidence            99999995


No 38 
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin. Ig5_Contactin_like: Fifth Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=99.32  E-value=1.4e-11  Score=64.51  Aligned_cols=53  Identities=19%  Similarity=0.290  Sum_probs=41.2

Q ss_pred             CcEEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      .|.++| ++++..+....+. ....++.|.|.++..+      |+|.|+|.|.|..|...+
T Consensus        15 ~p~v~W-~k~~~~~~~~~~~-~~~~~~~L~i~~v~~~------D~G~Y~C~a~N~~G~~~~   67 (73)
T cd04969          15 KPTISW-SKGTELLTNSSRI-CIWPDGSLEILNVTKS------DEGKYTCFAENFFGKANS   67 (73)
T ss_pred             CCEEEE-EECCEEcccCCCE-EECCCCeEEEccCChh------HCEEEEEEEECCCCceEE
Confidence            479999 8888887543222 2334568999999766      999999999999998774


No 39 
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein. Ig_Myomesin_like_C: domain similar to the C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein. Myomesin and M-protein are both structural proteins localized to the M-band, a transverse structure in the center of the sarcomere, and are candidates for M-band bridges. Both proteins are modular, consisting mainly of repetitive Ig-like and fibronectin type III (FnIII) domains. Myomesin is expressed in all types of vertebrate striated muscle; M-protein has a muscle-type specific expression pattern. Myomesin is present in both slow and fast fibers; M-protein is present only in fast fibers. It has been suggested that myomesin acts as a molecular spring with alternative splicing as a means of modifying its elasticity.
Probab=99.32  E-value=1.6e-11  Score=67.04  Aligned_cols=54  Identities=15%  Similarity=0.228  Sum_probs=41.1

Q ss_pred             CcEEEEEccCCeeeeccccceEEee-C--CeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIALS-N--GSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~~~-~--~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      .|.+.| +++|.++....+.+.... +  ..|.|.++..+      |+|.|+|.|.|..|....
T Consensus        30 ~p~v~W-~k~g~~l~~~~~~~~~~~~~~~~~L~I~~v~~~------D~G~Y~C~a~N~~G~~~~   86 (92)
T cd05737          30 DPEVSW-LKNDQALALSDHYNVKVEQGKYASLTIKGVSSE------DSGKYGIVVKNKYGGETV   86 (92)
T ss_pred             CCeEEE-EECCEECccCCCEEEEEcCCCEEEEEEccCChh------hCEEEEEEEEECCCcceE
Confidence            388999 899998865433333333 2  26999999766      999999999999998764


No 40 
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM). Ig_CEACAM_D4:  immunoglobulin (Ig)-like domain 4 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surface. This family corresponds to the
Probab=99.32  E-value=2.2e-11  Score=66.43  Aligned_cols=56  Identities=21%  Similarity=0.425  Sum_probs=42.0

Q ss_pred             CcEEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEEEEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILSRFV   64 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~~~~   64 (116)
                      .|.|+| +++|.++.. .+......++.|.|.++.++      |+|.|.|.|.|..|...+..+
T Consensus        31 ~p~i~W-~kng~~l~~-~~~~~~~~~~~L~I~~v~~~------D~G~Y~C~a~N~~G~~~S~~~   86 (91)
T cd05740          31 ATYIWW-VNNGSLLVP-PRLQLSNDNRTLTFNNVTRS------DTGHYQCEASNEVSNMTSDPY   86 (91)
T ss_pred             CCEEEE-EECCEECCC-CCEEEeCCCCEEEECcCChh------hCEEEEEEEEcCCCCEEeeeE
Confidence            488999 899988753 12222223458999999766      999999999999998876443


No 41 
>PHA02785 IL-beta-binding protein; Provisional
Probab=99.31  E-value=4.1e-11  Score=79.17  Aligned_cols=94  Identities=19%  Similarity=0.311  Sum_probs=61.8

Q ss_pred             cEEEEEccCCeeeeccccceEEeeCC-eEEecCCCCCCCCCCCCceEEEEEEEcCCCceE-EEEEEEEeCcEeeeeccCC
Q psy11568          2 YVLLWLIRDNTVIAYVKDLRIALSNG-SLMFPPFPETGFRPDVHSTVYRCRASNEAGVIL-SRFVHVKAGSVVSLLDIQG   79 (116)
Q Consensus         2 p~v~W~~~~g~~~~~~~~~~~~~~~~-~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~-~~~~~v~~~~~~~~~~~~~   79 (116)
                      |.|+| +|+|....    ......++ .|.|.++..+      |+|.|+|.+.|..|... +..|.|....        .
T Consensus        61 ~~i~W-~K~g~~~~----~~~~~~~g~~l~i~~~~~~------DsG~Y~C~a~N~~g~~~~s~~L~V~~~~--------~  121 (326)
T PHA02785         61 LDILW-EKRGADND----RIIPIDNGSNMLILNPTQS------DSGIYICITKNETYCDMMSLNLTIVSVS--------E  121 (326)
T ss_pred             ceEEE-EECCCccc----eEEEccCCceEEEcccCcc------cCeEEEEEEECCCcceEEEEEEEEEecC--------C
Confidence            68999 88774321    12334444 4888888655      99999999999987655 3555554320        0


Q ss_pred             CceEecCCCeEEEeCCCcEEEEee-----ecCcCCceeEEe
Q psy11568         80 PLFRIEPPYRFEFSNESGGRLDCA-----AQGSPTPKIEWL  115 (116)
Q Consensus        80 p~~~~~~~~~~~~~~g~~~~l~C~-----~~g~P~p~i~W~  115 (116)
                      +.+...+ ....+.+|..+.+.|.     ..+.|.|.++|+
T Consensus       122 ~~~~~~~-~~~~~~~g~~~~i~C~~~~~~~~~~~~~~i~W~  161 (326)
T PHA02785        122 SNIDLIS-YPQIVNERSTGEMVCPNINAFIASNVNADIIWS  161 (326)
T ss_pred             Cccceee-ccceecccCcEEEECCChhhcccCCCCceEEEc
Confidence            2221111 2334568999999997     346799999996


No 42 
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig2_Robo: domain similar to the second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antago
Probab=99.30  E-value=2.8e-11  Score=65.07  Aligned_cols=55  Identities=18%  Similarity=0.326  Sum_probs=42.0

Q ss_pred             CcEEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILSR   62 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~~   62 (116)
                      .|.+.| +++|..+...........++.|.|.++..+      |+|.|+|.+.|..|...+.
T Consensus        26 ~p~i~W-~k~g~~~~~~~~~~~~~~~~~L~I~~~~~~------D~G~Y~C~a~N~~G~~~s~   80 (86)
T cd05724          26 EPTVSW-RKDGQPLNLDNERVRIVDDGNLLIAEARKS------DEGTYKCVATNMVGERESA   80 (86)
T ss_pred             CCEEEE-EECCEECCCCCCCEEEccCCEEEEeECCcc------cCEEEEEEEEeccCceeee
Confidence            378999 899988764222222344678999999766      9999999999999987753


No 43 
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily. Ig_1: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=99.30  E-value=2.4e-11  Score=63.83  Aligned_cols=58  Identities=19%  Similarity=0.327  Sum_probs=39.6

Q ss_pred             CcEEEEEccCCeee-eccccceE--EeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE-EEEE
Q psy11568          1 MYVLLWLIRDNTVI-AYVKDLRI--ALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS-RFVH   65 (116)
Q Consensus         1 ~p~v~W~~~~g~~~-~~~~~~~~--~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~-~~~~   65 (116)
                      .|.|+| +++|... ......++  ...++.|.|.++..+      |+|.|.|.|.|..|...+ ..|.
T Consensus        12 ~P~v~W-~k~~~~~~~~~~~~~~~~~~~~~~L~I~~~~~~------D~G~Y~C~A~N~~G~~~~~~~l~   73 (75)
T cd05763          12 TPQIAW-QKDGGTDFPAARERRMHVMPEDDVFFIVDVKIE------DTGVYSCTAQNTAGSISANATLT   73 (75)
T ss_pred             CCEEEE-EeCCCccCCcccccceEEecCCCEEEEeeCCcc------cCEEEEEEEEcCCCEEEeeEEEE
Confidence            478999 7776532 21112222  223568999999766      999999999999998764 4343


No 44 
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig3_Robo: domain similar to the third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antagoni
Probab=99.30  E-value=2.4e-11  Score=62.87  Aligned_cols=52  Identities=21%  Similarity=0.347  Sum_probs=39.2

Q ss_pred             CcEEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      +|.+.| ++++..+..  .......++.|.|.++..+      |+|.|+|.|.|..|...+
T Consensus        12 ~p~v~W-~k~~~~~~~--~~~~~~~~~~L~I~~v~~~------D~G~Y~C~a~N~~G~~~~   63 (69)
T cd05725          12 VPTVLW-RKEDGELPK--GRAEILDDKSLKIRNVTAG------DEGSYTCEAENMVGKIEA   63 (69)
T ss_pred             CCEEEE-EECCccCCC--CcEEEeeCCEEEECcCChh------HCEEEEEEEEcCCCcEEE
Confidence            478999 777766542  1122335668999999766      999999999999998764


No 45 
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin. Ig4_Peroxidasin: the fourth immunoglobulin (Ig)-like domain in peroxidasin. Peroxidasin has a peroxidase domain and interacting extracellular motifs containing four Ig-like domains. It has been suggested that peroxidasin is secreted, and has functions related to the stabilization of the extracellular matrix. It may play a part in various other important processes such as removal and destruction of cells, which have undergone programmed cell death, and protection of the organism against non-self.
Probab=99.30  E-value=2.5e-11  Score=62.85  Aligned_cols=52  Identities=17%  Similarity=0.247  Sum_probs=40.9

Q ss_pred             CcEEEEEccCCeeeeccccceE-EeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRI-ALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~-~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      .|.|+| +++|.++...  .++ ...++.|.|.++..+      |+|.|+|.|.|..|...+
T Consensus        12 ~p~i~W-~k~g~~~~~~--~~~~~~~~~~L~I~~~~~~------D~G~Y~C~a~N~~G~~~~   64 (69)
T cd05746          12 EPTITW-NKDGVQVTES--GKFHISPEGYLAIRDVGVA------DQGRYECVARNTIGYASV   64 (69)
T ss_pred             CCEEEE-EECCEECCCC--CCEEECCCCEEEECcCChh------hCEEEEEEEECCCCcEEE
Confidence            489999 8899887632  233 334678999999766      999999999999998764


No 46 
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins. Ig4_Contactin-2-like: fourth Ig domain of the neural cell adhesion molecule contactin-2. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (aliases TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. The first four Ig domains form the intermolecular binding fragment which arranges as a compact U-shaped module by contacts between Ig domains 1 and 4, and domains 2 and 3. It has been proposed that a linear zipper-like array forms, from contactin-2 molecules alternatively provided by the two apposed membranes.
Probab=99.28  E-value=2.9e-11  Score=65.07  Aligned_cols=52  Identities=25%  Similarity=0.503  Sum_probs=42.6

Q ss_pred             CcEEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      .|.++| +++|.++..  ..++...++.|.|.++..+      |+|.|+|.|.|..|...+
T Consensus        28 ~p~v~W-~k~g~~~~~--~~~~~~~~~~L~i~~~~~~------D~G~Y~C~a~N~~G~~~~   79 (85)
T cd05728          28 RPAYRW-LKNGQPLAS--ENRIEVEAGDLRITKLSLS------DSGMYQCVAENKHGTIYA   79 (85)
T ss_pred             CCEEEE-EECCEECCC--CCeEEEeCCEEEEeeCCHH------HCEEEEEEEECCCCeEEE
Confidence            488999 899998763  2345566789999999766      999999999999998764


No 47 
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Ig1_FGFR: The first immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for all FGFs.
Probab=99.28  E-value=2.5e-11  Score=64.49  Aligned_cols=50  Identities=16%  Similarity=0.301  Sum_probs=40.3

Q ss_pred             cEEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceE
Q psy11568          2 YVLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVIL   60 (116)
Q Consensus         2 p~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~   60 (116)
                      |.|.| ++||.++..  +.+....++.|.|.++..+      |+|.|+|.|.|..|...
T Consensus        23 ~~v~W-~k~g~~l~~--~~~~~~~~~~L~I~~~~~~------DsG~Y~C~a~n~~g~~~   72 (79)
T cd04973          23 QSINW-TKDGVQLGE--NNRTRITGEEVQIKDAVPR------DSGLYACVTSSPSGSDT   72 (79)
T ss_pred             ceEEE-eeCCcCCCC--CceEEEeCCEEEECCCChh------hCEEEEEEEeCCCCccc
Confidence            67999 899998864  2344555678999999766      99999999999988755


No 48 
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha. IG4_PDGFR-alpha: The fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha. PDGF is a potent mitogen for connective tissue cells. PDGF-stimulated processes are mediated by three different PDGFs (PDGF-A,-B, and C). PDGFR alpha binds to all three PDGFs, whereas the PDGFR beta (not included in this group) binds only to PDGF-B. PDGF alpha is organized as an extracellular component having five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. In mice, PDGFR alpha and PDGFR beta are essential for normal development.
Probab=99.28  E-value=2.5e-11  Score=67.41  Aligned_cols=59  Identities=19%  Similarity=0.141  Sum_probs=42.3

Q ss_pred             CcEEEEEccCCeeeeccccceEE--------eeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE-EEEEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIA--------LSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS-RFVHV   66 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~--------~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~-~~~~v   66 (116)
                      +|.+.| ++||+++.........        .....|.|.++..+      |+|.|+|.|.|..|.... ..|.|
T Consensus        32 ~P~v~W-~kdg~~l~~~~~~~~~~~~~~~~~~~~s~L~I~~v~~~------D~G~Ytc~A~N~~g~~~~t~~l~V   99 (101)
T cd05859          32 PPQIRW-LKDNRTLIENLTEITTSEHNVQETRYVSKLKLIRAKEE------DSGLYTALAQNEDAVKSYTFALQI   99 (101)
T ss_pred             CCceEE-EECCEECcCCcceEEeccccccceeeccEEEEeeCCHH------HCEEEEEEEEcCCceEEEEEEEEE
Confidence            488999 9999998742221111        11247999999766      999999999999988763 54444


No 49 
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C). Ig_C5_MyBP_C : the C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C). MyBP_C consists of repeated domains, Ig and fibronectin type 3, and various linkers. Three isoforms of MYBP_C exist and are included in this group: cardiac(c), and fast and slow skeletal muscle (s) MyBP_C. cMYBP_C has insertions between and inside domains and an additional cardiac-specific Ig domain at the N-terminus. For cMYBP_C  an interaction has been demonstrated between this C5 domain and the Ig C8 domain.
Probab=99.27  E-value=6.6e-11  Score=63.87  Aligned_cols=54  Identities=15%  Similarity=0.222  Sum_probs=40.8

Q ss_pred             CcEEEEEccCCeeeeccc-cceEEee--CCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          1 MYVLLWLIRDNTVIAYVK-DLRIALS--NGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~-~~~~~~~--~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      +|.|+| +++|+++.... +......  .+.|.|.++.++      |+|.|+|.|.|..|....
T Consensus        24 ~P~v~W-~k~~~~i~~~~~r~~~~~~~~~~~L~I~~~~~~------D~G~Y~c~a~N~~G~~~~   80 (86)
T cd05894          24 APTVTW-SRGDKAFTETEGRVRVESYKDLSSFVIEGAERE------DEGVYTITVTNPVGEDHA   80 (86)
T ss_pred             CCeEEE-EECCEECccCCCeEEEEEcCCeEEEEECCCccC------cCEEEEEEEEeCCCcEEE
Confidence            489999 99999886432 2222222  237999999766      999999999999998764


No 50 
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). Ig3_NCAM-1_like: domain similar to the third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-non-NCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1,and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the
Probab=99.27  E-value=6.1e-11  Score=65.04  Aligned_cols=59  Identities=17%  Similarity=0.272  Sum_probs=43.1

Q ss_pred             CcEEEEEccCCeeeeccccceEEe--eCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE-EEEEEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIAL--SNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS-RFVHVK   67 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~~--~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~-~~~~v~   67 (116)
                      .|.|+| +++|..+... ..++..  .++.|.|.++..+      |+|.|+|.|.|..|.... ..|.|.
T Consensus        32 ~p~v~W-~k~g~~~~~~-~~~~~~~~~~~~L~I~~v~~~------D~G~Y~C~a~N~~G~~~~~~~L~V~   93 (95)
T cd05730          32 EPTMTW-TKDGEPIESG-EEKYSFNEDGSEMTILDVDKL------DEAEYTCIAENKAGEQEAEIHLKVF   93 (95)
T ss_pred             CCEEEE-EECCEECcCC-CCEEEEeCCCCEEEECCCChh------hCEEEEEEEEcCCCeEEEEEEEEEE
Confidence            488999 8999887643 122322  2347999999766      999999999999998764 555543


No 51 
>cd04967 Ig1_Contactin First Ig domain of contactin. Ig1_Contactin: First Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 weeks postnata
Probab=99.27  E-value=3.9e-11  Score=65.35  Aligned_cols=56  Identities=30%  Similarity=0.436  Sum_probs=43.1

Q ss_pred             CcEEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILSR   62 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~~   62 (116)
                      +|.++| +++|.++......+....++.|.|.++..     ..|+|.|+|.|.|..|.+.+.
T Consensus        33 ~p~i~W-~k~~~~l~~~~~~~~~~~~~~L~i~~~~~-----~~d~G~Y~C~a~N~~G~~~S~   88 (91)
T cd04967          33 PPTYRW-LMNGTEIDDEPDSRYSLVGGNLVISNPSK-----AKDAGRYQCLASNIVGTVLSR   88 (91)
T ss_pred             CCEEEE-EECCEECCCCCCCCEEEECCEEEEecCCc-----cCCCEEEEEEEEcCCCEEEec
Confidence            479999 89999885433445566678899988753     139999999999999987764


No 52 
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM). Ig8_DSCAM:  the eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM). DSCAM is a cell adhesion molecule expressed largely in the developing nervous system. The gene encoding DSCAM is located at human chromosome 21q22, the locus associated with the mental retardation phenotype of Down Syndrome. DSCAM is predicted to be the largest member of the IG superfamily. It has been demonstrated that DSCAM can mediate cation-independent homophilic intercellular adhesion.
Probab=99.26  E-value=8.2e-11  Score=63.77  Aligned_cols=60  Identities=20%  Similarity=0.306  Sum_probs=43.1

Q ss_pred             CcEEEEEccCCeeeeccccceEEee-----C---CeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE-EEEEEEe
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIALS-----N---GSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS-RFVHVKA   68 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~~~-----~---~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~-~~~~v~~   68 (116)
                      +|.++| ++++..+.... .++...     .   ..|.|.++..+      |+|.|+|.|.|..|...+ ..|.|..
T Consensus        15 ~~~i~W-~k~~~~i~~~~-~r~~~~~~~~~~~~~s~L~I~~~~~~------D~G~YtC~A~N~~G~~~~~~~L~V~~   83 (88)
T cd05735          15 PIIVRW-EKEDRIINPEM-SRYLVSTKEVGDEVISTLQILPTVRE------DSGFFSCHAINSYGEDRGIIQLTVQE   83 (88)
T ss_pred             CCEEEE-eeCCEECCCCC-CcEEEEEecCCCcEEEEEEECCCCcc------cCEEEEEEEEcCCCcceEEEEEEEeC
Confidence            378999 99998875322 122211     1   36999999666      999999999999998875 5566654


No 53 
>cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1). Ig2_VEGFR-1: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1). VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-1 binds VEGF-A strongly; VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-1 may play an inhibitory rolet in the function of VEGFR-2 by binding VEGF-A and interfering with its interaction with VEGFR-2. VEGFR-1 has a signaling role in mediating monocyte chemotaxis and may mediate a chemotactic and a survival signal in hematopoietic stem cells or leukemia cells.
Probab=99.25  E-value=5.8e-11  Score=61.93  Aligned_cols=49  Identities=16%  Similarity=0.184  Sum_probs=38.6

Q ss_pred             CcEEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCC
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAG   57 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g   57 (116)
                      +|.++| +++|.++... ..++...+.+|.|.++..+      |+|.|+|.|.|...
T Consensus        12 ~P~v~W-~kdg~~l~~~-~~~~~~~~~~L~I~~v~~~------D~G~YtC~a~~~~~   60 (72)
T cd07702          12 APEVIW-LKDGLPAAEK-CSRYHVDGYSLVIKDVTEE------DAGIYTILLGIKQY   60 (72)
T ss_pred             CCeEEE-EECCEECCCC-CcEEEeCCCEEEECcCCHH------HCEEEEEEEEcccc
Confidence            489999 9999987642 2344555668999999766      99999999999843


No 54 
>KOG4222|consensus
Probab=99.25  E-value=2e-11  Score=88.94  Aligned_cols=96  Identities=23%  Similarity=0.385  Sum_probs=78.0

Q ss_pred             CcEEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceE-EEEEEEEeCcEeeeeccCC
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVIL-SRFVHVKAGSVVSLLDIQG   79 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~-~~~~~v~~~~~~~~~~~~~   79 (116)
                      +|.|.| .+++..+.. .+..+.....+|.|.++...      |+|.|.|.+.|..|... +..++|.++          
T Consensus       254 ~P~Vrw-kk~~~~~P~-~ry~i~~d~qtl~i~r~tp~------deg~y~C~a~n~vG~l~asa~ltV~ap----------  315 (1281)
T KOG4222|consen  254 QPTVRW-KKDDPSLPR-SRYSILDDTQTLRIDRVTPT------DEGTYVCPAENLVGGLEASATLTVQAP----------  315 (1281)
T ss_pred             CCceee-eccCCCCCc-cceeeeeccccccccccCCC------cccceeeeccccccccccccceEEecC----------
Confidence            488999 777665542 23344555578999999665      99999999999998877 477888876          


Q ss_pred             CceEecCCCeEEEeCCCcEEEEeeecCcCCceeEEe
Q psy11568         80 PLFRIEPPYRFEFSNESGGRLDCAAQGSPTPKIEWL  115 (116)
Q Consensus        80 p~~~~~~~~~~~~~~g~~~~l~C~~~g~P~p~i~W~  115 (116)
                      |.|..++ .+..+..|..+.|.|.+.|+|.|.+.|.
T Consensus       316 P~f~kkp-~dq~v~lg~~vt~pc~~~gnP~PavfW~  350 (1281)
T KOG4222|consen  316 PSFGKKP-RDQKVALGGTVTFPCETLGNPPPAVFWL  350 (1281)
T ss_pred             ccccccc-CccccccCceEEeeeecCCCCCcceEEe
Confidence            8888887 7777788999999999999999999996


No 55 
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. Ig2_FGFR: second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. FGF receptors bind FGF signaling polypeptides. FGFs participate in multiple processes such as morphogenesis, development, and angiogenesis. FGFs bind to four FGF receptor tyrosine kinases (FGFR1, -2, -3, -4). Receptor diversity is controlled by alternative splicing producing splice variants with different ligand binding characteristics and different expression patterns. FGFRs have an extracellular region comprised of three IG-like domains, a single transmembrane helix, and an intracellular tyrosine kinase domain. Ligand binding and specificity reside in the Ig-like domains 2 and 3, and the linker region that connects these two. FGFR activation and signaling depend on FGF-induced dimerization, a process involving cell surface heparin or heparin sulfate proteoglycans.
Probab=99.24  E-value=6.5e-11  Score=63.55  Aligned_cols=54  Identities=17%  Similarity=0.327  Sum_probs=39.8

Q ss_pred             CcEEEEEccCCeeeeccccc---eEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDL---RIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~---~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      +|.|+| +++|+++......   +.......|.|.++..+      |+|.|+|.+.|..|...+
T Consensus        23 ~p~i~W-~k~g~~l~~~~~~~~~~~~~~~~~l~i~~~~~~------D~G~Y~C~a~N~~G~~~~   79 (85)
T cd05857          23 TPTMRW-LKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPS------DKGNYTCVVENEYGSINH   79 (85)
T ss_pred             CCEEEE-EECCEECCCCCceeeeEEeCCceEEEEccCCcc------cCEEEEEEEEeCCCEEEE
Confidence            378999 8999988642221   11223347889999655      999999999999998774


No 56 
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2. Ig_Perlecan_D2_like: the immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2. Perlecan consists of five domains. Domain I has three putative heparan sulfate attachment sites; domain II has four LDL receptor-like repeats, and one Ig-like repeat; domain III resembles the short arm of laminin chains; domain IV has multiple Ig-like repeats (21 repeats in human perlecan); and domain V resembles the globular G domain of the laminin A chain and internal repeats of EGF. Perlecan may participate in a variety of biological functions including cell binding, LDL-metabolism, basement membrane assembly and selective permeability, calcium binding, and growth- and neurite-promoting activities.
Probab=99.24  E-value=8.2e-11  Score=62.32  Aligned_cols=54  Identities=19%  Similarity=0.371  Sum_probs=40.1

Q ss_pred             CcEEEEEccCCeeeeccccceEEeeC--CeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIALSN--GSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~~~~--~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      .|.|+| ++++.++....+......+  +.|.|.++..+      |+|.|+|.|.|..|...+
T Consensus        15 ~p~v~W-~~~~~~~~~~~~~~~~~~~~~~~L~I~~v~~~------D~G~Y~C~a~N~~G~~~~   70 (78)
T cd05743          15 TPIINW-RLNWGHVPDSARVSITSEGGYGTLTIRDVKES------DQGAYTCEAINTRGMVFG   70 (78)
T ss_pred             CCEEEE-EECCeECCCCCCEEEEECCCEEEEEECCCChH------HCEEEEEEEEecCCEEEe
Confidence            489999 8888777543222222222  37999999766      999999999999998875


No 57 
>cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig3_L1-CAM_like: domain similar to the third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM and human neurofascin.
Probab=99.24  E-value=5.7e-11  Score=61.62  Aligned_cols=57  Identities=23%  Similarity=0.256  Sum_probs=40.6

Q ss_pred             CcEEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE-EEEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS-RFVH   65 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~-~~~~   65 (116)
                      .|.++| ++++.++... .......++.|.|.++..+      |+|.|+|.|.|..|.... ..|.
T Consensus        12 ~p~v~W-~k~~~~~~~~-~~~~~~~~~~L~i~~v~~~------D~G~Y~C~a~N~~G~~~~~~~l~   69 (71)
T cd05731          12 TPEISW-IKIGGELPAD-RTKFENFNKTLKIDNVSEE------DDGEYRCTASNSLGSARHTISVT   69 (71)
T ss_pred             CCeEEE-EECCeECCCC-ceeEecCCCEEEECCCCHH------HCEEEEEEEEeCCceEEEEEEEE
Confidence            489999 7777766421 1122233458999999766      999999999999997664 4443


No 58 
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig6_Contactin-2: Sixth Ig domain of the neural cell adhesion molecule contactin-2-like. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. It may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module by contacts between IG domains 1 and 4, and domains 2 and 3. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-2 is also expressed in retinal amacrine cells in the developing c
Probab=99.23  E-value=8.3e-11  Score=63.35  Aligned_cols=59  Identities=19%  Similarity=0.260  Sum_probs=42.6

Q ss_pred             EEEEEccCCeeeeccc-cceE---E--eeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE-EEEEEEe
Q psy11568          3 VLLWLIRDNTVIAYVK-DLRI---A--LSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS-RFVHVKA   68 (116)
Q Consensus         3 ~v~W~~~~g~~~~~~~-~~~~---~--~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~-~~~~v~~   68 (116)
                      .++| ++||.++.... ..++   .  ...+.|.|.++...      |+|.|+|.|.|..|...+ ..|.|..
T Consensus        18 ~v~W-~~~g~~i~~~~~~~~~~~~~~~~~~~~L~I~~v~~~------D~G~YtC~A~n~~g~~~~~~~L~V~~   83 (85)
T cd05854          18 TFTW-SLDDFPIDLDKPNGHYRRMEVKETIGDLVIVNAQLS------HAGTYTCTAQTVVDSASASATLVVRG   83 (85)
T ss_pred             EEEE-EECCeEccccCCCCcEEEEEecceEeEEEEccCChh------hCeEEEEEEecCCCCEEEEEEEEEEC
Confidence            6899 88998885421 1111   1  13458999999766      999999999999998875 5565553


No 59 
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain. IgC_Tapasin_R: Immunoglobulin-like domain on Tapasin-R. Tapasin is a V-C1 (variable-constant) immunoglobulin superfamily molecule present in the endoplasmic reticulum (ER), where it links MHC class I molecules to the transporter associated with antigen processing (TAP). Tapasin-R is a tapasin-related protein that contains similar structural motifs to Tapasin, with some marked differences, especially in the V domain, transmembrane and cytoplasmic regions. The majority of Tapasin-R is located within the ER; however, there may be some expression of Tapasin-R at the cell surface. Tapasin-R lacks an obvious ER retention signal.
Probab=99.23  E-value=1.9e-10  Score=67.29  Aligned_cols=71  Identities=23%  Similarity=0.334  Sum_probs=52.1

Q ss_pred             eEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE-EEEEEEeCcEeeeeccCCCceEecCCCeEEEeCCCcEEEEeeecC
Q psy11568         28 SLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS-RFVHVKAGSVVSLLDIQGPLFRIEPPYRFEFSNESGGRLDCAAQG  106 (116)
Q Consensus        28 ~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~-~~~~v~~~~~~~~~~~~~p~~~~~~~~~~~~~~g~~~~l~C~~~g  106 (116)
                      .|.|.++..+      |+|.|.|.+.+..|.... ..|.|..+          |.+...+ .......|+.+.|.|.+.|
T Consensus         2 sL~i~~v~~~------D~G~Y~C~~~~~~~~~~~~~~l~v~~~----------P~v~~~~-~~~~~~~~~~~~L~C~a~g   64 (139)
T cd05771           2 SLTLPGLTVH------DEGTYICSVSTPPHQAQQIIQLSVSEP----------PRVRLSL-EKLVSMIEEPQTLICHIAG   64 (139)
T ss_pred             eEEECCCCHH------HCEEEEEEEEccCcceeeEEEEEEecC----------CceEEeC-CCceeecCCcEEEEEEECC
Confidence            5789999766      999999999988776553 55666554          6665554 3334446899999999999


Q ss_pred             c-CC-ceeEEe
Q psy11568        107 S-PT-PKIEWL  115 (116)
Q Consensus       107 ~-P~-p~i~W~  115 (116)
                      . |. +.++|+
T Consensus        65 ~~P~~~~i~W~   75 (139)
T cd05771          65 YYPLDVQVEWT   75 (139)
T ss_pred             CCCCCeEEEEE
Confidence            6 54 488996


No 60 
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2. Ig1_NCAM-2:  first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 (OCAM/mamFas II, RNCAM). NCAM-2  is organized similarly to NCAM , including five N-terminal Ig-like domains and two fibronectin type III domains. NCAM-2 is differentially expressed in the developing and mature olfactory epithelium (OE), and may function like NCAM, as an adhesion molecule.
Probab=99.23  E-value=1.7e-10  Score=62.96  Aligned_cols=56  Identities=18%  Similarity=0.293  Sum_probs=39.5

Q ss_pred             cEEEEEccCCeeeeccccceEEeeCC---eEEecCCCCCCCCCCCCceEEEEEEEcCCCceEEEEE
Q psy11568          2 YVLLWLIRDNTVIAYVKDLRIALSNG---SLMFPPFPETGFRPDVHSTVYRCRASNEAGVILSRFV   64 (116)
Q Consensus         2 p~v~W~~~~g~~~~~~~~~~~~~~~~---~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~~~~   64 (116)
                      +.++|++.+|.++....+... ..++   .|.|.++..+      |+|.|+|.|.|..|.....++
T Consensus        29 ~~v~W~k~~g~~~~~~~r~~~-~~~g~~~~L~I~~v~~~------D~G~Y~C~A~N~~G~~~~~~i   87 (92)
T cd05866          29 ESIDWYNPQGEKIVSSQRVVV-QKEGVRSRLTIYNANIE------DAGIYRCQATDAKGQTQEATV   87 (92)
T ss_pred             CeEEEEeCCCeEecCCCCEEE-EeCCCeeEEEEecCChH------HCEEEEEEEEcCCCcEEEEEE
Confidence            368995457877754322222 2233   7999999766      999999999999998765443


No 61 
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. Ig1_NCAM-1: first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. NCAM-1 plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-nonNCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves the Ig1, Ig2, and Ig3 domains. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the surface of opposing cells (trans
Probab=99.22  E-value=1.5e-10  Score=63.69  Aligned_cols=52  Identities=19%  Similarity=0.317  Sum_probs=36.3

Q ss_pred             cEEEEEccCCeeeeccccceEE--ee---CCeEEecCCCCCCCCCCCCceEEEEEEEcCC-CceE
Q psy11568          2 YVLLWLIRDNTVIAYVKDLRIA--LS---NGSLMFPPFPETGFRPDVHSTVYRCRASNEA-GVIL   60 (116)
Q Consensus         2 p~v~W~~~~g~~~~~~~~~~~~--~~---~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~-g~~~   60 (116)
                      |.|+|++.||..+..... ++.  ..   .++|.|.++..+      |+|.|+|.|.|.. |...
T Consensus        31 p~i~W~~~~g~~l~~~~~-r~~v~~~~~~~~~L~I~~v~~~------D~G~YtC~A~N~~~g~~~   88 (96)
T cd05865          31 KDISWFSPNGEKLTPNQQ-RISVVRNDDYSSTLTIYNANID------DAGIYKCVVSNEDEGESE   88 (96)
T ss_pred             CEEEEECCCCcCccccCC-eEEEEeCCCCceEEEEeccChh------hCEEEEEEEEcCCCCcEE
Confidence            699994448877653221 222  12   147999999766      9999999999997 5555


No 62 
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin. Ig6_Contactin_like: Sixth Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=99.22  E-value=1e-10  Score=62.87  Aligned_cols=59  Identities=25%  Similarity=0.371  Sum_probs=42.3

Q ss_pred             EEEEEccCCeeeecccc-c---eE--EeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE-EEEEEEe
Q psy11568          3 VLLWLIRDNTVIAYVKD-L---RI--ALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS-RFVHVKA   68 (116)
Q Consensus         3 ~v~W~~~~g~~~~~~~~-~---~~--~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~-~~~~v~~   68 (116)
                      .++| +++|.++..... .   +.  ...++.|.|.++...      |+|.|+|.|.|..|...+ ..|.|..
T Consensus        18 ~~~W-~~~g~~i~~~~~~~~~~~~~~~~~~~~L~I~~v~~~------D~G~Y~C~a~n~~g~~~~~~~l~V~~   83 (85)
T cd04970          18 TFTW-SFNGVPIDFDKDGGHYRRVGGKDSNGDLMIRNAQLK------HAGKYTCTAQTVVDSLSASADLIVRG   83 (85)
T ss_pred             EEEE-EECCeEeeccCCCccEEEEecccccceEEEccCCHH------hCeeeEEEEecCCCcEEEEEEEEEEC
Confidence            5689 889998864211 1   11  124568999999766      999999999999988764 5555554


No 63 
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins. Ig2_Follistatin_like: domain similar to the second immunoglobulin (Ig)-like domain found in a follistatin-like molecule encoded by the CNS-related Mahya gene. Mahya genes have been retained in certain Bilaterian branches during evolution.  They are conserved in Hymenoptera and Deuterostomes, but are absent from other metazoan species such as fruit fly and nematode. Mahya proteins are secretory, with a follistatin-like domain (Kazal-type serine/threonine protease inhibitor domain and EF-hand calcium-binding domain), two Ig-like domains, and a novel C-terminal domain. Mahya may be involved in learning and memory and in processing of sensory information in Hymenoptera and vertebrates. Follistatin is a secreted, multidomain protein that binds activins with high affinity and antagonizes their signaling.
Probab=99.21  E-value=2.3e-10  Score=60.18  Aligned_cols=59  Identities=24%  Similarity=0.363  Sum_probs=42.7

Q ss_pred             CcEEEEEccCCeeeeccccceEE-eeC-CeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE-EEEEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIA-LSN-GSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS-RFVHV   66 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~-~~~-~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~-~~~~v   66 (116)
                      +|.+.| +++++.+......+.. ..+ ..|.|.++..+      |+|.|+|.+.|..|.... ..|.|
T Consensus        12 ~p~v~W-~k~~~~l~~~~~~~~~~~~~~~~l~I~~~~~~------D~G~Y~C~a~N~~G~~~~~~~l~V   73 (76)
T cd05736          12 LPRLTW-LKNGMDITPKLSKQLTLIANGSELHISNVRYE------DTGAYTCIAKNEAGVDEDISSLFV   73 (76)
T ss_pred             CCEEEE-EECCEECCCCCCccEEEeCCCCEEEECcCCcc------cCEEEEEEEEcCCCCcceEEEEEE
Confidence            478999 8999887643222322 233 36999999665      999999999999998774 44544


No 64 
>cd04968 Ig3_Contactin_like Third Ig domain of contactin. Ig3_Contactin_like: Third Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=99.20  E-value=1.7e-10  Score=62.42  Aligned_cols=52  Identities=19%  Similarity=0.319  Sum_probs=39.5

Q ss_pred             CcEEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      .|.++| ++++..+..  .......++.|.|.++..+      |+|.|.|.|.|..|...+
T Consensus        30 ~p~v~W-~k~~~~~~~--~~~~~~~~~~L~i~~v~~~------D~G~Y~C~a~N~~G~~~~   81 (88)
T cd04968          30 VPQIKW-RKVDGSMPS--SAEISMSGAVLKIPNIQFE------DEGTYECEAENIKGKDTH   81 (88)
T ss_pred             CCEEEE-EECCCcCCC--ccEEEEeCCEEEECCCCcc------cCEEEEEEEEECCCcEEE
Confidence            378999 777665542  2223356679999999766      999999999999998764


No 65 
>cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily. Ig_2: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=99.19  E-value=1.9e-10  Score=60.17  Aligned_cols=54  Identities=22%  Similarity=0.337  Sum_probs=39.8

Q ss_pred             CcEEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      .|.+.|++.++..+.... ......++.|.|.++..+      |+|.|+|.|.|..|...+
T Consensus        15 ~p~v~W~~~~~~~~~~~~-~~~~~~~~~L~i~~~~~~------D~G~Y~C~a~N~~G~~~~   68 (74)
T cd05764          15 EPAIHWISPDGKLISNSS-RTLVYDNGTLDILITTVK------DTGSFTCIASNAAGEATA   68 (74)
T ss_pred             CCEEEEEeCCCEEecCCC-eEEEecCCEEEEEECChh------hCEEEEEEEECCCCeEEE
Confidence            479999545777665322 123345678999999665      999999999999997664


No 66 
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. Ig3_RPTP_IIa_LAR_like: domain similar to the third immunoglobulin (Ig)-like domain found in the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. LAR belongs to the RPTP type IIa subfamily. Members of this subfamily are cell adhesion molecule-like proteins involved in central nervous system (CNS) development. They have large extracellular portions, comprised of multiple IG-like domains and two to nine fibronectin type III (FNIII) domains, and a cytoplasmic portion having two tandem phosphatase domains. Included in this group is Drosophila LAR (DLAR).
Probab=99.18  E-value=2e-10  Score=59.50  Aligned_cols=50  Identities=18%  Similarity=0.324  Sum_probs=37.6

Q ss_pred             CcEEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      .|.|+| +++|+++...  .+.......|.|.++.        |+|.|+|.|.|..|...+
T Consensus        15 ~P~v~W-~k~g~~l~~~--~~~~~~~~~L~i~~~~--------d~G~Y~C~A~N~~G~~~~   64 (69)
T cd05739          15 MPYVKW-MKGGEELTKE--DEMPVGRNVLELTNIY--------ESANYTCVAISSLGMIEA   64 (69)
T ss_pred             CCEEEE-EECCEECCCc--cceecCccEEEEeccc--------cCeeEEEEEEeCCCEEEE
Confidence            489999 8888887532  2233344578888873        899999999999998764


No 67 
>PF07679 I-set:  Immunoglobulin I-set domain;  InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents I-set domains, which are found in several cell adhesion molecules, including vascular (VCAM), intercellular (ICAM), neural (NCAM) and mucosal addressin (MADCAM) cell adhesion molecules, as well as junction adhesion molecules (JAM). I-set domains are also present in several other diverse protein families, including several tyrosine-protein kinase receptors, the hemolymph protein hemolin, the muscle proteins titin, telokin, and twitchin, the neuronal adhesion molecule axonin-1 [], and the signalling molecule semaphorin 4D that is involved in axonal guidance, immune function and angiogenesis [].; PDB: 3MTR_A 2EDK_A 3DMK_B 1KOA_A 3NCM_A 2NCM_A 2V9Q_A 2CR3_A 3QQN_A 3QR2_A ....
Probab=99.17  E-value=3.8e-10  Score=61.05  Aligned_cols=58  Identities=19%  Similarity=0.331  Sum_probs=44.2

Q ss_pred             CcEEEEEccCCeeeeccccceEEeeCC--eEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE-EEEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIALSNG--SLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS-RFVH   65 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~~~~~--~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~-~~~~   65 (116)
                      .|.+.| +++|..+....+.......+  .|.|.++..+      |+|.|+|.+.|..|.... ..|.
T Consensus        29 ~~~v~W-~~~~~~l~~~~~~~~~~~~~~~~L~I~~v~~~------D~G~Y~C~~~n~~g~~~~~~~l~   89 (90)
T PF07679_consen   29 PPTVTW-YKNGRPLTSSQRYQIESDGGSSSLTIKNVTRE------DAGTYTCVASNSSGEATASVNLT   89 (90)
T ss_dssp             SSEEEE-EETTEEEESSSSEEEEEETTEEEEEESSESGG------GSEEEEEEEEETTEEEEEEEEEE
T ss_pred             CCcccc-cccccceeeeeeeeeecccceeEEccCCCChh------hCEEEEEEEEECCCEEEEEEEEE
Confidence            378999 88999998644544444433  7999999766      999999999999887764 4443


No 68 
>cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig4_Robo: domain similar to the fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antagoni
Probab=99.17  E-value=2.9e-10  Score=61.81  Aligned_cols=61  Identities=20%  Similarity=0.422  Sum_probs=43.0

Q ss_pred             CcEEEEEccCCeeeec------cccceEEe-eCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE-EEEEEEe
Q psy11568          1 MYVLLWLIRDNTVIAY------VKDLRIAL-SNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS-RFVHVKA   68 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~------~~~~~~~~-~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~-~~~~v~~   68 (116)
                      .|.|.| +++|..+..      ....++.. .++.|.|.++..+      |+|.|.|.|.|..|...+ ..|.|..
T Consensus        15 ~p~v~W-~k~g~~~~~~~~~~~~~~~r~~v~~~~~L~I~~v~~~------D~G~Y~C~a~N~~G~~~~~~~l~V~~   83 (90)
T cd05726          15 QPAIFW-QKEGSQNLLFSYQPPQSSSRFSVSQTGDLTITNVQRS------DVGYYICQTLNVAGSILTKAYLEVTD   83 (90)
T ss_pred             CCEEEE-EeCCCcceeecccCCCCCCeEEECCCCeEEEeeCChh------hCEEEEEEEEcCCCceEEEEEEEEee
Confidence            378999 667654311      11234433 3568999999766      999999999999998875 5566653


No 69 
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins. Ig1_NCAM-1 like: first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. NCAM-1 plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-nonNCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves the Ig1, Ig2, and Ig3 domains. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the s
Probab=99.17  E-value=4e-10  Score=61.51  Aligned_cols=55  Identities=11%  Similarity=0.270  Sum_probs=37.5

Q ss_pred             CcEEEEEccCCeeeeccccceEEeeC---CeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIALSN---GSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~~~~---~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      +|.++|++.+|..+....+......+   ..|.|.++..+      |+|.|+|.|.|..|....
T Consensus        28 p~~i~W~~~~~~~~~~~~~~~~~~~~~~~~~L~I~~v~~~------D~G~Y~C~A~N~~g~~~~   85 (92)
T cd04977          28 PKDISWFSPNGEKLVTQQQISVVQNDDVRSTLTIYNANIE------DAGIYKCVATDAKGTESE   85 (92)
T ss_pred             CCeEEEECCCCCEeccCCCEEEEeCCCCEEEEEEecCCcc------cCEEEEEEEEcCCCCcce
Confidence            46899954577766542222222222   27999999766      999999999999765443


No 70 
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1). Ig2_FGFRL1-like: second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1). FGFRL1 is comprised of a signal peptide, three extracellular Ig-like modules, a transmembrane segment, and a short intracellular domain. FGFRL1 is expressed preferentially in skeletal tissues. Similar to FGF receptors, the expressed protein interacts specifically with heparin and with FGF2.  FGFRL1 does not have a protein tyrosine kinase domain at its C terminus; neither does its cytoplasmic domain appear to interact with a signaling partner. It has been suggested that FGFRL1 may not have any direct signaling function, but instead acts as a decoy receptor trapping FGFs and preventing them from binding other receptors.
Probab=99.16  E-value=9.8e-11  Score=62.30  Aligned_cols=54  Identities=22%  Similarity=0.292  Sum_probs=38.6

Q ss_pred             CcEEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      .|.++| +++|..+..............|.|.++..+      |+|.|+|.+.|..|....
T Consensus        23 ~p~i~W-~k~~~~~~~~~~~~~~~~~~~L~i~~v~~~------D~G~Y~C~a~N~~G~~~~   76 (82)
T cd05856          23 RPDITW-LKDNKPLTPTEIGESRKKKWTLSLKNLKPE------DSGKYTCHVSNRAGEINA   76 (82)
T ss_pred             CCcEEE-EECCcCCcCCccceecCceEEEEEccCChh------hCEEEEEEEEcCCccEEE
Confidence            378999 888887753221111122347999999766      999999999999997663


No 71 
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins. Ig1_Neogenin: first immunoglobulin (Ig)-like domain in neogenin and related proteins. Neogenin  is a cell surface protein which is expressed in the developing nervous system of vertebrate embryos in the growing nerve cells. It is also expressed in other embryonic tissues, and may play a general role in developmental processes such as cell migration, cell-cell recognition, and tissue growth regulation. Included in this group is the tumor suppressor protein DCC, which is deleted in colorectal carcinoma . DCC and neogenin each have four Ig-like domains followed by six fibronectin type III domains, a transmembrane domain, and an intracellular domain.
Probab=99.16  E-value=3.9e-10  Score=61.83  Aligned_cols=63  Identities=29%  Similarity=0.478  Sum_probs=43.0

Q ss_pred             CcEEEEEccCCeeeeccccc-eEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcC-CCceEEEEEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDL-RIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNE-AGVILSRFVH   65 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~-~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~-~g~~~~~~~~   65 (116)
                      .|.++| ++||..+...... .....++.+.|.++..... .+.|+|.|.|.|.|. .|...+..+.
T Consensus        28 ~p~i~W-~k~g~~l~~~~~~~~~~~~~~~l~i~~v~~~~~-~~~D~G~Y~C~a~N~~~G~~~s~~~~   92 (95)
T cd05722          28 PPKIEW-KKDGVLLNLVSDERRQQLPNGSLLITSVVHSKH-NKPDEGFYQCVAQNDSLGSIVSRTAR   92 (95)
T ss_pred             CCEEEE-EECCeECccccCcceEEccCCeEEEeeeeccCC-CCCcCEEEEEEEECCccCcEEEeeeE
Confidence            489999 8999988643322 2344566787777632100 134999999999999 9988765433


No 72 
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2). Ig_M-protein_C: the C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2). M-protein is a structural protein localized to the M-band, a transverse structure in the center of the sarcomere, and is a candidate for M-band bridges. M-protein is modular consisting mainly of repetitive IG-like and fibronectin type III (FnIII) domains, and has a muscle-type specific expression pattern. M-protein is present in fast fibers.
Probab=99.16  E-value=3.3e-10  Score=61.86  Aligned_cols=54  Identities=19%  Similarity=0.293  Sum_probs=39.4

Q ss_pred             CcEEEEEccCCeeeeccccceEEeeCC---eEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIALSNG---SLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~~~~~---~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      .|.+.| +++|..+....+.......+   .|.|.++..+      |+|.|+|.|.|.+|....
T Consensus        30 ~p~i~W-~k~~~~~~~~~~~~~~~~~~~~~~L~I~~~~~~------D~G~Y~C~a~N~~G~~~~   86 (92)
T cd05891          30 DPEVIW-FKNDQDIELSEHYSVKLEQGKYASLTIKGVTSE------DSGKYSINVKNKYGGETV   86 (92)
T ss_pred             CCeEEE-EECCEECCCCCCEEEEEcCCCEEEEEECCCChh------hCEEEEEEEEeCCCceee
Confidence            478999 78888775433322222222   6899999655      999999999999998774


No 73 
>cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins. Ig2_IL1R_like: domain similar to the second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R).  IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three IG-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta. This group also contains ILIR-like 1 (IL1
Probab=99.15  E-value=4.2e-10  Score=61.43  Aligned_cols=51  Identities=12%  Similarity=0.254  Sum_probs=39.8

Q ss_pred             CcEEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVIL   60 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~   60 (116)
                      .|.|.| ++||+++....  +....++.|.|.++..+      |+|.|+|.+.|..+...
T Consensus        29 ~p~i~W-yk~~~~i~~~~--~~~~~~~~L~I~~v~~~------DsG~YtC~~~n~~~~~~   79 (92)
T cd05757          29 LPPVQW-YKDCKLLEGDR--KRFVKGSKLLIQNVTEE------DAGNYTCKLTFTHNGKQ   79 (92)
T ss_pred             CCcEEE-eECCEECCCCc--cEEecCCEEEEeeCChh------hCEEEEEEEEecCCCEE
Confidence            378999 99999886422  22236679999999766      99999999999976654


No 74 
>cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM). Ig7_DSCAM: the seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM). DSCAM is a cell adhesion molecule expressed largely in the developing nervous system. The gene encoding DSCAM is located at human chromosome 21q22, the locus associated with the mental retardation phenotype of Down Syndrome. DSCAM is predicted to be the largest member of the IG superfamily. It has been demonstrated that DSCAM can mediate cation-independent homophilic intercellular adhesion.
Probab=99.14  E-value=6.8e-10  Score=58.88  Aligned_cols=57  Identities=30%  Similarity=0.355  Sum_probs=38.1

Q ss_pred             CcEEEEEccCCeeeecc-----ccceE-EeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEEEE
Q psy11568          1 MYVLLWLIRDNTVIAYV-----KDLRI-ALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILSRF   63 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~-----~~~~~-~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~~~   63 (116)
                      .|.|+|++.++......     ...+. ...++.|.|.++..+      |+|.|.|.|.|..|...+..
T Consensus        12 ~P~v~W~~~~~~~~~~~~~~~~~~~r~~~~~~~~L~I~~v~~~------D~G~Y~C~a~N~~G~~~s~~   74 (79)
T cd05734          12 PPTIVWKHSKGRGHPQHTHTCCLAGRIQLLSNGSLLIKHVLEE------DSGYYLCKVSNDVGADASKS   74 (79)
T ss_pred             CCEEEEEECCCccccccccccccCCCEEEecCCeEEECcCCcc------cCEEEEEEEEeCCCCCCceE
Confidence            48999944344322110     11222 245678999999765      99999999999999876543


No 75 
>cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins. Ig1_IL1R_like: domain similar to the first immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R). IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three Ig-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta.
Probab=99.14  E-value=2.8e-10  Score=62.43  Aligned_cols=53  Identities=19%  Similarity=0.297  Sum_probs=39.9

Q ss_pred             cEEEEEccCCeeeec--cccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          2 YVLLWLIRDNTVIAY--VKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         2 p~v~W~~~~g~~~~~--~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      |.|+| +++|..+..  ..+.+....++.|.|.++..+      |+|.|+|.+.|..|...+
T Consensus        34 ~~v~W-yk~~~~~~~~~~~~~r~~~~~~~L~I~~~~~~------DsG~Y~C~~~N~~g~~~~   88 (94)
T cd05756          34 LNLTW-YKSDGKTPIPTEERSRMHQQKDLLWFLPAALE------DSGLYTCVVRNSTYCMKV   88 (94)
T ss_pred             ceEEE-EEcCCCCcccccccceeeecCCeEEEccCCcc------cCeEEEEEEcCCCccEEE
Confidence            68999 788766432  123344445678999999766      999999999999988764


No 76 
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC. TrkABC_d4: the fourth domain of Trk receptors TrkA, TrkB and TrkC, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors. They are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkA, TrkB, and TrkC share significant sequence homology and domain organization. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrkA, Band C mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. TrkA is recognized by NGF. TrKB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. TrkC is recognized by NT-3. NT-3 is promiscuous as in some cell systems it activates TrkA and TrkB receptors. TrkA is a receptor fo
Probab=99.13  E-value=6.8e-10  Score=60.31  Aligned_cols=54  Identities=15%  Similarity=0.233  Sum_probs=39.3

Q ss_pred             CcEEEEEccCCeeeeccccceEE--eeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIA--LSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~--~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      .|.|+| +++|..+.........  .....|.|.++..+      |.|.|.|.|.|..|...+
T Consensus        29 ~p~v~W-~~~g~~~~~~~~~~~~~~~~~~~L~I~~v~~~------D~g~Y~C~A~N~~G~~~~   84 (90)
T cd04972          29 LPKVEW-IIAGLIVIQTRTDTLETTVDIYNLQLSNITSE------TQTTVTCTAENPVGQANV   84 (90)
T ss_pred             CCeEEE-EECCEEccCCccEEEEecCCEEEEEEecCCcc------cCEEEEEEEECCCCceeE
Confidence            489999 8898877532211111  12237999999766      999999999999998774


No 77 
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins. Ig5_Titin_like: domain similar to the M5, fifth immunoglobulin (Ig)-like domain from the human titin C terminus. Titin (also called connectin) is a fibrous sarcomeric protein specifically found in vertebrate striated muscle. Titin is gigantic; depending on isoform composition it ranges from 2970 to 3700 kDa, and is of a length that spans half a sarcomere. Titin largely consists of multiple repeats of Ig-like and fibronectin type 3 (FN-III)-like domains. Titin connects the ends of myosin thick filaments to Z disks and extends along the thick filament to the H zone, and appears to function similar to an elastic band, keeping the myosin filaments centered in the sarcomere during muscle contraction or stretching.
Probab=99.12  E-value=7.7e-10  Score=60.33  Aligned_cols=54  Identities=13%  Similarity=0.259  Sum_probs=39.6

Q ss_pred             CcEEEEEccCCeeeeccccceEEee--CCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIALS--NGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~~~--~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      .|.+.| +++|..+....+......  .+.|.|.++..+      |+|.|.|.|.|..|....
T Consensus        32 ~p~v~W-~k~g~~l~~~~~~~~~~~~~~~~L~i~~~~~~------D~G~Y~C~a~N~~G~~~~   87 (92)
T cd05747          32 APTVTW-MREGQIIVSSQRHQITSTEYKSTFEISKVQMS------DEGNYTVVVENSEGKQEA   87 (92)
T ss_pred             CCEEEE-EECCEECCCCCcEEEEEcCCeeEEEECCCCcc------cCEeEEEEEEcCCCCEeE
Confidence            378999 888888754322222222  247999999665      999999999999998764


No 78 
>cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs). Ig_Pro_neuregulin: immunoglobulin (Ig)-like domain in neuregulins (NRGs). NRGs are signaling molecules, which participate in cell-cell interactions in the nervous system, breast, heart, and other organ systems, and are implicated in the pathology of diseases including schizophrenia, multiple sclerosis, and breast cancer. There are four members of the neuregulin gene family (NRG1, -2, -3, and -4). The NRG-1 protein, binds to and activates the tyrosine kinases receptors ErbB3 and ErbB4, initiating signaling cascades. The other NRGs proteins bind one or the other or both of these ErbBs. NRG-1 has multiple functions; for example, in the brain it regulates various processes such as radial glia formation and neuronal migration, dendritic development, and expression of neurotransmitters receptors; in the peripheral nervous system NRG-1 regulates processes such as target cell differentiation, and Schwann cell surv
Probab=99.11  E-value=6e-10  Score=58.33  Aligned_cols=54  Identities=20%  Similarity=0.236  Sum_probs=39.4

Q ss_pred             CcEEEEEccCCeeeeccccce---EEe--eCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLR---IAL--SNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~---~~~--~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      .|.+.| +++|+++.......   ...  ....|.|.++..+      |+|.|+|.|.|..|....
T Consensus        13 ~p~~~W-~k~g~~l~~~~~~~~~~~~~~~~~~~L~I~~~~~~------D~G~Y~C~a~N~~G~~~~   71 (75)
T cd05750          13 SLRFKW-FKDGKELNRKNKPRNIKIRNKKKNSELQINKAKLA------DSGEYTCVVENILGNDTV   71 (75)
T ss_pred             CceEEE-EcCCeeccccCCcceEEEEecCceEEEEEccCCcc------cCeEEEEEEEEcCCceeE
Confidence            378999 88999886432221   111  1347999999766      999999999999987653


No 79 
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). Ig5_NCAM-1: The fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM) and heterophilic (NCAM-non-NCAM) interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the surface of opposing cells (tr
Probab=99.07  E-value=1.4e-09  Score=59.93  Aligned_cols=54  Identities=24%  Similarity=0.274  Sum_probs=38.4

Q ss_pred             CcEEEEEccCCeeeeccc---cceEEee----CCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          1 MYVLLWLIRDNTVIAYVK---DLRIALS----NGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~---~~~~~~~----~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      .|.|+| ++++..+....   ..++...    .+.|.|.++..+      |+|.|+|.|.|..|....
T Consensus        31 ~P~v~W-~~~~~~~~~~~~~~~~~~~v~~~~~~~~L~I~~v~~~------D~G~Y~C~A~N~~G~~~~   91 (97)
T cd05869          31 IPSITW-RTSTRNISSEEKTLDGHIVVRSHARVSSLTLKYIQYT------DAGEYLCTASNTIGQDSQ   91 (97)
T ss_pred             CCEEEE-EECCccccCCccccCccEEEEcCccEEEEEEecCccC------cCEEEEEEEecCCCCeeE
Confidence            489999 77887764311   1122221    137999999766      999999999999998764


No 80 
>cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Ig3_FGFR: third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for FGFs.
Probab=99.07  E-value=8.8e-10  Score=59.91  Aligned_cols=33  Identities=18%  Similarity=0.260  Sum_probs=27.0

Q ss_pred             CeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE-EEEE
Q psy11568         27 GSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS-RFVH   65 (116)
Q Consensus        27 ~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~-~~~~   65 (116)
                      +.|.|.++..+      |+|.|+|.|.|..|...+ ..|.
T Consensus        55 ~~L~I~~v~~~------D~G~Y~C~A~N~~G~~~~sa~L~   88 (90)
T cd04974          55 EVLYLRNVSFD------DAGEYTCLAGNSIGPSHHSAWLT   88 (90)
T ss_pred             ceEEEeccccc------cCcEEEEEeecccCcccCCEEEE
Confidence            47999999766      999999999999998764 4443


No 81 
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs). Ig2_Tyro3_like: the second immunoglobulin (Ig)-like domain in the Axl/Tyro3 family of receptor tyrosine kinases (RTKs). This family includes Axl (also known as Ark, Ufo, and Tyro7), Tyro3 (also known as Sky, Rse, Brt, Dtk, and Tif), and Mer (also known as Nyk, c-Eyk, and Tyro12). Axl/Tyro3 family receptors have an extracellular portion with two Ig-like domains followed by two fibronectin-types III (FNIII) domains, a membrane-spanning single helix, and a cytoplasmic tyrosine kinase domain. Axl, Tyro3 and Mer are widely expressed in adult tissues, though they show higher expression in the brain, in the lymphatic and vascular systems, and in the testis. Axl, Tyro3, and Mer bind the vitamin K dependent protein Gas6 with high affinity, and in doing so activate their tyrosine kinase activity. Axl/Gas6 signaling may play a part in cell adhesion processes, prevention of apoptosis, and c
Probab=99.06  E-value=8.5e-10  Score=58.85  Aligned_cols=50  Identities=26%  Similarity=0.377  Sum_probs=37.7

Q ss_pred             c-EEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEEEEE
Q psy11568          2 Y-VLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILSRFV   64 (116)
Q Consensus         2 p-~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~~~~   64 (116)
                      | .|+| ++||.++..    +.....+.|.|..+.        |+|.|.|.|.|..|...+...
T Consensus        28 P~~I~W-~k~g~~l~~----~~~~~~s~L~i~~~~--------d~g~Y~C~A~N~~G~~~s~~a   78 (81)
T cd05749          28 PVEILW-WQGGSPLGD----PPAPSPSVLNVPGLN--------ETSKFSCEAHNAKGVTTSRTG   78 (81)
T ss_pred             CeEEEE-EECCEECCC----CCCCCCCEEEEcccc--------CCeEEEEEEEeccCcEEeeeE
Confidence            7 6999 999998753    111234578888773        889999999999998876443


No 82 
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins. Ig1_Robo: domain similar to the first immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit res
Probab=99.06  E-value=1.5e-09  Score=59.63  Aligned_cols=59  Identities=25%  Similarity=0.437  Sum_probs=36.1

Q ss_pred             CcEEEEEccCCeeeecc----ccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          1 MYVLLWLIRDNTVIAYV----KDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~----~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      .|.|+| +++|+.+...    ...+....++.+.+..+.... ....|+|.|+|.|.|..|...+
T Consensus        30 ~p~i~W-~k~g~~l~~~~~~~~~~~~~~~~~~~~~~~i~~~~-~~~~D~G~Y~C~a~N~~G~~~s   92 (100)
T cd07693          30 TPTIQW-LKNGQPLETDKDDPRSHRIVLPSGSLFFLRVVHGR-KGRSDEGVYVCVAHNSLGEAVS   92 (100)
T ss_pred             CCEEEE-EECCEECccccCCCCcceEEecCCcEEEEEeeccC-CCcCcCEEEEEEEEccccceec
Confidence            378999 8999988641    112233445544332221000 0134999999999999998665


No 83 
>cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D. Ig_Sema4D_like; Immunoglobulin (Ig)-like domain of Sema4D. Sema4D is a Class IV semaphorin. Semaphorins are classified based on structural features additional to the Sema domain. Sema4D has extracellular Sema and Ig domains, a transmembrane domain, and a short cytoplasmic domain. Sema4D plays a part in the development of GABAergic synapses. Sema4D in addition is an immune semaphorin. It is abundant on resting T cells; its expression is weak on resting B cells and antigen presenting cells (APCs), but is upregulated by various stimuli. The receptor used by Sema4D in the immune system is CD72. Sem4D enhances the activation of B cells and DCs through binding CD72, perhaps by reducing CD72s inhibitory signals. The receptor used by Sema4D in the non-lymphatic tissues is plexin-B1. Sem4D is anchored to the cell surface but its extracellular domain can be released from the cell surface by a metalloproteas
Probab=99.05  E-value=6.7e-10  Score=59.96  Aligned_cols=47  Identities=17%  Similarity=0.311  Sum_probs=38.9

Q ss_pred             cEEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCC
Q psy11568          2 YVLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEA   56 (116)
Q Consensus         2 p~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~   56 (116)
                      |+|+| ++||.++.... .++...++.|.|.++..+      |+|.|+|.+.+..
T Consensus        25 ~~i~W-~~ng~~i~~~~-~r~~~~~~~L~I~nv~~~------DsG~Y~C~a~e~~   71 (87)
T cd05873          25 ARVVW-KFDGKVLTPES-AKYLLYRDGLLIFNASEA------DAGRYQCLSVEKS   71 (87)
T ss_pred             CeEEE-EECCEECCCCC-ceEEEECCcEEEeCCCHH------HCEEEEEEEEecc
Confidence            68999 99999986432 356677889999999766      9999999999874


No 84 
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin. Ig8_hNephrin_like: domain similar to the eighth immunoglobulin-like domain in human nephrin. Nephrin is an integral component of the slit diaphragm, and is a central component of the glomerular ultrafilter. Nephrin plays a structural role, and has a role in signaling. Nephrin is a transmembrane protein having a short intracellular portion, and an extracellular portion comprised of eight Ig-like domains, and one fibronectin type III-like domain. The extracellular portions of nephrin, from neighboring foot processes of separate podocyte cells, may interact with each other, and in association with other components of the slit diaphragm, form a porous molecular sieve within the slit pore.  The intracellular portion of nephrin is associated with linker proteins, which connect nephrin to the actin cytoskeleton. The intracellular portion is tyrosine phosphorylated, and mediates signaling from the slit diaphragm into the p
Probab=99.05  E-value=2.5e-09  Score=60.18  Aligned_cols=60  Identities=12%  Similarity=0.145  Sum_probs=41.3

Q ss_pred             CcEEEEEccCCeeeeccccceEE---ee-----CCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE-EEEEEE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIA---LS-----NGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS-RFVHVK   67 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~---~~-----~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~-~~~~v~   67 (116)
                      .|.++| ++||..+.... .++.   ..     .+.|.|.++..     ..|.|.|+|.|.|..|.... ..|.+.
T Consensus        37 ~p~i~W-~k~g~~l~~~~-~r~~~~~~~~~~~~~s~L~I~~v~~-----~~D~G~Y~C~A~N~~G~~~~~i~L~~~  105 (109)
T cd05773          37 RVQFRW-AKNGVPLDLGN-PRYEETTEHTGTVHTSILTIINVSA-----ALDYALFTCTAHNSLGEDSLDIQLVST  105 (109)
T ss_pred             CCEEEE-EECCEECCCCC-CeEEEEeeccCccceeEEEECcCCc-----cCCCEEEEEEEEeCCccCcEEEEEEec
Confidence            378999 88999885321 1221   11     24689998863     13999999999999998764 445444


No 85 
>cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2). Ig3_FGFR-2-like; domain similar to the third immunoglobulin (Ig)-like domain of human fibroblast growth factor receptor 2 (FGFR2). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for FGFs. FGFR2 is required for male sex determination.
Probab=99.03  E-value=1.6e-09  Score=58.87  Aligned_cols=29  Identities=21%  Similarity=0.296  Sum_probs=25.4

Q ss_pred             CeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568         27 GSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus        27 ~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      +.|.|.++..+      |+|.|+|.|.|..|...+
T Consensus        55 ~~L~I~~v~~~------D~G~Y~C~A~N~~G~~~~   83 (90)
T cd05858          55 EVLYLRNVTFE------DAGEYTCLAGNSIGISHH   83 (90)
T ss_pred             eEEEEccCCHH------HCEEEEEEEEeCCCcccc
Confidence            36999999766      999999999999998764


No 86 
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1. Ig_Pro_neuregulin-1: immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1. There are many NRG-1 isoforms which arise from the alternative splicing of mRNA. NRG-1 belongs to the neuregulin gene family, which is comprised of four genes. This group represents NRG-1. NRGs are signaling molecules, which participate in cell-cell interactions in the nervous system, breast, and heart, and other organ systems, and are implicated in the pathology of diseases including schizophrenia, multiple sclerosis, and breast cancer. The NRG-1 protein binds to and activates the tyrosine kinases receptors ErbB3 and ErbB4, initiating signaling cascades. NRG-1 has multiple functions; for example, in the brain it regulates various processes such as radial glia formation and neuronal migration, dendritic development, and expression of neurotransmitters receptors; in the peripheral nervous system NRG-1 regulates process
Probab=99.00  E-value=1.4e-09  Score=57.19  Aligned_cols=53  Identities=17%  Similarity=0.303  Sum_probs=38.1

Q ss_pred             cEEEEEccCCeeeecc--ccceEEe----eCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          2 YVLLWLIRDNTVIAYV--KDLRIAL----SNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         2 p~v~W~~~~g~~~~~~--~~~~~~~----~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      |.++| +++|+++...  .+.++..    ..+.|.|.++..+      |+|.|+|.+.|..|...+
T Consensus        14 ~~~~W-~~~g~~i~~~~~~~~~~~~~~~~~~~~L~I~~~~~~------DsG~Y~C~a~N~~g~~~~   72 (76)
T cd05895          14 LRFKW-FKNGKEIGAKNKPDNKIKIRKKKKSSELQISKASLA------DNGEYKCMVSSKLGNDSV   72 (76)
T ss_pred             CceEE-EECCcccccCCCCCceEEEEeCCcEEEEEECcCCcc------cCEEEEEEEEeCCCceeE
Confidence            67899 8899888532  1222221    1246999999765      999999999999987653


No 87 
>cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2). Ig2_IL1R2_like: domain similar to the second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2). IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds the type II (IL1R2) represented in this group. Mature IL1R2 consists of three IG-like domains, a transmembrane domain, and a short cytoplasmic domain. It lacks the large cytoplasmic domain of Mature IL1R1, and does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta.
Probab=98.97  E-value=2.4e-09  Score=58.66  Aligned_cols=50  Identities=14%  Similarity=0.174  Sum_probs=37.6

Q ss_pred             cEEEEEccCCeeeeccccceEEe--eCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCce
Q psy11568          2 YVLLWLIRDNTVIAYVKDLRIAL--SNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVI   59 (116)
Q Consensus         2 p~v~W~~~~g~~~~~~~~~~~~~--~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~   59 (116)
                      |.|+| +||++++...+ .+...  ..+.|.|.++..+      |+|.|+|.+.+.+|..
T Consensus        30 ~~v~W-YKd~~~l~~~~-~~~~~~~~~~~L~I~~v~~~------D~G~YtC~~~~~~~g~   81 (95)
T cd05897          30 VELQW-YKDSVLLDKDN-EKFYSLKGSTYLHIIDVSLN------DSGYYTCKLQFTHEGK   81 (95)
T ss_pred             CcEEE-ccCCEECcCCC-cceEecCCCCEEEEEEcChh------hCEEEEEEEEEeeCCE
Confidence            68999 99999886422 22222  2357999999766      9999999999997544


No 88 
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins. Ig5_NCAM-1 like: domain similar to the fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic  (NCAM-NCAM), and heterophilic (NCAM-non-NCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM mole
Probab=98.97  E-value=5.1e-09  Score=57.36  Aligned_cols=54  Identities=26%  Similarity=0.302  Sum_probs=37.7

Q ss_pred             CcEEEEEccCCeeeeccc---cceEEee----CCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          1 MYVLLWLIRDNTVIAYVK---DLRIALS----NGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~---~~~~~~~----~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      .|.|+| ++++..+....   ..++...    .+.|.|.++..+      |+|.|.|.|.|..|....
T Consensus        30 ~p~v~W-~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~I~~v~~~------D~G~Y~C~a~N~~G~~~~   90 (96)
T cd05732          30 IPEITW-RRATRNFSEGDKSLDGRIVVRGHARVSSLTLKDVQLT------DAGRYDCEASNRIGGDQQ   90 (96)
T ss_pred             CCcEEE-EECCcccCCCCccccceEEEeCCccEEEEEECcCCcC------cCEEeEEEEEeCCCCcEE
Confidence            378999 77776654311   1122221    237999999766      999999999999998763


No 89 
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM). Ig5_NCAM-2: the fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM). NCAM-2  is organized similarly to NCAM , including five N-terminal Ig-like domains and two fibronectin type III domains. NCAM-2 is differentially expressed in the developing and mature olfactory epithelium (OE), and may function like NCAM, as an adhesion molecule.
Probab=98.95  E-value=6.2e-09  Score=57.39  Aligned_cols=55  Identities=22%  Similarity=0.280  Sum_probs=36.8

Q ss_pred             CcEEEEEcc-CCeeeecc---ccceEEee----CCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          1 MYVLLWLIR-DNTVIAYV---KDLRIALS----NGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         1 ~p~v~W~~~-~g~~~~~~---~~~~~~~~----~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      .|.|+|++. +|..+...   .+.++...    ...|.|.++..+      |+|.|+|.|.|..|....
T Consensus        30 ~p~i~W~k~~~g~~~~~~~~~~~~r~~v~~~~~~~~L~I~~v~~~------D~G~Y~C~A~N~~G~~~~   92 (98)
T cd05870          30 IPEITWKRASDGHTFSEGDKSPDGRIEVKGQHGESSLHIKDVKLS------DSGRYDCEAASRIGGHQK   92 (98)
T ss_pred             CCeEEEEECCCCceeccCCcCcCceEEEeecCCeeEEEEeeCCcC------CCEEEEEEEeccCCccee
Confidence            378999433 45444321   11233222    247999999766      999999999999997764


No 90 
>cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily. Ig_3: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=98.93  E-value=7.1e-09  Score=54.98  Aligned_cols=30  Identities=23%  Similarity=0.462  Sum_probs=26.0

Q ss_pred             CCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568         26 NGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus        26 ~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      .+.|.|.++..+      |+|.|.|.|.|..|...+
T Consensus        46 ~~~L~I~~~~~~------D~G~Y~C~a~N~~G~~~~   75 (81)
T cd05765          46 IGQLVIYNAQPQ------DAGLYTCTARNSGGLLRA   75 (81)
T ss_pred             ccEEEEccCCcc------cCEEEEEEEecCCceEEE
Confidence            458999999766      999999999999998764


No 91 
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins. Ig5_KIRREL3-like: domain similar to the fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1), Kirrel2 (Neph3), and Drosophila RST (irregular chiasm C-roughest) protein. These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development.
Probab=98.91  E-value=8.7e-09  Score=56.82  Aligned_cols=54  Identities=19%  Similarity=0.263  Sum_probs=38.4

Q ss_pred             c-EEEEEccCCeeeeccccceEEee-C-------CeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          2 Y-VLLWLIRDNTVIAYVKDLRIALS-N-------GSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         2 p-~v~W~~~~g~~~~~~~~~~~~~~-~-------~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      | .|.| ++++..+......++... .       +.|.|.++..+     .|.|.|.|.|.|..|...+
T Consensus        31 P~~v~W-~~~~~~i~~~~~~r~~i~~~~~~~~~~s~L~I~~v~~~-----d~~G~Y~C~A~N~~G~~~~   93 (98)
T cd05758          31 PDRIVW-TWKENELESGSSGRYTVETDPSPGGVLSTLTISNTQES-----DFQTSYNCTAWNSFGSGTA   93 (98)
T ss_pred             CCEeEE-EECCEEccCCCCCCEEEEEecCCCceEEEEEECCcccc-----ccceeEEEEEEcCCCcccE
Confidence            5 5999 889988764322233221 1       26999999763     2699999999999998664


No 92 
>cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin. Ig_Semaphorin_C; Immunoglobulin (Ig)-like domain in semaphorins. Semaphorins are transmembrane protein that have important roles in a variety of tissues. Functionally, semaphorins were initially characterized for their importance in the development of the nervous system and in axonal guidance. Later they have been found to be important for the formation and functioning of the cardiovascular, endocrine, gastrointestinal, hepatic, immune, musculoskeletal, renal, reproductive, and respiratory systems. Semaphorins function through binding to their receptors and transmembrane semaphorins also serves as receptors themselves. Although molecular mechanism of semaphorins is poorly understood, the Ig-like domains may involve in ligand binding or dimerization.
Probab=98.89  E-value=1.5e-08  Score=54.84  Aligned_cols=52  Identities=12%  Similarity=0.309  Sum_probs=37.6

Q ss_pred             cEEEEEccCCeeeeccc--cceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceE
Q psy11568          2 YVLLWLIRDNTVIAYVK--DLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVIL   60 (116)
Q Consensus         2 p~v~W~~~~g~~~~~~~--~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~   60 (116)
                      |.+.| ++++..+....  ..+.....+.|.|.++..+      |+|.|.|.+.+..+...
T Consensus        25 ~~i~W-~k~~~~~~~~~~~~~~~~~~~~~L~I~~~~~~------D~G~Y~C~a~~~~~~~~   78 (89)
T cd04979          25 ASVVW-LFQGGPLQRKEEPEERLLVTEDGLLIRSVSPA------DAGVYTCQSVEHGFKQT   78 (89)
T ss_pred             ceEEE-EECCcccccccCcCceEEEcCCCEEEccCCHH------HCEEEEEEEecCcccee
Confidence            68999 88877665321  2344455567999999766      99999999998765444


No 93 
>cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins. Ig2_Contactin-2-like: second Ig domain of the neural cell adhesion molecule contactin-2. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (aliases TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. The first four Ig domains form the intermolecular binding fragment which arranges as a compact U-shaped module by contacts between Ig domains 1 and 4, and domains 2 and 3. It has been proposed that a linear zipper-like array forms, from contactin-2 molecules alternatively provided by the two apposed membranes.
Probab=98.86  E-value=5e-09  Score=57.47  Aligned_cols=52  Identities=15%  Similarity=0.220  Sum_probs=37.6

Q ss_pred             CcEEEEEccCCeeeec-cccceEEee-CCeEEecCCCCCCCCCCCCceEEEEEEEcCCCce
Q psy11568          1 MYVLLWLIRDNTVIAY-VKDLRIALS-NGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVI   59 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~-~~~~~~~~~-~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~   59 (116)
                      .|.+.| ++++.++.. ....+.... +|.|.|.++.++      |+|.|.|.|+|.....
T Consensus        33 ~p~~~W-~k~~~~~~~~~d~r~~~~~~~G~L~fs~v~~~------D~g~Y~C~A~n~~~~~   86 (96)
T cd05727          33 DLSYRW-LLNEFPNFIPEDGRRFVSQTNGNLYIAKVEAS------DRGNYSCFVSSPSSTK   86 (96)
T ss_pred             CCEEEE-EECCcccccccCCCeEEeCCCCcEEEeecCHh------hCceeEEEEEecccCC
Confidence            378999 888876532 122233443 689999999766      9999999999986433


No 94 
>smart00408 IGc2 Immunoglobulin C-2 Type.
Probab=98.79  E-value=3.6e-08  Score=49.07  Aligned_cols=47  Identities=26%  Similarity=0.477  Sum_probs=35.2

Q ss_pred             cEEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCC
Q psy11568          2 YVLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAG   57 (116)
Q Consensus         2 p~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g   57 (116)
                      +.+.| ++++..+.  ........+..|.|.++..+      |+|.|+|.+.|..|
T Consensus        17 ~~v~W-~~~~~~~~--~~~~~~~~~~~L~i~~~~~~------d~G~Y~C~~~n~~g   63 (63)
T smart00408       17 PNITW-LKDGKPLP--ESNRLSASGSTLTIKSVSLE------DSGEYTCVAENSAG   63 (63)
T ss_pred             CeEEE-EECCEECC--CCCEEecCCcEEEEeeCCcc------cCEEEEEEEecCCC
Confidence            67999 77887765  22233344568999999665      99999999999764


No 95 
>PHA02826 IL-1 receptor-like protein; Provisional
Probab=98.76  E-value=2.4e-08  Score=62.95  Aligned_cols=52  Identities=17%  Similarity=0.468  Sum_probs=38.1

Q ss_pred             cEEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCC-CceE
Q psy11568          2 YVLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEA-GVIL   60 (116)
Q Consensus         2 p~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~-g~~~   60 (116)
                      |+|+| ++||+++....+......++.|.|.++..+      |+|.|+|.++..+ |...
T Consensus       164 p~I~W-yKng~~l~~~~r~~~~~~~~~L~I~~V~~~------DsG~YtC~a~~~~~g~~y  216 (227)
T PHA02826        164 YTLTW-YKNGNIVLYTDRIQLRNNNSTLVIKSATHD------DSGIYTCNLRFNKNSNNY  216 (227)
T ss_pred             ceEEE-EECCEECCCCCCEEEeCCCCEEEECcCCHH------hCEEEEEEEEEeECCEEE
Confidence            78999 999999864332222223458999999766      9999999999975 4433


No 96 
>cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins. Ig1_VEGFR_like: first immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) related proteins. The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGF-A interacts with both VEGFR-1 and VEGFR-2. VEGFR-1 binds strongest to VEGF, VEGF-2 binds more weakly. VEGFR-3 appears not to bind VEGF, but binds other members of the VEGF family (VEGF-C and -D). VEGFRs bind VEGFs with high affinity with the IG-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGF
Probab=98.75  E-value=5e-08  Score=52.21  Aligned_cols=53  Identities=15%  Similarity=0.089  Sum_probs=35.2

Q ss_pred             cEEEEEccCCeeeecc-c-c-ceE----EeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          2 YVLLWLIRDNTVIAYV-K-D-LRI----ALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         2 p~v~W~~~~g~~~~~~-~-~-~~~----~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      |.+.| ..+++.+... . . .+.    ......|.|.++..+      |+|.|.|.|.|..|...+
T Consensus        18 ~~i~W-~~~~~~~~~~~~~~~~~~~~~~~~~~s~L~I~~v~~~------DsG~Y~C~a~n~~~~~~~   77 (84)
T cd05742          18 VDFQW-TYPGKKRGRGKSMVTRQSLSEATELSSTLTIPNATLK------DSGTYTCAASSGTMDQKE   77 (84)
T ss_pred             EEEEE-ecCCcccCCceEeecccccccceEEEEEEEECCCChh------hCEEEEEEEccCCCceEE
Confidence            67999 6666544321 0 0 001    112237999999766      999999999999987664


No 97 
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins. Ig2_FGFR_like: domain similar to the second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. FGF receptors bind FGF signaling polypeptides. FGFs participate in multiple processes such as morphogenesis, development, and angiogenesis. FGFs bind to four FGF receptor tyrosine kinases (FGFR1, -2, -3, -4). Receptor diversity is controlled by alternative splicing producing splice variants with different ligand binding characteristics and different expression patterns. FGFRs have an extracellular region comprised of three Ig-like domains, a single transmembrane helix, and an intracellular tyrosine kinase domain. Ligand binding and specificity reside in the Ig-like domains 2 and 3, and the linker region that connects these two. FGFR activation and signaling depend on FGF-induced dimerization, a process involving cell surface heparin or heparin 
Probab=98.73  E-value=1.2e-07  Score=50.42  Aligned_cols=53  Identities=17%  Similarity=0.301  Sum_probs=36.2

Q ss_pred             CcEEEEEccCCeeeeccccce-EE--eeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceE
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLR-IA--LSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVIL   60 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~-~~--~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~   60 (116)
                      .|.|.| ++++..+....... ..  .....|.|.++..+      |+|.|.|.+.|..|...
T Consensus        23 ~~~v~W-~k~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~------d~g~Y~C~~~n~~g~~~   78 (85)
T cd05729          23 RPTITW-LKDGKPFKKEHRIGGYKVRKKKWTLILESVVPS------DSGKYTCIVENKYGSIN   78 (85)
T ss_pred             CCeEEE-EECCEECcccCceeEEEccCcEEEEEEeECCcc------cCEEEEEEEEECCceEE
Confidence            367999 88888765321111 11  11226888888655      99999999999998755


No 98 
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins. Ig3_Perlecan_like: domain similar to the third immunoglobulin (Ig)-like domain found in Perlecan. Perlecan is a large multi-domain heparin sulfate proteoglycan, important in tissue development and organogenesis.  Perlecan can be represented as 5 major portions; its fourth major portion (domain IV) is a tandem repeat of immunoglobulin-like domains (Ig2-Ig15), which can vary in size due to alternative splicing. Perlecan binds many cellular and extracellular ligands. Its domain IV region has many binding sites.  Some of these have been mapped at the level of individual Ig-like domains, including a site restricted to the Ig5 domain for heparin/sulfatide, a site restricted to the Ig3 domain for nidogen-1 and nidogen-2, a site restricted to Ig4-5 for fibronectin, and sites restricted to Ig2 and to Ig13-15 for fibulin-2.
Probab=98.67  E-value=8.3e-08  Score=51.44  Aligned_cols=49  Identities=24%  Similarity=0.327  Sum_probs=36.8

Q ss_pred             cEEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          2 YVLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         2 p~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      |.+.| ++++..+..    +....++.|.|.++..+      |+|.|.|.|.|..|...+
T Consensus        32 ~~i~W-~~~~~~~~~----~~~~~~~~L~I~~v~~~------DsG~Y~C~a~n~~g~~~~   80 (85)
T cd05754          32 YTLVW-TRVGGGLPS----RAMDFNGILTIRNVQLS------DAGTYVCTGSNMLDTDEA   80 (85)
T ss_pred             cEEEE-EECCCcCCC----cccccCCEEEECCCCHH------HCEEEEEEEeccCCeEeE
Confidence            68999 677655432    12234568999999766      999999999999987765


No 99 
>cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1). Ig1_ IL1RAPL-1_like: domain similar to the first immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1).  IL-1 alpha and IL-1 beta are cytokines which participates in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three Ig-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of 
Probab=98.63  E-value=2.1e-07  Score=51.59  Aligned_cols=51  Identities=20%  Similarity=0.375  Sum_probs=37.4

Q ss_pred             EEEEEccCCeeeec-c----ccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceE
Q psy11568          3 VLLWLIRDNTVIAY-V----KDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVIL   60 (116)
Q Consensus         3 ~v~W~~~~g~~~~~-~----~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~   60 (116)
                      .|+| +|++..+.. .    .+.|....+..|.|.++..+      |+|.|.|.+.|.-....
T Consensus        42 ~v~W-yK~~~~~~~~~~~~~~~~Ri~~~~~~Lwf~Pa~~e------DSG~Y~C~~rN~t~C~~   97 (104)
T cd05896          42 SLMW-YKSSGDGEEPIEIIFDGVRMSKEEDSIWFRPAELQ------DSGLYTCVLRNSTYCMK   97 (104)
T ss_pred             eEEE-EECCCCCCCCCcccccceeEEEeCCEEEEEeCChh------hCeEEEEEECCCCcceE
Confidence            6899 778654432 1    12366677889999999766      99999999999864433


No 100
>cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs) and similar proteins. Ig2_FcgammaR_like: domain similar to the second immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs). Interactions between IgG and FcgammaR are important to the initiation of cellular and humoral response. IgG binding to FcgammaR leads to a cascade of signals and ultimately to functions such as antibody-dependent-cellular-cytotoxicity (ADCC), endocytosis, phagocytosis, release of inflammatory mediators, etc. FcgammaR has two Ig-like domains. This group also contains FcepsilonRI, which binds IgE with high affinity.
Probab=98.63  E-value=8.7e-08  Score=51.30  Aligned_cols=50  Identities=26%  Similarity=0.323  Sum_probs=36.8

Q ss_pred             cEEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEEEEE
Q psy11568          2 YVLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILSRFV   64 (116)
Q Consensus         2 p~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~~~~   64 (116)
                      +.+.| +++|..+..      ...+..|.|.+++.+      |+|.|.|.+.+..|...+..+
T Consensus        30 ~~~~w-~k~g~~~~~------~~~~~~l~I~~~~~~------dsG~Y~C~~~~~~~~~~s~~~   79 (83)
T cd05753          30 YKVTY-YRDGKAKKY------SHSNSNLSIPQATLS------DSGSYHCSGIIGSYDYSSEPV   79 (83)
T ss_pred             eEEEE-EECCeEccc------cCCCceEEECccCHH------HCEEEEEEEEeCCceecCCCE
Confidence            46889 788876531      112457999999766      999999999999986666433


No 101
>cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin. Ig_Semaphorin_class III; Immunoglobulin (Ig)-like domain of class III semaphorins. Semaphorins are classified into various classes on the basis of structural features additional to the Sema domain. Class III semaphorins are a vertebrate class having a Sema domain, an Ig domain, a short basic domain, and are secreted. They have been shown to be axonal guidance cues and have a part in the regulation of the cardiovascular, immune and respiratory systems. Sema3A, the prototype member of this class III subfamily, induces growth cone collapse and is an inhibitor of axonal sprouting. In perinatal rat cortex as a chemoattractant, it functions to direct, for pyramidal neurons, the orientated extension of apical dendrites. It may play a role, prior to the development of apical dendrites, in signaling the radial migration of newborn cortical neurons towards the upper layers. Sema3A selectively inhibits vascula
Probab=98.62  E-value=2.9e-07  Score=50.11  Aligned_cols=53  Identities=17%  Similarity=0.334  Sum_probs=34.0

Q ss_pred             cEEEEEcc-CCeeeec--cccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEc-CCCceE
Q psy11568          2 YVLLWLIR-DNTVIAY--VKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASN-EAGVIL   60 (116)
Q Consensus         2 p~v~W~~~-~g~~~~~--~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n-~~g~~~   60 (116)
                      |.|+|++. +|.....  ....+....++.|.|.++.++      |+|.|+|.+.+ ..+...
T Consensus        25 p~v~Wykq~~g~~~~~~~~~~~r~~~~~~~L~I~~~~~~------DsG~Y~C~a~~~~~~~~~   81 (91)
T cd05871          25 ASVKWLFQRGGDQRKEEVKTEERLIHTERGLLLRSLQRS------DAGVYTCTAVEHSFSQTL   81 (91)
T ss_pred             ceEEEEEECCCCCccccccccccEEEecCeEEEeeCChh------HCEEEEEEEEccCCeEEE
Confidence            78999432 3322211  112345556678999999766      99999999984 555333


No 102
>cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)). Ig1_Necl-1: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-1, Necl-1 (also known as celll adhesion molecule 3 (CADM3), SynCAM2, IGSF4). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue, and is important to the format
Probab=98.61  E-value=2.9e-07  Score=50.52  Aligned_cols=49  Identities=18%  Similarity=0.266  Sum_probs=32.0

Q ss_pred             CcEEEEEccCCeeeec------cccceEEee-----CCeEEecCCCCCCCCCCCCceEEEEEEEcCC
Q psy11568          1 MYVLLWLIRDNTVIAY------VKDLRIALS-----NGSLMFPPFPETGFRPDVHSTVYRCRASNEA   56 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~------~~~~~~~~~-----~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~   56 (116)
                      .|.|.| ++++..+..      ..+.|+...     +..|.|.++..+      |+|.|+|.+....
T Consensus        26 ~~~v~W-~k~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~L~I~nV~~~------D~G~YtC~~~t~~   85 (95)
T cd05882          26 NSSLQW-SNTAQQTLYFGEKRALRDNRIQLVKSTPTELIISISNVQLS------DEGEYTCSIFTMP   85 (95)
T ss_pred             CCeEEE-eccCccEEEeCCeEEEeCCeEEEEeCCCceEEEEECCCCcc------cCEEEEEEEEeec
Confidence            378999 666553311      112233221     247999999766      9999999999843


No 103
>cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins. Ig2_L1-CAM_like: domain similar to the second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains, five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth.
Probab=98.61  E-value=8.5e-08  Score=52.52  Aligned_cols=49  Identities=24%  Similarity=0.425  Sum_probs=35.3

Q ss_pred             CcEEEEEccCCeeeeccccceEEe-eCCeEEecCCCCCCCCCCCCce-EEEEEEEcCCC
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIAL-SNGSLMFPPFPETGFRPDVHST-VYRCRASNEAG   57 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~~-~~~~l~i~~v~~~~~~~~~d~G-~y~C~a~n~~g   57 (116)
                      .|.|.| ++++...... +.|+.. .+|.|.|+++..+      |+| .|.|.|.|...
T Consensus        33 ~P~i~W-~~~~~~~i~~-~~Ri~~~~~GnL~fs~v~~~------D~g~~Y~C~a~~~~~   83 (95)
T cd05845          33 PLRIYW-MNSDLLHITQ-DERVSMGQNGNLYFANVEEQ------DSHPDYICHAHFPGL   83 (95)
T ss_pred             CCEEEE-ECCCCccccc-cccEEECCCceEEEEEEehh------hCCCCeEEEEEcccc
Confidence            389999 5665443222 334443 5689999999766      999 89999999863


No 104
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig3_Contactin-1: Third Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=98.51  E-value=3.8e-07  Score=49.32  Aligned_cols=35  Identities=23%  Similarity=0.359  Sum_probs=31.5

Q ss_pred             CceEecCCCeEEEeCCCcEEEEeeecCcCCceeEEe
Q psy11568         80 PLFRIEPPYRFEFSNESGGRLDCAAQGSPTPKIEWL  115 (116)
Q Consensus        80 p~~~~~~~~~~~~~~g~~~~l~C~~~g~P~p~i~W~  115 (116)
                      |.+...+ .+..+.+|+.+.|.|.+.|.|.|.++|+
T Consensus         2 p~i~~~~-~~~~~~~G~~v~l~C~~~G~P~P~v~W~   36 (88)
T cd05851           2 ADINVKF-KDTYALKGQNVTLECFALGNPVPVIRWR   36 (88)
T ss_pred             CceEEcc-ccEEEeCCCcEEEEEEecccCCCEEEEE
Confidence            6777776 7788899999999999999999999997


No 105
>cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4  (Necl-4, also known as cell adhesion molecule 4 (CADM4)). Ig2_Necl-4: second immunoglobulin (Ig)-like domain of nectin-like molecule-4  (Necl-4, also known as cell adhesion molecule 4 (CADM4)). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1-Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. Ig domains are likely to participate in ligand binding and recognition. Necl-4 is expressed on Schwann cells, and plays a key part in initiating peripheral nervous system (PNS) myelination.  In injured peripheral nerve cells, the mRNA signal for both Necl-4 and Necl-5 was observed to be elevated.  Necl-4 participates in cell-cell adhesion and is proposed to play a role in tumor suppression.
Probab=98.51  E-value=2.9e-07  Score=48.84  Aligned_cols=52  Identities=23%  Similarity=0.325  Sum_probs=35.5

Q ss_pred             CcEEEEEccCCeeeeccc----cceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCce
Q psy11568          1 MYVLLWLIRDNTVIAYVK----DLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVI   59 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~----~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~   59 (116)
                      +|+|+| ++||+++....    ..+.....+.|.+...+.+      |.+.|+|.|.|..+..
T Consensus        14 ~a~i~W-~k~~~~l~~~~~~~~~~~~~t~~s~L~~~~~~~D------dg~~~~C~A~n~a~~~   69 (80)
T cd05885          14 AATLRW-YRDRKELKGVISQQENGKTVSVSNTIRFPVDRKD------DGAILSCEASHPALVS   69 (80)
T ss_pred             CCeEEE-EECCEECCCCcccccCCceEEEEEEEEEEeeecc------CCcEEEEEEEChhhCC
Confidence            478999 99999996422    1111112335777766544      9999999999997643


No 106
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs) and similar proteins. Ig1_FcgammaR_like: domain similar to the first immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs). Interactions between IgG and FcgammaR are important to the initiation of cellular and humoral response. IgG binding to FcgammaR leads to a cascade of signals and ultimately to functions such as antibody-dependent-cellular-cytotoxicity (ADCC), endocytosis, phagocytosis, release of inflammatory mediators, etc. FcgammaR has two Ig-like domains. This group also contains FcepsilonRI, which binds IgE with high affinity.
Probab=98.49  E-value=2.5e-07  Score=48.99  Aligned_cols=38  Identities=16%  Similarity=0.379  Sum_probs=30.3

Q ss_pred             cEEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcC
Q psy11568          2 YVLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNE   55 (116)
Q Consensus         2 p~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~   55 (116)
                      +.+.| ++||..+..        .++.|.|.++ .+      |+|.|+|.|.|.
T Consensus        31 ~~~~W-~kng~~l~~--------~~~~l~i~~~-~~------dsG~Y~C~a~~~   68 (78)
T cd05752          31 NSTQW-YHNGKLLET--------TTNSYRIRAA-NN------DSGEYRCQTQGS   68 (78)
T ss_pred             ccEEE-EECCEEeec--------cCCeEEEeec-cc------CCEEeEEECCCC
Confidence            35899 999987631        3557889888 66      999999999986


No 107
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b). Ig1_PDGFR-alphabeta: The first immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b). PDGF is a potent mitogen for connective tissue cells. PDGF-stimulated processes are mediated by three different PDGFs (PDGF-A,-B, and C). PDGFRalpha binds to all three PDGFs, whereas the PDGFRbeta binds only to PDGF-B. PDGFRs alpha and beta have similar organization: an extracellular component with five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. In mice, PDGFRalpha and PDGFRbeta are essential for normal development.
Probab=98.47  E-value=2.2e-06  Score=45.87  Aligned_cols=25  Identities=28%  Similarity=0.509  Sum_probs=21.6

Q ss_pred             CeEEecCCCCCCCCCCCCceEEEEEEEcCCC
Q psy11568         27 GSLMFPPFPETGFRPDVHSTVYRCRASNEAG   57 (116)
Q Consensus        27 ~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g   57 (116)
                      ..|.|.++..+      |+|.|.|.|.|..+
T Consensus        46 s~L~I~~~~~~------DsG~Y~C~a~n~~~   70 (84)
T cd05861          46 STLTFPHATVE------DSGTYECAAHESTQ   70 (84)
T ss_pred             EEEEECCCCcC------CCEEEEEEEEECcc
Confidence            37999999665      99999999999865


No 108
>PF00047 ig:  Immunoglobulin domain The Prosite family only concerns antibodies and MHCs.;  InterPro: IPR013151 Members of the immunoglobulin superfamily are found in hundreds of proteins of different functions. Examples include antibodies, the giant muscle kinase titin and receptor tyrosine kinases. Immunoglobulin-like domains may be involved in protein-protein and protein-ligand interactions. The Pfam alignments do not include the first and last strand of the immunoglobulin-like domain.; PDB: 1B6U_A 3O4O_C 3VH8_H 1BIH_A 2C9A_A 2V5Y_A 1BQH_K 2ATP_A 3B9K_A 1NEZ_H ....
Probab=98.44  E-value=4.6e-07  Score=45.78  Aligned_cols=43  Identities=14%  Similarity=0.237  Sum_probs=27.6

Q ss_pred             cEEEEEccCCeeeeccccceEEee-CCe----EEecCCCCCCCCCCCCceEEEEEE
Q psy11568          2 YVLLWLIRDNTVIAYVKDLRIALS-NGS----LMFPPFPETGFRPDVHSTVYRCRA   52 (116)
Q Consensus         2 p~v~W~~~~g~~~~~~~~~~~~~~-~~~----l~i~~v~~~~~~~~~d~G~y~C~a   52 (116)
                      +.++| .+++..+..... ..... +..    |.|.++..+      |+|.|+|.+
T Consensus        17 ~~~~W-~~~~~~~~~~~~-~~~~~~~~~~~~~L~i~~v~~~------d~G~Y~C~v   64 (64)
T PF00047_consen   17 TTVTW-SKNGQSLPEGST-TNRSTNSVSSTSRLTISNVTPE------DSGTYTCVV   64 (64)
T ss_dssp             SEEEE-EETTTTTSEEEE-EEEEETTTEEEEEEEESSCTGG------GTEEEEEEE
T ss_pred             cEEEE-EECCccccCcce-eEeecccceeeeEEEEccCCHH------HCEEEEEEC
Confidence            67899 666655432111 11222 222    999999766      999999986


No 109
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)). Ig1_Necl-3: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-3, Necl-3 (also known as cell adhesion molecule 2 (CADM2), SynCAM2, IGSF4D).  Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region, belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses.  Necl-3 accumulates in central and peripheral nervous system tissue, and has been shown to selectively interact with oligodendrocytes.
Probab=98.36  E-value=4.4e-06  Score=45.82  Aligned_cols=26  Identities=12%  Similarity=0.077  Sum_probs=21.5

Q ss_pred             CeEEecCCCCCCCCCCCCceEEEEEEEcCCCc
Q psy11568         27 GSLMFPPFPETGFRPDVHSTVYRCRASNEAGV   58 (116)
Q Consensus        27 ~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~   58 (116)
                      ..|.|.++..+      |+|.|.|.+.+..+.
T Consensus        62 ~sL~I~~v~~~------DsG~Y~C~~~t~~~~   87 (95)
T cd07701          62 LSISISDVSLS------DEGQYTCSLFTMPVK   87 (95)
T ss_pred             EEEEECcCCcc------cCEEEEEEeEeecCc
Confidence            37999999766      999999999986444


No 110
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins. Ig1_Robo: domain similar to the first immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit res
Probab=98.34  E-value=1.2e-06  Score=47.96  Aligned_cols=36  Identities=36%  Similarity=0.701  Sum_probs=32.0

Q ss_pred             CceEecCCCeEEEeCCCcEEEEeeecCcCCceeEEeC
Q psy11568         80 PLFRIEPPYRFEFSNESGGRLDCAAQGSPTPKIEWLI  116 (116)
Q Consensus        80 p~~~~~~~~~~~~~~g~~~~l~C~~~g~P~p~i~W~~  116 (116)
                      |.+...+ ....+.+|+.+.|.|.+.|.|.|.++|+.
T Consensus         2 P~i~~~p-~~~~v~~G~~~~l~C~~~g~P~p~i~W~k   37 (100)
T cd07693           2 PRIVEHP-SDLIVSKGDPATLNCKAEGRPTPTIQWLK   37 (100)
T ss_pred             CeEEecC-ceeEEcCCCeEEEEeeCCcCCCCEEEEEE
Confidence            6777776 78889999999999999999999999973


No 111
>cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B. Ig_Sema4B_like; Immunoglobulin (Ig)-like domain of Sema4B_like. Sema4B is a Class IV semaphorin. Semaphorins are classified based on structural features additional to the Sema domain. Sema4B has extracellular Sema and Ig domains, a transmembrane domain and a short cytoplasmic domain. Sema4B has been shown to preferentially regulate the development of the postsynaptic specialization at the glutamatergic synapses. This cytoplasmic domain includes a PDZ-binding motif upon which the synaptic localization of Sem4B is dependent. Sema4B is a ligand of CLCP1, CLCP1 was identified in an expression profiling analysis, which compared a highly metastic lung cancer subline with its low metastic parental line. Sema4B was shown to promote CLCP1 endocytosis, and their interaction is a potential target for therapeutic intervention of metastasis.
Probab=98.34  E-value=3.5e-06  Score=45.28  Aligned_cols=49  Identities=20%  Similarity=0.389  Sum_probs=36.1

Q ss_pred             cEEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceE
Q psy11568          2 YVLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVIL   60 (116)
Q Consensus         2 p~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~   60 (116)
                      +++.| +.+|.++..  +.+.......|.|.++..+      |+|.|.|.+. ..|...
T Consensus        25 A~v~W-~~ng~~l~~--~~r~~~~~~GLlI~~~~~~------dsG~Y~C~s~-E~gf~~   73 (85)
T cd05872          25 ASPVW-LFNGTPLNA--QFSYRVGTDGLLILVTSPE------HSGTYRCYSE-EEGFQQ   73 (85)
T ss_pred             ccEEE-EECCcccCC--CcceEEeCCCCEEEECCHh------hCEEEEEEEe-cCCCeE
Confidence            57899 999888753  3455656667889999655      9999999987 344444


No 112
>cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). Ig2_KIRREL3-like: domain similar to the second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1), Kirrel2 (Neph3), and Drosophila RST (irregular chiasm C-roughest) protein. These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development.
Probab=98.32  E-value=4.7e-06  Score=44.28  Aligned_cols=48  Identities=29%  Similarity=0.515  Sum_probs=29.8

Q ss_pred             cEEEEEccCCeeeeccccceEEeeCC-------eEEecCCCCCCCCCCCCceEEEEEEEcCC
Q psy11568          2 YVLLWLIRDNTVIAYVKDLRIALSNG-------SLMFPPFPETGFRPDVHSTVYRCRASNEA   56 (116)
Q Consensus         2 p~v~W~~~~g~~~~~~~~~~~~~~~~-------~l~i~~v~~~~~~~~~d~G~y~C~a~n~~   56 (116)
                      |.|+| +++|+++...........++       .|.+.....      .|.|.|+|.+.|..
T Consensus        15 ~~v~W-~~~g~~l~~~~~~~~~~~~~~~~~~~s~L~i~~~~~------~~~~~y~C~a~n~~   69 (82)
T cd05759          15 AEIIW-FRDGEVLDGATYSKELLKDGKRETTVSTLPITPSDH------DTGRTFTCRARNEA   69 (82)
T ss_pred             CEEEE-EECCEEccCceeeeeEecCCCeEEEEEEEEEeCcee------cCCCEEEEEEcCcc
Confidence            68999 88999875421111112222       355554433      37889999999975


No 113
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively). Ig1_Necl-1-3_like:  N-terminal immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 (also known as cell adhesion molecule 3 (CADM3)), Necl-2 (CADM1), and Necl-3 (CADM2). At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1, Necl-2, and Necl-3 have Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue, and is important to the form
Probab=98.30  E-value=8.2e-06  Score=44.55  Aligned_cols=25  Identities=12%  Similarity=0.143  Sum_probs=21.2

Q ss_pred             eEEecCCCCCCCCCCCCceEEEEEEEcCCCc
Q psy11568         28 SLMFPPFPETGFRPDVHSTVYRCRASNEAGV   58 (116)
Q Consensus        28 ~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~   58 (116)
                      .|.|.++..+      |+|.|.|.+.+....
T Consensus        63 ~L~I~~v~~~------DsG~Y~C~~~~~~~~   87 (95)
T cd05717          63 SISISNVSLS------DEGRYTCSLYTMPVQ   87 (95)
T ss_pred             EEEEccCCcc------cCEEEEEEEecCCCc
Confidence            6999999766      999999999987643


No 114
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs). Ig2_Tyro3_like: the second immunoglobulin (Ig)-like domain in the Axl/Tyro3 family of receptor tyrosine kinases (RTKs). This family includes Axl (also known as Ark, Ufo, and Tyro7), Tyro3 (also known as Sky, Rse, Brt, Dtk, and Tif), and Mer (also known as Nyk, c-Eyk, and Tyro12). Axl/Tyro3 family receptors have an extracellular portion with two Ig-like domains followed by two fibronectin-types III (FNIII) domains, a membrane-spanning single helix, and a cytoplasmic tyrosine kinase domain. Axl, Tyro3 and Mer are widely expressed in adult tissues, though they show higher expression in the brain, in the lymphatic and vascular systems, and in the testis. Axl, Tyro3, and Mer bind the vitamin K dependent protein Gas6 with high affinity, and in doing so activate their tyrosine kinase activity. Axl/Gas6 signaling may play a part in cell adhesion processes, prevention of apoptosis, and c
Probab=98.28  E-value=1.6e-06  Score=46.21  Aligned_cols=28  Identities=29%  Similarity=0.603  Sum_probs=26.1

Q ss_pred             CeEEEeCCCcEEEEeeecCcCCc-eeEEe
Q psy11568         88 YRFEFSNESGGRLDCAAQGSPTP-KIEWL  115 (116)
Q Consensus        88 ~~~~~~~g~~~~l~C~~~g~P~p-~i~W~  115 (116)
                      .+..+..|+.+.|.|.+.|.|.| .|+|+
T Consensus         6 ~~~~v~~G~~v~l~C~a~G~P~P~~I~W~   34 (81)
T cd05749           6 EDLSVTANTPFNLTCQAVGPPEPVEILWW   34 (81)
T ss_pred             CceEEcCCCCEEEEEEeeeecCCeEEEEE
Confidence            67888999999999999999999 79997


No 115
>smart00409 IG Immunoglobulin.
Probab=98.28  E-value=1.4e-05  Score=41.74  Aligned_cols=53  Identities=21%  Similarity=0.383  Sum_probs=35.6

Q ss_pred             cEEEEEccC-CeeeeccccceEEeeC--CeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          2 YVLLWLIRD-NTVIAYVKDLRIALSN--GSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         2 p~v~W~~~~-g~~~~~~~~~~~~~~~--~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      +.+.| +++ +..+....+......+  ..|.|.++...      |+|.|.|.+.+..+....
T Consensus        24 ~~~~W-~~~~~~~v~~~~~~~~~~~~~~~~l~i~~~~~~------d~G~Y~C~v~~~~~~~~~   79 (86)
T smart00409       24 PEVTW-YKQGGKLLAESGRFSVSRSGSNSTLTISNVTPE------DSGTYTCAATNSSGSASS   79 (86)
T ss_pred             CeEEE-EECCCEEcCCCCcEEEEEcCCeeEEEEEeeccc------cCeEEEEEEEcCCCeEEE
Confidence            57899 665 7766522222222222  47999999766      999999999988766553


No 116
>smart00410 IG_like Immunoglobulin like. IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.
Probab=98.28  E-value=1.4e-05  Score=41.74  Aligned_cols=53  Identities=21%  Similarity=0.383  Sum_probs=35.6

Q ss_pred             cEEEEEccC-CeeeeccccceEEeeC--CeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          2 YVLLWLIRD-NTVIAYVKDLRIALSN--GSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         2 p~v~W~~~~-g~~~~~~~~~~~~~~~--~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      +.+.| +++ +..+....+......+  ..|.|.++...      |+|.|.|.+.+..+....
T Consensus        24 ~~~~W-~~~~~~~v~~~~~~~~~~~~~~~~l~i~~~~~~------d~G~Y~C~v~~~~~~~~~   79 (86)
T smart00410       24 PEVTW-YKQGGKLLAESGRFSVSRSGSNSTLTISNVTPE------DSGTYTCAATNSSGSASS   79 (86)
T ss_pred             CeEEE-EECCCEEcCCCCcEEEEEcCCeeEEEEEeeccc------cCeEEEEEEEcCCCeEEE
Confidence            57899 665 7766522222222222  47999999766      999999999988766553


No 117
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC. TrkABC_d4: the fourth domain of Trk receptors TrkA, TrkB and TrkC, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors. They are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkA, TrkB, and TrkC share significant sequence homology and domain organization. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrkA, Band C mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. TrkA is recognized by NGF. TrKB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. TrkC is recognized by NT-3. NT-3 is promiscuous as in some cell systems it activates TrkA and TrkB receptors. TrkA is a receptor fo
Probab=98.26  E-value=1.7e-06  Score=46.82  Aligned_cols=31  Identities=35%  Similarity=0.754  Sum_probs=27.2

Q ss_pred             CCCeEEEeCCCcEEEEeeecCcCCceeEEeC
Q psy11568         86 PPYRFEFSNESGGRLDCAAQGSPTPKIEWLI  116 (116)
Q Consensus        86 ~~~~~~~~~g~~~~l~C~~~g~P~p~i~W~~  116 (116)
                      ++....+..|+.+.|.|.+.|.|.|.++|+.
T Consensus         6 ~p~~~~v~~G~~v~l~C~~~G~P~p~v~W~~   36 (90)
T cd04972           6 GPNATVVYEGGTATIRCTAEGSPLPKVEWII   36 (90)
T ss_pred             CCcCEEEcCCCcEEEEEEEEEcCCCeEEEEE
Confidence            3466778899999999999999999999973


No 118
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins. Ig5_Titin_like: domain similar to the M5, fifth immunoglobulin (Ig)-like domain from the human titin C terminus. Titin (also called connectin) is a fibrous sarcomeric protein specifically found in vertebrate striated muscle. Titin is gigantic; depending on isoform composition it ranges from 2970 to 3700 kDa, and is of a length that spans half a sarcomere. Titin largely consists of multiple repeats of Ig-like and fibronectin type 3 (FN-III)-like domains. Titin connects the ends of myosin thick filaments to Z disks and extends along the thick filament to the H zone, and appears to function similar to an elastic band, keeping the myosin filaments centered in the sarcomere during muscle contraction or stretching.
Probab=98.26  E-value=2.5e-06  Score=46.36  Aligned_cols=36  Identities=22%  Similarity=0.640  Sum_probs=31.9

Q ss_pred             CceEecCCCeEEEeCCCcEEEEeeecCcCCceeEEeC
Q psy11568         80 PLFRIEPPYRFEFSNESGGRLDCAAQGSPTPKIEWLI  116 (116)
Q Consensus        80 p~~~~~~~~~~~~~~g~~~~l~C~~~g~P~p~i~W~~  116 (116)
                      |.++..| ....+.+|+.+.|.|.+.|.|.|.+.|+.
T Consensus         4 ~~~~~~p-~~~~~~~G~~~~L~C~~~g~P~p~v~W~k   39 (92)
T cd05747           4 ATILTKP-RSLTVSEGESARFSCDVDGEPAPTVTWMR   39 (92)
T ss_pred             CcccccC-ccEEEeCCCcEEEEEEEeecCCCEEEEEE
Confidence            6666666 78899999999999999999999999973


No 119
>cd04968 Ig3_Contactin_like Third Ig domain of contactin. Ig3_Contactin_like: Third Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=98.26  E-value=2.3e-06  Score=46.06  Aligned_cols=36  Identities=25%  Similarity=0.468  Sum_probs=29.8

Q ss_pred             CceEecCCCeEEEeCCCcEEEEeeecCcCCceeEEeC
Q psy11568         80 PLFRIEPPYRFEFSNESGGRLDCAAQGSPTPKIEWLI  116 (116)
Q Consensus        80 p~~~~~~~~~~~~~~g~~~~l~C~~~g~P~p~i~W~~  116 (116)
                      +.+...+ ....+.+|+.+.|.|.+.|.|.|.++|+.
T Consensus         2 ~~~~~~p-~~~~~~~g~~v~l~C~~~g~P~p~v~W~k   37 (88)
T cd04968           2 SIIVVFP-KDTYALKGQNVTLECFALGNPVPQIKWRK   37 (88)
T ss_pred             CcEEECC-CceEEeCCCcEEEEEEeeEeCCCEEEEEE
Confidence            3444444 77888899999999999999999999973


No 120
>cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R). IG1_VEGFR: first immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGF_A interacts with both VEGFR-1 and VEGFR-2. VEGFR-1 binds strongest to VEGF, VEGF-2 binds more weakly. VEGFR-3 appears not to bind VEGF, but binds other members of the VEGF family (VEGF-C and -D). VEGFRs bind VEGFs with high affinity with the IG-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-2 is a major mediator of the mitogenic, angioge
Probab=98.25  E-value=5.2e-06  Score=44.67  Aligned_cols=29  Identities=17%  Similarity=0.232  Sum_probs=24.1

Q ss_pred             CeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568         27 GSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus        27 ~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      ..|.|.++..+      |+|.|+|.|.|..|...+
T Consensus        50 s~L~I~~~~~~------DsG~Y~C~a~n~~~~~~~   78 (86)
T cd05862          50 STLTIENVTLS------DLGRYTCTASSGQMIAKN   78 (86)
T ss_pred             eEEEEecCCcc------cCEEEEEEEeecceEecc
Confidence            47999999766      999999999998875553


No 121
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK). Ig8_MLCK: the eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK). MLCK is a key regulator of different forms of cell motility involving actin and myosin II.  Agonist stimulation of smooth muscle cells increases cytosolic Ca2+, which binds calmodulin.  This Ca2+-calmodulin complex in turn binds to and activates MLCK. Activated MLCK leads to the phosphorylation of the 20 kDa myosin regulatory light chain (RLC) of myosin II and the stimulation of actin-activated myosin MgATPase activity. MLCK is widely present in vertebrate tissues; it phosphorylates the 20 kDa RLC of both smooth and nonmuscle myosin II. Phosphorylation leads to the activation of the myosin motor domain and altered structural properties of myosin II. In smooth muscle MLCK it is involved in initiating contraction. In nonmuscle cells, MLCK may participate in cell division and cell motility; it has
Probab=98.23  E-value=3.5e-06  Score=46.46  Aligned_cols=35  Identities=17%  Similarity=0.332  Sum_probs=30.5

Q ss_pred             CceEecCCCeEEEeCCCcEEEEeeecCcCCceeEEe
Q psy11568         80 PLFRIEPPYRFEFSNESGGRLDCAAQGSPTPKIEWL  115 (116)
Q Consensus        80 p~~~~~~~~~~~~~~g~~~~l~C~~~g~P~p~i~W~  115 (116)
                      |.|+..+ ....+..|+.+.|.|.+.|.|+|.+.|+
T Consensus         1 p~~~~~p-~~~~v~~G~~v~l~C~~~G~p~p~v~W~   35 (98)
T cd05762           1 PQIIQFP-EDMKVRAGESVELFCKVTGTQPITCTWM   35 (98)
T ss_pred             CceEECC-cCEEEECCCEEEEEEEEcccCCCceEEE
Confidence            4455565 7888999999999999999999999997


No 122
>PF13895 Ig_2:  Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A ....
Probab=98.16  E-value=1.6e-05  Score=41.51  Aligned_cols=48  Identities=29%  Similarity=0.456  Sum_probs=32.8

Q ss_pred             cEEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEEEEE
Q psy11568          2 YVLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILSRFV   64 (116)
Q Consensus         2 p~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~~~~   64 (116)
                      +.+.| ++++..+...        .+.+.+.++..+      |+|.|+|.+.+..+...+..+
T Consensus        29 ~~~~w-~~~~~~~~~~--------~~~~~~~~~~~~------~~g~y~C~~~~~~~~~~s~~~   76 (80)
T PF13895_consen   29 PQVQW-YKNGSPINSS--------QNGLFIPNVSPE------DSGNYTCRASNGSGSNTSTSV   76 (80)
T ss_dssp             SEEEE-EETTEEEEEE--------SSEEEESSEEGG------GTEEEEEEEEETTEEEEEEEE
T ss_pred             eeeee-eeeeeeeeee--------eeeeeeeeeccc------cCEEEEEEEEeCCCCeEeeeE
Confidence            57889 6777766521        122667777655      999999999997765554433


No 123
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5. Ig1_Contactin-5: First Ig domain of the neural cell adhesion molecule contactin-5. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains, anchored to the membrane by glycosylphosphatidylinositol. The different contactins show different expression patterns in the central nervous system. In rats, a lack of contactin-5 (NB-2) results in an impairment of the neuronal activity in the auditory system. Contactin-5 is expressed specifically in the postnatal nervous system, peaking at about 3 weeks postnatal. Contactin-5 is highly expressed in the adult human brain in the occipital lobe and in the amygdala; lower levels of expression have been detected in the corpus callosum, caudate nucleus, and spinal cord.
Probab=98.15  E-value=5.7e-06  Score=45.24  Aligned_cols=35  Identities=40%  Similarity=0.804  Sum_probs=27.7

Q ss_pred             CceEecCCCeEEEe---CCCcEEEEeeecCcCCceeEEe
Q psy11568         80 PLFRIEPPYRFEFS---NESGGRLDCAAQGSPTPKIEWL  115 (116)
Q Consensus        80 p~~~~~~~~~~~~~---~g~~~~l~C~~~g~P~p~i~W~  115 (116)
                      |.|+..| .+..+.   +|+.+.|.|.+.|.|.|.++|+
T Consensus         2 P~f~~~p-~~~~~~~~~~g~~v~l~C~~~G~P~P~i~W~   39 (94)
T cd05848           2 PVFVQEP-DDAIFPTDSDEKKVILNCEARGNPVPTYRWL   39 (94)
T ss_pred             CeeEECC-CcEEccCCCCCCEEEEEEEeeecCCCEEEEE
Confidence            6676666 444443   4789999999999999999997


No 124
>PF07679 I-set:  Immunoglobulin I-set domain;  InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents I-set domains, which are found in several cell adhesion molecules, including vascular (VCAM), intercellular (ICAM), neural (NCAM) and mucosal addressin (MADCAM) cell adhesion molecules, as well as junction adhesion molecules (JAM). I-set domains are also present in several other diverse protein families, including several tyrosine-protein kinase receptors, the hemolymph protein hemolin, the muscle proteins titin, telokin, and twitchin, the neuronal adhesion molecule axonin-1 [], and the signalling molecule semaphorin 4D that is involved in axonal guidance, immune function and angiogenesis [].; PDB: 3MTR_A 2EDK_A 3DMK_B 1KOA_A 3NCM_A 2NCM_A 2V9Q_A 2CR3_A 3QQN_A 3QR2_A ....
Probab=98.14  E-value=4.9e-06  Score=44.72  Aligned_cols=36  Identities=25%  Similarity=0.689  Sum_probs=31.2

Q ss_pred             CceEecCCCeEEEeCCCcEEEEeeecCcCCceeEEeC
Q psy11568         80 PLFRIEPPYRFEFSNESGGRLDCAAQGSPTPKIEWLI  116 (116)
Q Consensus        80 p~~~~~~~~~~~~~~g~~~~l~C~~~g~P~p~i~W~~  116 (116)
                      |.|...+ ....+.+|+++.|.|.+.|.|.|.+.|++
T Consensus         1 P~~~~~~-~~~~v~~G~~~~l~c~~~~~p~~~v~W~~   36 (90)
T PF07679_consen    1 PVFTKKP-KDVTVKEGESVTLECEVSGNPPPTVTWYK   36 (90)
T ss_dssp             EEEEEES-SEEEEETTSEEEEEEEEEESSSSEEEEEE
T ss_pred             CEEEEec-CCEEEeCCCEEEEEEEEEeCCCCcccccc
Confidence            4555666 88999999999999999999999999973


No 125
>cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2). Ig5_KIRREL3: the fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1). These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development. Neph1 and 2 may mediate axonal guidance and synapse formation in certain areas of the CNS. In the kidney, they participate in the formation of the slit diaphragm.
Probab=98.13  E-value=1.6e-05  Score=43.81  Aligned_cols=53  Identities=21%  Similarity=0.290  Sum_probs=34.1

Q ss_pred             EEEEEccCCeeeeccccceEEe-----eC---CeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          3 VLLWLIRDNTVIAYVKDLRIAL-----SN---GSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         3 ~v~W~~~~g~~~~~~~~~~~~~-----~~---~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      .|.| ..++..+......++..     .+   ..|.|.++.+.     .+.|.|.|.|.|.+|....
T Consensus        33 ~i~W-~w~~~~i~~~~~~r~~I~~~~~~~g~~S~L~I~~~~~~-----d~~g~Y~C~a~N~~G~d~~   93 (98)
T cd05898          33 RIAW-AWKENVLESGTSERYTVERTSTGSGVLSTLTINNIMEA-----DFQTHYNCTAWNSFGSGTA   93 (98)
T ss_pred             EEEE-EEccccccCCCCCCEEEEEEccCCCcEEEEEECCCccc-----cCCcEEEEEEEeCCccceE
Confidence            4688 55555654322223322     11   26999999654     1489999999999998764


No 126
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM). Ig5_NCAM-2: the fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM). NCAM-2  is organized similarly to NCAM , including five N-terminal Ig-like domains and two fibronectin type III domains. NCAM-2 is differentially expressed in the developing and mature olfactory epithelium (OE), and may function like NCAM, as an adhesion molecule.
Probab=98.13  E-value=6.8e-06  Score=45.19  Aligned_cols=34  Identities=26%  Similarity=0.550  Sum_probs=29.1

Q ss_pred             CceEecCCCeEEEeCCCcEEEEeeecCcCCceeEEe
Q psy11568         80 PLFRIEPPYRFEFSNESGGRLDCAAQGSPTPKIEWL  115 (116)
Q Consensus        80 p~~~~~~~~~~~~~~g~~~~l~C~~~g~P~p~i~W~  115 (116)
                      |.+. .+ .+..+.+|+.+.|.|.+.|.|.|.++|+
T Consensus         3 p~i~-~~-~~~~~~~G~~v~l~C~~~G~P~p~i~W~   36 (98)
T cd05870           3 PHII-QL-KNETTVENGAATLSCKAEGEPIPEITWK   36 (98)
T ss_pred             CEEE-ee-ccEEEcCCCcEEEEEecccCCCCeEEEE
Confidence            5553 34 6788899999999999999999999997


No 127
>PF13927 Ig_3:  Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C ....
Probab=98.11  E-value=8.3e-06  Score=41.97  Aligned_cols=25  Identities=32%  Similarity=0.495  Sum_probs=20.6

Q ss_pred             eeCCeEEecCCCCCCCCCCCCceEEEEEEEc
Q psy11568         24 LSNGSLMFPPFPETGFRPDVHSTVYRCRASN   54 (116)
Q Consensus        24 ~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n   54 (116)
                      ..++.|.|.++..+      |.|.|+|.|.|
T Consensus        51 ~~~~~L~i~~v~~~------~~g~y~C~a~N   75 (75)
T PF13927_consen   51 SSNSTLTISNVTRS------DNGTYTCIASN   75 (75)
T ss_dssp             EEEEEEEESSCCGG------GTEEEEEEEEE
T ss_pred             ceeeEEEEccCCHH------hCcEEEEEEEC
Confidence            34558999999766      99999999987


No 128
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein. Ig_Myomesin_like_C: domain similar to the C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein. Myomesin and M-protein are both structural proteins localized to the M-band, a transverse structure in the center of the sarcomere, and are candidates for M-band bridges. Both proteins are modular, consisting mainly of repetitive Ig-like and fibronectin type III (FnIII) domains. Myomesin is expressed in all types of vertebrate striated muscle; M-protein has a muscle-type specific expression pattern. Myomesin is present in both slow and fast fibers; M-protein is present only in fast fibers. It has been suggested that myomesin acts as a molecular spring with alternative splicing as a means of modifying its elasticity.
Probab=98.10  E-value=9.1e-06  Score=44.15  Aligned_cols=31  Identities=26%  Similarity=0.556  Sum_probs=27.2

Q ss_pred             CCCeEEEeCCCcEEEEeeecCcCCceeEEeC
Q psy11568         86 PPYRFEFSNESGGRLDCAAQGSPTPKIEWLI  116 (116)
Q Consensus        86 ~~~~~~~~~g~~~~l~C~~~g~P~p~i~W~~  116 (116)
                      .+....+.+|+++.|.|.+.|.|.|.++|+.
T Consensus         7 lp~~v~v~~G~~v~L~C~v~G~P~p~v~W~k   37 (92)
T cd05737           7 LPDVVTIMEGKTLNLTCTVFGDPDPEVSWLK   37 (92)
T ss_pred             CCceEEEeCCCcEEEEEEEEecCCCeEEEEE
Confidence            3466788899999999999999999999973


No 129
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins. Ig4_Contactin-2-like: fourth Ig domain of the neural cell adhesion molecule contactin-2. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (aliases TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. The first four Ig domains form the intermolecular binding fragment which arranges as a compact U-shaped module by contacts between Ig domains 1 and 4, and domains 2 and 3. It has been proposed that a linear zipper-like array forms, from contactin-2 molecules alternatively provided by the two apposed membranes.
Probab=98.09  E-value=5.5e-06  Score=44.39  Aligned_cols=28  Identities=36%  Similarity=0.624  Sum_probs=26.3

Q ss_pred             CeEEEeCCCcEEEEeeecCcCCceeEEe
Q psy11568         88 YRFEFSNESGGRLDCAAQGSPTPKIEWL  115 (116)
Q Consensus        88 ~~~~~~~g~~~~l~C~~~g~P~p~i~W~  115 (116)
                      .+..+..|+.+.|.|.+.|.|.|.++|+
T Consensus         7 ~~~~~~~G~~~~l~C~~~g~p~p~v~W~   34 (85)
T cd05728           7 SDTEADIGSSLRWECKASGNPRPAYRWL   34 (85)
T ss_pred             CccEEcCCCcEEEEEEeeEeCCCEEEEE
Confidence            6788889999999999999999999996


No 130
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2. Ig1_Contactin-2: First Ig domain of the neural cell adhesion molecule contactin-2-like. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. It may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module by contacts between IG domains 1 and 4, and domains 2 and 3. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-2 is also expressed in retinal amacrine cells in the developing c
Probab=98.09  E-value=8e-06  Score=44.64  Aligned_cols=36  Identities=28%  Similarity=0.626  Sum_probs=28.1

Q ss_pred             CceEecCCCeEEEeCC---CcEEEEeeecCcCCceeEEeC
Q psy11568         80 PLFRIEPPYRFEFSNE---SGGRLDCAAQGSPTPKIEWLI  116 (116)
Q Consensus        80 p~~~~~~~~~~~~~~g---~~~~l~C~~~g~P~p~i~W~~  116 (116)
                      |.|...| ....+.+|   +++.|.|.+.|.|.|.++|++
T Consensus         2 P~f~~~P-~~~~~~~~~~g~~v~l~C~a~g~P~p~i~W~~   40 (94)
T cd05850           2 PVFEEQP-SSLLFPEGSPEEKVTLGCRARASPPATYRWKM   40 (94)
T ss_pred             CeeEECC-CCEEecCCCCCCeEEEEeEceeCCCCEEEEEE
Confidence            5666665 56655555   579999999999999999973


No 131
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1. Ig1_Contactin-1: First Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may, through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=98.06  E-value=1.1e-05  Score=44.10  Aligned_cols=35  Identities=26%  Similarity=0.637  Sum_probs=26.4

Q ss_pred             CceEecCCCeEEEeC---CCcEEEEeeecCcCCceeEEe
Q psy11568         80 PLFRIEPPYRFEFSN---ESGGRLDCAAQGSPTPKIEWL  115 (116)
Q Consensus        80 p~~~~~~~~~~~~~~---g~~~~l~C~~~g~P~p~i~W~  115 (116)
                      |.|...| ....+.+   |..+.|.|.+.|.|.|.++|+
T Consensus         2 P~f~~~P-~~~~~~~~~~~~~v~l~C~a~G~P~P~i~W~   39 (93)
T cd05849           2 PVFEEQP-IDTIYPEESTEGKVSVNCRARANPFPIYKWR   39 (93)
T ss_pred             CEEEECC-CCEEecCCccCCeEEEeCcCccCCCCEEEEE
Confidence            5566555 4444443   347999999999999999997


No 132
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins. Ig1_Neogenin: first immunoglobulin (Ig)-like domain in neogenin and related proteins. Neogenin  is a cell surface protein which is expressed in the developing nervous system of vertebrate embryos in the growing nerve cells. It is also expressed in other embryonic tissues, and may play a general role in developmental processes such as cell migration, cell-cell recognition, and tissue growth regulation. Included in this group is the tumor suppressor protein DCC, which is deleted in colorectal carcinoma . DCC and neogenin each have four Ig-like domains followed by six fibronectin type III domains, a transmembrane domain, and an intracellular domain.
Probab=98.04  E-value=1.2e-05  Score=43.89  Aligned_cols=33  Identities=39%  Similarity=0.694  Sum_probs=28.0

Q ss_pred             eEecCCCeEEEeCCCcEEEEeeecCcCCceeEEe
Q psy11568         82 FRIEPPYRFEFSNESGGRLDCAAQGSPTPKIEWL  115 (116)
Q Consensus        82 ~~~~~~~~~~~~~g~~~~l~C~~~g~P~p~i~W~  115 (116)
                      |...| ....+.+|+++.|.|.+.|.|.|.++|+
T Consensus         2 f~~~P-~~~~~~~g~~v~l~C~v~g~P~p~i~W~   34 (95)
T cd05722           2 FLSEP-SDIVAVRGGPVVLNCSAEGEPPPKIEWK   34 (95)
T ss_pred             cEECC-CCeEEcCCCCEEEeeecccCCCCEEEEE
Confidence            34455 6677788999999999999999999997


No 133
>PHA03376 BARF1; Provisional
Probab=98.03  E-value=3.4e-05  Score=47.15  Aligned_cols=71  Identities=20%  Similarity=0.356  Sum_probs=42.2

Q ss_pred             eEEecCCCCCCCCCCCCceEEEEEEEcCCCceE-EEEEEEEeCcEeeeeccCCCceEecCCCeEEEeCCCcEEEEeeecC
Q psy11568         28 SLMFPPFPETGFRPDVHSTVYRCRASNEAGVIL-SRFVHVKAGSVVSLLDIQGPLFRIEPPYRFEFSNESGGRLDCAAQG  106 (116)
Q Consensus        28 ~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~-~~~~~v~~~~~~~~~~~~~p~~~~~~~~~~~~~~g~~~~l~C~~~g  106 (116)
                      +|.|.+++.+      |.|.|+|.......... ...+.+..+..          +.+.. ....+...+...+.|.+.|
T Consensus        88 sLvI~~l~lS------DdGtY~C~fQkge~~~~k~ehLt~V~~~~----------Lsv~a-~~~dFp~~~~~~i~C~sgg  150 (221)
T PHA03376         88 FLVVTAANIS------HDGNYLCRMKLGETEVTKQEHLSVVKPLT----------LSVHS-ERSQFPDFSVLTVTCTVNA  150 (221)
T ss_pred             EEEEEeeeec------CCceEEEEEEcCCCceeeeeeeeeeecce----------EEEEe-ccccCCCCCeeEEEEecCC
Confidence            6888999655      99999999877643222 22222211100          11111 1111122567788899888


Q ss_pred             cCCceeEEe
Q psy11568        107 SPTPKIEWL  115 (116)
Q Consensus       107 ~P~p~i~W~  115 (116)
                      -|.|.++|.
T Consensus       151 fP~P~~~Wl  159 (221)
T PHA03376        151 FPHPHVQWL  159 (221)
T ss_pred             cCCchheec
Confidence            999999995


No 134
>cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM). IG_CEACAM_D1: immunoglobulin (Ig)-like domain 1 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surface. This family corresponds to the D
Probab=98.01  E-value=9.7e-05  Score=41.27  Aligned_cols=30  Identities=17%  Similarity=0.242  Sum_probs=24.9

Q ss_pred             EeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCc
Q psy11568         23 ALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGV   58 (116)
Q Consensus        23 ~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~   58 (116)
                      ...+++|.|.++++.      |+|.|.|.+.+....
T Consensus        66 ~~~ngSL~I~~v~~~------D~G~Y~~~v~~~~~~   95 (105)
T cd05774          66 IYPNGSLLIQNVTQK------DTGFYTLQTITTNFQ   95 (105)
T ss_pred             EeCCCcEEEecCCcc------cCEEEEEEEEeCCcc
Confidence            455789999999766      999999999988643


No 135
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins. Ig5_KIRREL3-like: domain similar to the fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1), Kirrel2 (Neph3), and Drosophila RST (irregular chiasm C-roughest) protein. These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development.
Probab=97.97  E-value=2.3e-05  Score=43.03  Aligned_cols=35  Identities=20%  Similarity=0.324  Sum_probs=27.8

Q ss_pred             ceEecCCCeEEEeCCCcEEEEeeecCcCCc-eeEEeC
Q psy11568         81 LFRIEPPYRFEFSNESGGRLDCAAQGSPTP-KIEWLI  116 (116)
Q Consensus        81 ~~~~~~~~~~~~~~g~~~~l~C~~~g~P~p-~i~W~~  116 (116)
                      .++..+ ....+..|+.+.|.|.+.|.|.| .++|+.
T Consensus         3 p~i~~~-~~~~~~~G~~v~L~C~~~g~P~P~~v~W~~   38 (98)
T cd05758           3 PIITSE-ATQYAILGDKGRVECFIFSTPPPDRIVWTW   38 (98)
T ss_pred             CeEcCC-CcEEEeCCCcEEEEEEEcccCCCCEeEEEE
Confidence            333444 56677889999999999999999 599963


No 136
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C). Ig_C5_MyBP_C : the C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C). MyBP_C consists of repeated domains, Ig and fibronectin type 3, and various linkers. Three isoforms of MYBP_C exist and are included in this group: cardiac(c), and fast and slow skeletal muscle (s) MyBP_C. cMYBP_C has insertions between and inside domains and an additional cardiac-specific Ig domain at the N-terminus. For cMYBP_C  an interaction has been demonstrated between this C5 domain and the Ig C8 domain.
Probab=97.97  E-value=1.7e-05  Score=42.64  Aligned_cols=28  Identities=25%  Similarity=0.499  Sum_probs=25.1

Q ss_pred             CeEEEeCCCcEEEEeeecCcCCceeEEe
Q psy11568         88 YRFEFSNESGGRLDCAAQGSPTPKIEWL  115 (116)
Q Consensus        88 ~~~~~~~g~~~~l~C~~~g~P~p~i~W~  115 (116)
                      ....+..|+.+.|.|.+.|.|.|.++|+
T Consensus         3 ~~~~v~~G~~v~l~c~~~G~P~P~v~W~   30 (86)
T cd05894           3 NTIVVVAGNKLRLDVPISGEPAPTVTWS   30 (86)
T ss_pred             CEEEEEcCCEEEEEeeEeecCCCeEEEE
Confidence            3566788999999999999999999996


No 137
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). Ig5_NCAM-1: The fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM) and heterophilic (NCAM-non-NCAM) interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the surface of opposing cells (tr
Probab=97.97  E-value=2.4e-05  Score=42.89  Aligned_cols=35  Identities=29%  Similarity=0.513  Sum_probs=27.5

Q ss_pred             CceEecCCCeEEEeCCCcEEEEeeecCcCCceeEEe
Q psy11568         80 PLFRIEPPYRFEFSNESGGRLDCAAQGSPTPKIEWL  115 (116)
Q Consensus        80 p~~~~~~~~~~~~~~g~~~~l~C~~~g~P~p~i~W~  115 (116)
                      |.+...+ ....+..|+.+.|.|.+.|.|.|.++|+
T Consensus         3 p~i~~~~-~~~~~~~g~~v~l~C~~~G~P~P~v~W~   37 (97)
T cd05869           3 PKITYVE-NQTAMELEEQITLTCEASGDPIPSITWR   37 (97)
T ss_pred             ceEEEcc-CceEEEcCCCEEEEEEeeEeCCCEEEEE
Confidence            5555554 3445556899999999999999999997


No 138
>cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4. Ig1_CD4; first immunoglobulin (Ig) domain of CD4.  CD4 and CD8 are the two primary co-receptor proteins found on the surface of T cells, and the presence of either CD4 or CD8 determines the function of the T cell.  CD4 is found on helper T cells, where it is required for the binding of MHC (major histocompatibility complex) class II molecules, while CD8 is found on cytotoxic T cells, where it is required for the binding of MHC class I molecules.  CD4 contains four immunoglobulin domains, with the first three included in this hierarchy.  The fourth domain has a general Ig architecture, but has slight topological changes in the arrangement of beta strands relative to the other structures in this family and is not specifically included in the hierarchy.
Probab=97.96  E-value=1.8e-05  Score=43.30  Aligned_cols=25  Identities=16%  Similarity=0.341  Sum_probs=21.6

Q ss_pred             eEEecCCCCCCCCCCCCceEEEEEEEcCCCc
Q psy11568         28 SLMFPPFPETGFRPDVHSTVYRCRASNEAGV   58 (116)
Q Consensus        28 ~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~   58 (116)
                      .|.|.++..+      |+|+|.|.+.|..+.
T Consensus        66 ~L~I~~l~~s------DsgtY~C~v~~~~~~   90 (94)
T cd07690          66 PLIIKNLKIE------DSDTYICEVEDKKEE   90 (94)
T ss_pred             EEEECCCCHH------HCEEEEEEECCccce
Confidence            5999999766      999999999998653


No 139
>cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like. Ig_SLAM-CD84_like_N: The N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like. The SLAM family is a group of immune-cell specific receptors that can regulate both adaptive and innate immune responses. Members of this group include proteins such as CD84, SLAM (CD150), Ly-9 (CD229), NTB-A (ly-108, SLAM6), 19A (CRACC), and SLAMF9. The genes coding for the SLAM family are nested on chromosome 1, in humans at 1q23, and in mice at 1H2. The SLAM family is a subset of the CD2 family, which also includes CD2 and CD58 located on chromosome 1 at 1p13 in humans. In mice, CD2 is located on chromosome 3, and there is no CD58 homolog. The SLAM family proteins are organized as an extracellular domain with either two or four Ig-like domains, a single transmembrane segment, and a cytoplasmic region 
Probab=97.92  E-value=0.00022  Score=39.13  Aligned_cols=30  Identities=20%  Similarity=0.354  Sum_probs=25.0

Q ss_pred             CeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEEE
Q psy11568         27 GSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILSR   62 (116)
Q Consensus        27 ~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~~   62 (116)
                      .+|.|.+++.+      |+|.|.|...+..|.....
T Consensus        61 ~sL~I~~~~~~------DsG~Y~c~v~~~~~~~~~~   90 (97)
T cd05775          61 YSLQISNLKME------DAGSYRAEINTKNGVTITK   90 (97)
T ss_pred             eeEEECCCchH------HCEEEEEEEEcCCCCeEEE
Confidence            47999999766      9999999999887766543


No 140
>cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins. Ig_CEACAM_D1_like : immunoglobulin (IG)-like domain 1 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily-like. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surf
Probab=97.89  E-value=0.00026  Score=38.14  Aligned_cols=31  Identities=26%  Similarity=0.403  Sum_probs=25.1

Q ss_pred             eCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568         25 SNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus        25 ~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      .+++|.|.+++.+      |+|.|.|......+....
T Consensus        55 ~~~sL~I~~l~~~------DsG~Y~c~v~~~~~~~~~   85 (92)
T cd05741          55 PNGSLLIQNLTKE------DSGTYTLQIISTNGVTEN   85 (92)
T ss_pred             CCceEEEccCCch------hcEEEEEEEEcCCCcEEE
Confidence            4568999999766      999999999988755443


No 141
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins. Ig5_NCAM-1 like: domain similar to the fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic  (NCAM-NCAM), and heterophilic (NCAM-non-NCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM mole
Probab=97.86  E-value=3.5e-05  Score=41.98  Aligned_cols=34  Identities=26%  Similarity=0.432  Sum_probs=28.4

Q ss_pred             CceEecCCCeEEEeCCCcEEEEeeecCcCCceeEEe
Q psy11568         80 PLFRIEPPYRFEFSNESGGRLDCAAQGSPTPKIEWL  115 (116)
Q Consensus        80 p~~~~~~~~~~~~~~g~~~~l~C~~~g~P~p~i~W~  115 (116)
                      |.+. .+ .+..+.+|+.+.|.|.+.|.|.|.++|+
T Consensus         3 P~i~-~~-~~~~~~~g~~v~l~C~~~g~p~p~v~W~   36 (96)
T cd05732           3 PKIT-YL-ENQTAVELEQITLTCEAEGDPIPEITWR   36 (96)
T ss_pred             ccce-ec-CceeEecCCcEEEEEEEeEcCCCcEEEE
Confidence            5553 33 5677889999999999999999999997


No 142
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). Ig3_NCAM-1_like: domain similar to the third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-non-NCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1,and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the
Probab=97.86  E-value=3.4e-05  Score=42.01  Aligned_cols=28  Identities=25%  Similarity=0.491  Sum_probs=25.3

Q ss_pred             CeEEEeCCCcEEEEeeecCcCCceeEEe
Q psy11568         88 YRFEFSNESGGRLDCAAQGSPTPKIEWL  115 (116)
Q Consensus        88 ~~~~~~~g~~~~l~C~~~g~P~p~i~W~  115 (116)
                      ....+..|+++.|.|.+.|.|.|.++|+
T Consensus        11 ~~~~~~~G~~v~L~C~~~g~P~p~v~W~   38 (95)
T cd05730          11 VNATANLGQSVTLACDADGFPEPTMTWT   38 (95)
T ss_pred             cceEEeCCCCEEEEEeccEeCCCEEEEE
Confidence            4557788999999999999999999997


No 143
>cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG). Ig_MOG_like:  immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG). MOG, a minor component of the myelin sheath, is an important CNS-specific autoantigen, linked to the pathogenesis of multiple sclerosis (MS) and experimental autoimmune encephalomyelitis (EAE). It is a transmembrane protein having an extracellular Ig domain. MOG is expressed in the CNS on the outermost lamellae of the myelin sheath, and on the surface of oligodendrocytes, and may participate in the completion, compaction, and/or maintenance of myelin. This group also includes butyrophilin (BTN). BTN is the most abundant protein in bovine milk-fat globule membrane (MFGM).
Probab=97.81  E-value=0.00014  Score=39.92  Aligned_cols=27  Identities=11%  Similarity=0.132  Sum_probs=22.5

Q ss_pred             eEEecCCCCCCCCCCCCceEEEEEEEcCCCceE
Q psy11568         28 SLMFPPFPETGFRPDVHSTVYRCRASNEAGVIL   60 (116)
Q Consensus        28 ~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~   60 (116)
                      +|.|.++..+      |+|.|.|.+.+..+...
T Consensus        66 sL~I~~v~~~------D~G~Y~C~v~~~~~~~~   92 (100)
T cd05713          66 ALRIHNVRAS------DEGLYTCFFQSDGFYEE   92 (100)
T ss_pred             EEEEEcCChh------hCEEEEEEEecCCcEEE
Confidence            6999999766      99999999998766533


No 144
>cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR). Ig4_SCFR: The fourth Immunoglobulin (Ig)-like domain in stem cell factor receptor (SCFR). SCFR is organized as an extracellular component having five IG-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. SCFR and its ligand SCF are critical for normal hematopoiesis, mast cell development, melanocytes and gametogenesis. SCF binds to the second and third Ig-like domains of SCFR. This fourth Ig-like domain participates in SCFR dimerization, which follows ligand binding. Deletion of this fourth domain abolishes the ligand-induced dimerization of SCFR and completely inhibits signal transduction.
Probab=97.77  E-value=0.0003  Score=38.95  Aligned_cols=58  Identities=19%  Similarity=0.142  Sum_probs=36.6

Q ss_pred             cE-EEEEccCCeeeeccccceEEee-------CCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceE-EEEEEE
Q psy11568          2 YV-LLWLIRDNTVIAYVKDLRIALS-------NGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVIL-SRFVHV   66 (116)
Q Consensus         2 p~-v~W~~~~g~~~~~~~~~~~~~~-------~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~-~~~~~v   66 (116)
                      |+ +.| .+++..+...........       ...|.|.+++.+      |+|.|+|.|.|...... ++.|.|
T Consensus        33 p~~~~W-~~~~~~l~~~~~~~~~~~~~~~~rY~S~L~L~Rlk~~------E~G~YTf~a~N~~~~~s~tF~l~v   99 (101)
T cd05860          33 PEHQQW-IYMNRTLTNTSDHYVKSRNESNNRYVSELHLTRLKGT------EGGTYTFLVSNSDASASVTFNVYV   99 (101)
T ss_pred             CeeeEE-EcCCcccCccccceeEEeccCceEEEEEEEEeecChh------hCcEEEEEEECCCCeEEEEEEEEE
Confidence            44 899 777766543211111111       125888888666      99999999999986655 354443


No 145
>cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins. Ig1_PVR_like: domain similar to the first immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155). Poliovirus (PV) binds to its cellular receptor (PVR/CD155) to initiate infection. CD155 is a membrane-anchored, single-span glycoprotein; its extracellular region has three Ig-like domains. There are four different isotypes of CD155 (referred to as alpha, beta, gamma, and delta), that result from alternate splicing of the CD155 mRNA, and have identical extracellular domains. CD155-beta and - gamma, are secreted, CD155-alpha and delta are membrane-bound and function as PV receptors. The virus recognition site is contained in the amino-terminal domain, D1. Having the virus attachment site on the receptor distal from the plasma membrane, may be important for successful initiation of infection of cells by the virus. CD155 binds in the poliovirus "c
Probab=97.76  E-value=0.00047  Score=37.61  Aligned_cols=29  Identities=10%  Similarity=0.184  Sum_probs=22.3

Q ss_pred             CeEEecCCCCCCCCCCCCceEEEEEEEc-CCCceEE
Q psy11568         27 GSLMFPPFPETGFRPDVHSTVYRCRASN-EAGVILS   61 (116)
Q Consensus        27 ~~l~i~~v~~~~~~~~~d~G~y~C~a~n-~~g~~~~   61 (116)
                      ..|.|.++..+      |+|.|.|...+ ..|....
T Consensus        62 ~sL~I~~v~~~------D~G~Y~C~v~~~~~g~~~~   91 (98)
T cd05718          62 ATISISNLRLE------DEGNYICEFATFPQGNRQK   91 (98)
T ss_pred             eEEEEccCCcc------cCEEEEEEEEeCCCCcEEE
Confidence            37999999766      99999999876 3455443


No 146
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2). Ig_M-protein_C: the C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2). M-protein is a structural protein localized to the M-band, a transverse structure in the center of the sarcomere, and is a candidate for M-band bridges. M-protein is modular consisting mainly of repetitive IG-like and fibronectin type III (FnIII) domains, and has a muscle-type specific expression pattern. M-protein is present in fast fibers.
Probab=97.74  E-value=5.9e-05  Score=41.02  Aligned_cols=29  Identities=24%  Similarity=0.593  Sum_probs=26.2

Q ss_pred             CCeEEEeCCCcEEEEeeecCcCCceeEEe
Q psy11568         87 PYRFEFSNESGGRLDCAAQGSPTPKIEWL  115 (116)
Q Consensus        87 ~~~~~~~~g~~~~l~C~~~g~P~p~i~W~  115 (116)
                      |....+.+|+.+.|.|.+.|.|.|.+.|+
T Consensus         8 p~~v~v~eG~~v~L~C~v~g~P~p~i~W~   36 (92)
T cd05891           8 PDVVTIMEGKTLNLTCTVFGNPDPEVIWF   36 (92)
T ss_pred             CCcEEEcCCCEEEEEEEEEEeCCCeEEEE
Confidence            35678889999999999999999999997


No 147
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. Ig2_FGFR: second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. FGF receptors bind FGF signaling polypeptides. FGFs participate in multiple processes such as morphogenesis, development, and angiogenesis. FGFs bind to four FGF receptor tyrosine kinases (FGFR1, -2, -3, -4). Receptor diversity is controlled by alternative splicing producing splice variants with different ligand binding characteristics and different expression patterns. FGFRs have an extracellular region comprised of three IG-like domains, a single transmembrane helix, and an intracellular tyrosine kinase domain. Ligand binding and specificity reside in the Ig-like domains 2 and 3, and the linker region that connects these two. FGFR activation and signaling depend on FGF-induced dimerization, a process involving cell surface heparin or heparin sulfate proteoglycans.
Probab=97.74  E-value=5.4e-05  Score=40.28  Aligned_cols=27  Identities=30%  Similarity=0.731  Sum_probs=24.3

Q ss_pred             eEEEeCCCcEEEEeeecCcCCceeEEe
Q psy11568         89 RFEFSNESGGRLDCAAQGSPTPKIEWL  115 (116)
Q Consensus        89 ~~~~~~g~~~~l~C~~~g~P~p~i~W~  115 (116)
                      ...+.+|+.+.|.|.+.|.|.|.++|+
T Consensus         3 ~~~v~~G~~~~L~C~~~g~P~p~i~W~   29 (85)
T cd05857           3 LHAVPAANTVKFRCPAAGNPTPTMRWL   29 (85)
T ss_pred             cEEcCCCCEEEEEEEcCCCCCCEEEEE
Confidence            356778999999999999999999997


No 148
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. Ig1_NCAM-1: first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. NCAM-1 plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-nonNCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves the Ig1, Ig2, and Ig3 domains. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the surface of opposing cells (trans
Probab=97.71  E-value=7.3e-05  Score=41.06  Aligned_cols=28  Identities=21%  Similarity=0.373  Sum_probs=24.5

Q ss_pred             CeEEEeCCCcEEEEeeecCcCC-ceeEEe
Q psy11568         88 YRFEFSNESGGRLDCAAQGSPT-PKIEWL  115 (116)
Q Consensus        88 ~~~~~~~g~~~~l~C~~~g~P~-p~i~W~  115 (116)
                      ....+..|+++.|.|.+.|.|. |.++|+
T Consensus         8 ~~~~v~~G~~v~l~C~v~G~P~~p~i~W~   36 (96)
T cd05865           8 SQGEISVGESKFFLCQVAGEAKDKDISWF   36 (96)
T ss_pred             CccEECCCCeEEEEEEEeCCCCCCEEEEE
Confidence            4557788999999999999995 799997


No 149
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins. Ig4_SCFR_like; fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR). In addition to SCFR this group also includes the fourth Ig domain of platelet-derived growth factor receptors (PDGFR), alpha and beta, the fourth Ig domain of macrophage colony stimulating factor (M-CSF), and the Ig domain of the receptor tyrosine kinase KIT. SCFR and the PDGFR alpha and beta have similar organization: an extracellular component having five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. SCFR and its ligand SCF are critical for normal hematopoiesis, mast cell development, melanocytes and gametogenesis. SCF binds to the second and third Ig-like domains of SCFR, this fourth Ig-like domain participates in SCFR dimerization, which follows ligand binding. Deletion of this fourth SCFR_Ig-like domain abolishes
Probab=97.68  E-value=9.2e-05  Score=41.06  Aligned_cols=28  Identities=18%  Similarity=0.313  Sum_probs=25.9

Q ss_pred             CeEEEeCCCcEEEEeeecC-cCCceeEEe
Q psy11568         88 YRFEFSNESGGRLDCAAQG-SPTPKIEWL  115 (116)
Q Consensus        88 ~~~~~~~g~~~~l~C~~~g-~P~p~i~W~  115 (116)
                      ....+.+|+.+.|.|.+.| .|+|.++|+
T Consensus        11 ~~~~v~~G~~v~L~c~v~g~~P~p~v~W~   39 (101)
T cd04975          11 TTIFVNLGENLNLVVEVEAYPPPPHINWT   39 (101)
T ss_pred             ceEEEECCCCEEEEEEEEecCCCCccEEE
Confidence            5778889999999999999 999999997


No 150
>cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins. Ig1_Nectin-3_like: domain similar to the first immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3). Nectin-3 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which participate in adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. For example, during spermatid development, the nectin-3,-2 trans-interaction is required for the formation of Sertoli cell-spermatid junctions in testis, and during morphogenesis of the ciliary body, the nectin-3,-1 trans-interaction is important for apex-apex adhesion between the pigment and non-pigment layers of the ciliary epithelia. Nectins also
Probab=97.67  E-value=0.00062  Score=37.42  Aligned_cols=30  Identities=23%  Similarity=0.331  Sum_probs=23.6

Q ss_pred             CCeEEecCCCCCCCCCCCCceEEEEEEEcC-CCceEE
Q psy11568         26 NGSLMFPPFPETGFRPDVHSTVYRCRASNE-AGVILS   61 (116)
Q Consensus        26 ~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~-~g~~~~   61 (116)
                      +.+|.|.+++.+      |+|.|.|...+- .|...+
T Consensus        59 d~sl~i~nv~~~------D~G~Y~C~v~tfP~G~~~~   89 (96)
T cd05887          59 DATIMLENVGFS------DIGVYICKAVTFPLGNTQS   89 (96)
T ss_pred             ccEEEEeCCCcc------ccEEEEEEEEeCCCCCeeE
Confidence            458999999766      999999997665 566554


No 151
>cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins. Ig1_Nectin-1_like: domain similar to the first immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111). Nectin-1 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. In addition nectins heterophilically trans-interact with other CAMs such as nectin-like molecules (Necls), nectin-1 for example, has been shown to trans-interact with Necl-1. Nectins also interact with various other proteins, including the actin filament (F-actin)-binding protein, afadin. Mutation in the human nectin-1 gene is 
Probab=97.66  E-value=0.00023  Score=39.33  Aligned_cols=28  Identities=18%  Similarity=0.299  Sum_probs=22.7

Q ss_pred             CeEEecCCCCCCCCCCCCceEEEEEEEcC-CCceE
Q psy11568         27 GSLMFPPFPETGFRPDVHSTVYRCRASNE-AGVIL   60 (116)
Q Consensus        27 ~~l~i~~v~~~~~~~~~d~G~y~C~a~n~-~g~~~   60 (116)
                      .+|.|.+++.+      |+|.|.|...+. .|...
T Consensus        63 aSi~i~nl~~~------D~G~Y~C~v~t~P~g~~~   91 (99)
T cd05886          63 GTISLSRLELE------DEGVYICEFATFPTGNRE   91 (99)
T ss_pred             ceEEEcCCccc------cCEEEEEEEEeCCCCCeE
Confidence            57999999766      999999999994 55433


No 152
>cd04967 Ig1_Contactin First Ig domain of contactin. Ig1_Contactin: First Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 weeks postnata
Probab=97.64  E-value=0.00015  Score=39.25  Aligned_cols=36  Identities=39%  Similarity=0.821  Sum_probs=26.3

Q ss_pred             CceEecCCCeEEEeC---CCcEEEEeeecCcCCceeEEeC
Q psy11568         80 PLFRIEPPYRFEFSN---ESGGRLDCAAQGSPTPKIEWLI  116 (116)
Q Consensus        80 p~~~~~~~~~~~~~~---g~~~~l~C~~~g~P~p~i~W~~  116 (116)
                      |.|...| ....+..   |+++.|.|.+.|.|.|.++|+.
T Consensus         2 P~f~~~p-~~~~~~~~~~~~~~~l~C~~~g~p~p~i~W~k   40 (91)
T cd04967           2 PVFEEQP-DDTIFPEESDEGKVSLNCRARGSPPPTYRWLM   40 (91)
T ss_pred             CeeEeCC-CCEEccCCCCCCEEEEEEeeeEcCCCEEEEEE
Confidence            5555555 4444333   4679999999999999999973


No 153
>cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)). Ig1_Necl-1: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-1, Necl-1 (also known as celll adhesion molecule 3 (CADM3), SynCAM2, IGSF4). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue, and is important to the format
Probab=97.64  E-value=0.00012  Score=40.16  Aligned_cols=28  Identities=11%  Similarity=0.264  Sum_probs=25.8

Q ss_pred             CeEEEeCCCcEEEEeeecCcCCceeEEe
Q psy11568         88 YRFEFSNESGGRLDCAAQGSPTPKIEWL  115 (116)
Q Consensus        88 ~~~~~~~g~~~~l~C~~~g~P~p~i~W~  115 (116)
                      .+..+..|+++.|.|.+.+.|.|.+.|+
T Consensus         5 ~~~tv~~G~tv~L~C~v~g~~~~~v~W~   32 (95)
T cd05882           5 QDETVAVGGTVTLKCGVKEHDNSSLQWS   32 (95)
T ss_pred             ccEEEecCCcEEEEEEEeCCCCCeEEEe
Confidence            5678889999999999999999999995


No 154
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig2_Robo: domain similar to the second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antago
Probab=97.64  E-value=0.0001  Score=39.20  Aligned_cols=29  Identities=21%  Similarity=0.536  Sum_probs=25.5

Q ss_pred             CeEEEeCCCcEEEEeee-cCcCCceeEEeC
Q psy11568         88 YRFEFSNESGGRLDCAA-QGSPTPKIEWLI  116 (116)
Q Consensus        88 ~~~~~~~g~~~~l~C~~-~g~P~p~i~W~~  116 (116)
                      ....+.+|+++.|.|.+ .|.|.|.+.|+.
T Consensus         4 ~~~~~~~G~~v~l~C~~~~g~p~p~i~W~k   33 (86)
T cd05724           4 SDTQVAVGEMAVLECSPPRGHPEPTVSWRK   33 (86)
T ss_pred             ccEEEeCCCCEEEEEECCCCCCCCEEEEEE
Confidence            56778889999999998 799999999973


No 155
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)). Ig1_Necl-3: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-3, Necl-3 (also known as cell adhesion molecule 2 (CADM2), SynCAM2, IGSF4D).  Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region, belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses.  Necl-3 accumulates in central and peripheral nervous system tissue, and has been shown to selectively interact with oligodendrocytes.
Probab=97.62  E-value=0.00013  Score=39.98  Aligned_cols=28  Identities=11%  Similarity=0.362  Sum_probs=26.2

Q ss_pred             CeEEEeCCCcEEEEeeecCcCCceeEEe
Q psy11568         88 YRFEFSNESGGRLDCAAQGSPTPKIEWL  115 (116)
Q Consensus        88 ~~~~~~~g~~~~l~C~~~g~P~p~i~W~  115 (116)
                      ++..+.+|+++.|.|.+.+.|.|.+.|+
T Consensus         5 ~~v~v~eG~~v~L~C~~~~~p~~~v~W~   32 (95)
T cd07701           5 QNVTVVEGGTANLTCRVDQNDNTSLQWS   32 (95)
T ss_pred             ceEEEecCCcEEEEEEEecCCceEEEEe
Confidence            6788899999999999999999999996


No 156
>cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins. Ig1_DNAM-1_like: domain similar to the first immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226). DNAM-1 is a transmembrane protein having two Ig-like domains. It is an adhesion molecule which plays a part in tumor-directed cytotoxicity and adhesion in natural killer (NK) cells and T lymphocytes. It has been shown to regulate the NK cell killing of several tumor types, including myeloma cells and ovarian carcinoma cells. DNAM-1 interacts specifically with poliovirus receptor (PVR; CD155) and nectin -2 (CD211), other members of the Ig superfamily. DNAM-1 is expressed in most peripheral T cells, NK cells, monocytes and a subset of B lymphocytes.
Probab=97.55  E-value=0.0022  Score=35.21  Aligned_cols=29  Identities=24%  Similarity=0.271  Sum_probs=22.7

Q ss_pred             CCeEEecCCCCCCCCCCCCceEEEEEEEcC-CCceE
Q psy11568         26 NGSLMFPPFPETGFRPDVHSTVYRCRASNE-AGVIL   60 (116)
Q Consensus        26 ~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~-~g~~~   60 (116)
                      +.+|.|.+++.+      |+|.|+|...+. .|...
T Consensus        59 d~sI~i~nvt~~------D~G~Y~C~~~t~P~g~~~   88 (96)
T cd05889          59 DMSLSFNNATEE------DVGLYCCSLVTYPQGSWE   88 (96)
T ss_pred             ccEEEEcCCCcc------cCEEEEEEEEeCCCCCeE
Confidence            357999999766      999999998776 45443


No 157
>cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins. Ig_CSPGs_LP: immunoglobulin (Ig)-like domain similar to that found in chondroitin sulfate proteoglycans (CSPGs) and human cartilage link protein (LP).  Included in this group are the CSPGs aggrecan, versican, and neurocan. In CSPGs this Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggrecan and versican have a wide distribution in connective tissue and extracellular matrices. Neurocan is localized almost exclusively in nervous tissue.
Probab=97.53  E-value=0.00038  Score=38.67  Aligned_cols=34  Identities=21%  Similarity=0.248  Sum_probs=25.6

Q ss_pred             eEEecCCCCCCCCCCCCceEEEEEEEcCCCceE-EEEEEEE
Q psy11568         28 SLMFPPFPETGFRPDVHSTVYRCRASNEAGVIL-SRFVHVK   67 (116)
Q Consensus        28 ~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~-~~~~~v~   67 (116)
                      .|.|.+++.+      |+|.|.|.+.+..+... ...|.|.
T Consensus        69 sL~I~~v~~s------D~G~Y~C~v~~~~~~~~~~v~L~V~  103 (106)
T cd05714          69 SLVITDLRLE------DSGRYRCEVIDGIEDEQDTVELEVR  103 (106)
T ss_pred             eEEECCCCHH------HCEEEEEEEEcCCCceEEEEEEEEE
Confidence            7999999766      99999999998765443 2444444


No 158
>cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins. Ig1_Nectin-4_like: domain similar to the first immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor). Nectin-4 belongs to the nectin family, which is comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which participate in adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. For example nectin-4 trans-interacts with nectin-1. Nectin-4 has also been shown to interact with the actin filament-binding protein, afadin. Unlike the other nectins, which are widely expressed in adult tissues, nectin-4 is mainly expressed during embryogenesis, and is not detected in normal adult 
Probab=97.52  E-value=0.0009  Score=36.92  Aligned_cols=27  Identities=26%  Similarity=0.492  Sum_probs=22.0

Q ss_pred             CeEEecCCCCCCCCCCCCceEEEEEEEcC-CCce
Q psy11568         27 GSLMFPPFPETGFRPDVHSTVYRCRASNE-AGVI   59 (116)
Q Consensus        27 ~~l~i~~v~~~~~~~~~d~G~y~C~a~n~-~g~~   59 (116)
                      ..|.|.+++.+      |+|.|.|...+. .|..
T Consensus        64 ~sL~I~nv~~s------D~GtY~C~v~~~p~g~~   91 (100)
T cd05888          64 GALILRNAVQA------DEGKYKCRVITFPAGNF   91 (100)
T ss_pred             eEEEEecCccc------cceEEEEEEEeCCCCCe
Confidence            37999999766      999999999884 5544


No 159
>cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins. Ig2_L1-CAM_like: domain similar to the second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains, five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth.
Probab=97.52  E-value=0.00022  Score=39.09  Aligned_cols=36  Identities=19%  Similarity=0.356  Sum_probs=28.8

Q ss_pred             CceEecCCCeEEEeCCCcEEEEee-ecCcCCceeEEe
Q psy11568         80 PLFRIEPPYRFEFSNESGGRLDCA-AQGSPTPKIEWL  115 (116)
Q Consensus        80 p~~~~~~~~~~~~~~g~~~~l~C~-~~g~P~p~i~W~  115 (116)
                      |.|.....+...+.+|+.+.|.|. ..|.|.|.+.|+
T Consensus         3 ~~~~~~~~~~v~V~eG~~~~L~C~pP~g~P~P~i~W~   39 (95)
T cd05845           3 PKWPKEKIRPVEVEEGDSVVLPCNPPKSAVPLRIYWM   39 (95)
T ss_pred             CcCCccccceeEEecCCCEEEEecCCCCCCCCEEEEE
Confidence            334333346788899999999996 699999999996


No 160
>cd05883 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)). Ig2_Necl-2: second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)). Nectin-like molecules (Necls) have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. Necl-2 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is expressed in a wide variety of tissues, and is a putative tumour suppressor gene, which is downregulated in aggressive neuroblastoma. Ig domains are likely to participate in ligand binding and recognition.
Probab=97.52  E-value=0.0013  Score=35.08  Aligned_cols=49  Identities=14%  Similarity=0.237  Sum_probs=29.6

Q ss_pred             CcEEEEEccCCeeeeccccceEEeeC-----CeEEecCCCCCCCCCCCCceEEEEEEEcCC
Q psy11568          1 MYVLLWLIRDNTVIAYVKDLRIALSN-----GSLMFPPFPETGFRPDVHSTVYRCRASNEA   56 (116)
Q Consensus         1 ~p~v~W~~~~g~~~~~~~~~~~~~~~-----~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~   56 (116)
                      .++|+| +++|+++............     +.|.+. +.++     .|...|+|.|.|..
T Consensus        14 ~A~I~W-~k~~~~l~~~~~~~~~~~~~~t~~S~L~~~-p~~e-----DdG~~~~C~a~~~~   67 (82)
T cd05883          14 AATIRW-FKGNKELTGKSTVEETWSRMFTVTSQLMLK-VTKE-----DDGVPVICLVDHPA   67 (82)
T ss_pred             CCEEEE-EECCEECcCcccceeccCCCcEEEEEEEEE-Cchh-----hCCCEEEEEEcCcc
Confidence            378999 9999988642111101111     135553 3333     37789999999975


No 161
>cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP). Ig_LP_like: immunoglobulin (Ig)-like domain similar to that that found in human cartilage link protein (LP). In cartilage, chondroitin-keratan sulfate proteoglycan (CSPG), aggrecan, forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many different tissues. Members of the vertebrate HPLN (hyaluronan/HA and proteoglycan binding link) protein family are physically linked adjacent to CSPG genes.
Probab=97.52  E-value=0.00033  Score=38.91  Aligned_cols=34  Identities=15%  Similarity=0.176  Sum_probs=26.4

Q ss_pred             eEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE-EEEEEE
Q psy11568         28 SLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS-RFVHVK   67 (116)
Q Consensus        28 ~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~-~~~~v~   67 (116)
                      .|.|.++..+      |+|.|.|...+..+.... ..|.|.
T Consensus        69 sL~I~~v~~~------DsG~Y~C~v~~~~~~~~~~~~l~v~  103 (106)
T cd05877          69 SLVITDLRLE------DYGRYRCEVIDGLEDESVVVALRLR  103 (106)
T ss_pred             EEEEccCChH------HCEEEEEEEEecccceEEEEEEEEE
Confidence            6999999665      999999999988776553 455554


No 162
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1). Ig2_FGFRL1-like: second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1). FGFRL1 is comprised of a signal peptide, three extracellular Ig-like modules, a transmembrane segment, and a short intracellular domain. FGFRL1 is expressed preferentially in skeletal tissues. Similar to FGF receptors, the expressed protein interacts specifically with heparin and with FGF2.  FGFRL1 does not have a protein tyrosine kinase domain at its C terminus; neither does its cytoplasmic domain appear to interact with a signaling partner. It has been suggested that FGFRL1 may not have any direct signaling function, but instead acts as a decoy receptor trapping FGFs and preventing them from binding other receptors.
Probab=97.50  E-value=0.00015  Score=38.13  Aligned_cols=26  Identities=42%  Similarity=0.808  Sum_probs=22.9

Q ss_pred             EEEeCCCcEEEEeeecCcCCceeEEe
Q psy11568         90 FEFSNESGGRLDCAAQGSPTPKIEWL  115 (116)
Q Consensus        90 ~~~~~g~~~~l~C~~~g~P~p~i~W~  115 (116)
                      .....|+.+.|.|.+.|.|.|.++|+
T Consensus         4 ~~~~~G~~v~L~C~~~g~p~p~i~W~   29 (82)
T cd05856           4 IARPVGSSVRLKCVASGNPRPDITWL   29 (82)
T ss_pred             eeccCCCeEEEEEEeeEeCCCcEEEE
Confidence            34566999999999999999999997


No 163
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs) and similar proteins. Ig1_FcgammaR_like: domain similar to the first immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs). Interactions between IgG and FcgammaR are important to the initiation of cellular and humoral response. IgG binding to FcgammaR leads to a cascade of signals and ultimately to functions such as antibody-dependent-cellular-cytotoxicity (ADCC), endocytosis, phagocytosis, release of inflammatory mediators, etc. FcgammaR has two Ig-like domains. This group also contains FcepsilonRI, which binds IgE with high affinity.
Probab=97.49  E-value=0.00037  Score=36.76  Aligned_cols=29  Identities=17%  Similarity=0.257  Sum_probs=24.9

Q ss_pred             CeEEEeCCCcEEEEeeecCcCC-ceeEEeC
Q psy11568         88 YRFEFSNESGGRLDCAAQGSPT-PKIEWLI  116 (116)
Q Consensus        88 ~~~~~~~g~~~~l~C~~~g~P~-p~i~W~~  116 (116)
                      ....+.+|+++.|.|.+.+.|. +.+.|+.
T Consensus         8 ~~~~v~~G~~V~L~C~~~~~p~~~~~~W~k   37 (78)
T cd05752           8 PWTTIFQGEKVTLTCNGFNSPEQNSTQWYH   37 (78)
T ss_pred             CCeEeeCCCCEEEEEeCCCCCCCccEEEEE
Confidence            6778889999999999999886 4699973


No 164
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins. Ig3_Perlecan_like: domain similar to the third immunoglobulin (Ig)-like domain found in Perlecan. Perlecan is a large multi-domain heparin sulfate proteoglycan, important in tissue development and organogenesis.  Perlecan can be represented as 5 major portions; its fourth major portion (domain IV) is a tandem repeat of immunoglobulin-like domains (Ig2-Ig15), which can vary in size due to alternative splicing. Perlecan binds many cellular and extracellular ligands. Its domain IV region has many binding sites.  Some of these have been mapped at the level of individual Ig-like domains, including a site restricted to the Ig5 domain for heparin/sulfatide, a site restricted to the Ig3 domain for nidogen-1 and nidogen-2, a site restricted to Ig4-5 for fibronectin, and sites restricted to Ig2 and to Ig13-15 for fibulin-2.
Probab=97.47  E-value=0.00043  Score=36.86  Aligned_cols=30  Identities=23%  Similarity=0.408  Sum_probs=25.5

Q ss_pred             CCCeEEEeCCCcEEEEeeecC-cCCceeEEe
Q psy11568         86 PPYRFEFSNESGGRLDCAAQG-SPTPKIEWL  115 (116)
Q Consensus        86 ~~~~~~~~~g~~~~l~C~~~g-~P~p~i~W~  115 (116)
                      ++....+..|+++.|.|.+.+ .|.|.+.|+
T Consensus         7 ~p~~~~v~~G~~v~L~C~~~~~~~~~~i~W~   37 (85)
T cd05754           7 EPRSQEVRPGADVSFICRAKSKSPAYTLVWT   37 (85)
T ss_pred             CCCceEEcCCCCEEEEEEcCCCCCCcEEEEE
Confidence            346778888999999999975 789999996


No 165
>cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)). Ig1_Necl-2: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-2, Necl-2 (also known as cell adhesion molecule 1 (CADM1), SynCAM1, IGSF4A, Tslc1, sgIGSF, and RA175).  Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region, belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-2 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-2 is expressed in a wide variety of tissues, and is a 
Probab=97.45  E-value=0.0017  Score=35.58  Aligned_cols=23  Identities=9%  Similarity=0.239  Sum_probs=19.7

Q ss_pred             eEEecCCCCCCCCCCCCceEEEEEEEcCC
Q psy11568         28 SLMFPPFPETGFRPDVHSTVYRCRASNEA   56 (116)
Q Consensus        28 ~l~i~~v~~~~~~~~~d~G~y~C~a~n~~   56 (116)
                      +|.|.++..+      |+|.|.|.+....
T Consensus        63 tL~I~~vq~~------D~G~Y~Cqv~t~p   85 (95)
T cd05881          63 RVSLSNVSLS------DEGRYFCQLYTDP   85 (95)
T ss_pred             EEEECcCCcc------cCEEEEEEEEccc
Confidence            5999999666      9999999998754


No 166
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha. IG4_PDGFR-alpha: The fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha. PDGF is a potent mitogen for connective tissue cells. PDGF-stimulated processes are mediated by three different PDGFs (PDGF-A,-B, and C). PDGFR alpha binds to all three PDGFs, whereas the PDGFR beta (not included in this group) binds only to PDGF-B. PDGF alpha is organized as an extracellular component having five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. In mice, PDGFR alpha and PDGFR beta are essential for normal development.
Probab=97.44  E-value=0.00024  Score=39.36  Aligned_cols=28  Identities=18%  Similarity=0.233  Sum_probs=25.1

Q ss_pred             CeEEEeCCCcEEEEeeecCcCCceeEEe
Q psy11568         88 YRFEFSNESGGRLDCAAQGSPTPKIEWL  115 (116)
Q Consensus        88 ~~~~~~~g~~~~l~C~~~g~P~p~i~W~  115 (116)
                      ....+..|+.+.|.|.+.|.|+|.++|+
T Consensus        11 ~~~~~~~~~~~~l~~~v~g~P~P~v~W~   38 (101)
T cd05859          11 QLEFANLHEVKEFVVEVEAYPPPQIRWL   38 (101)
T ss_pred             ceEEEecCCcEEEEEEEEEeCCCceEEE
Confidence            3567778999999999999999999997


No 167
>cd05761 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-4 (also known as cell adhesion molecules CADM3, CADM1, CADM2, and CADM4, respectively). Ig2_Necl-1-4_like: domain similar to the second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 (also known as cell adhesion molecule 3 (CADM3)), Necl-2 (CADM1), Necl-3 (CADM2) and Necl-4 (CADM4). These nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1 and Necl-2 have Ca(2+)-independent homophilic and heterophilic cell-cel
Probab=97.41  E-value=0.001  Score=35.34  Aligned_cols=48  Identities=21%  Similarity=0.265  Sum_probs=27.7

Q ss_pred             cEEEEEccCCeeeeccccceEEe-eCC------eEEecCCCCCCCCCCCCceEEEEEEEcCCC
Q psy11568          2 YVLLWLIRDNTVIAYVKDLRIAL-SNG------SLMFPPFPETGFRPDVHSTVYRCRASNEAG   57 (116)
Q Consensus         2 p~v~W~~~~g~~~~~~~~~~~~~-~~~------~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g   57 (116)
                      +.|+| +++|+++.... ..... .++      .|.+....      ..+.+.|+|.+.+...
T Consensus        15 ~~v~W-~~~~~~l~~~~-~~~~~~~~~~~~~~s~l~~~~~~------~d~g~~~~C~v~h~~l   69 (82)
T cd05761          15 ATIRW-FKGDKELKGVK-LKEEDENGKTFTVTSSLRFQVDR------EDDGAPIICRVDHPAL   69 (82)
T ss_pred             CeEEE-EECCEEccCce-eeEecCCCCEEEEEEEEEEEcch------hhCCCEEEEEEeChhc
Confidence            68999 99999886321 11111 122      23332222      2256799999999853


No 168
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM). Ig_CEACAM_D4:  immunoglobulin (Ig)-like domain 4 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surface. This family corresponds to the
Probab=97.41  E-value=0.00036  Score=37.89  Aligned_cols=27  Identities=22%  Similarity=0.353  Sum_probs=25.0

Q ss_pred             CeEEEeCCCcEEEEeeecCcCCceeEEe
Q psy11568         88 YRFEFSNESGGRLDCAAQGSPTPKIEWL  115 (116)
Q Consensus        88 ~~~~~~~g~~~~l~C~~~g~P~p~i~W~  115 (116)
                      ++..+.+|+.+.|.|.+.|. .|.++|+
T Consensus        11 ~~~~v~~g~~v~l~C~a~g~-~p~i~W~   37 (91)
T cd05740          11 GNQPPEDNQPVTLTCEAEGQ-ATYIWWV   37 (91)
T ss_pred             CccccccCCcEEEEEEeCCC-CCEEEEE
Confidence            67788899999999999999 9999997


No 169
>cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan. Ig_Aggrecan: immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan. These aggregates contribute to the tissue's load bearing properties. In CSPGs, the Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Aggrecan has a wide distribution in connective tissue and extracellular matrices. Members of the vertebrate HPLN (hyaluronan/HA and proteoglycan binding link) protein family are physically linked adjacent to CSPG genes.
Probab=97.40  E-value=0.0032  Score=35.59  Aligned_cols=25  Identities=20%  Similarity=0.399  Sum_probs=21.1

Q ss_pred             CeEEecCCCCCCCCCCCCceEEEEEEEcCCC
Q psy11568         27 GSLMFPPFPETGFRPDVHSTVYRCRASNEAG   57 (116)
Q Consensus        27 ~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g   57 (116)
                      .+|.|.+++.+      |+|.|.|...+...
T Consensus        74 asL~I~nl~~s------DsG~Y~C~V~~g~~   98 (112)
T cd05900          74 ATLEITELRSN------DSGTYRCEVMHGIE   98 (112)
T ss_pred             cEEEEeecccc------cCEEEEEEEecCCC
Confidence            37999999766      99999999997653


No 170
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin. Ig8_hNephrin_like: domain similar to the eighth immunoglobulin-like domain in human nephrin. Nephrin is an integral component of the slit diaphragm, and is a central component of the glomerular ultrafilter. Nephrin plays a structural role, and has a role in signaling. Nephrin is a transmembrane protein having a short intracellular portion, and an extracellular portion comprised of eight Ig-like domains, and one fibronectin type III-like domain. The extracellular portions of nephrin, from neighboring foot processes of separate podocyte cells, may interact with each other, and in association with other components of the slit diaphragm, form a porous molecular sieve within the slit pore.  The intracellular portion of nephrin is associated with linker proteins, which connect nephrin to the actin cytoskeleton. The intracellular portion is tyrosine phosphorylated, and mediates signaling from the slit diaphragm into the p
Probab=97.40  E-value=0.0004  Score=38.97  Aligned_cols=36  Identities=33%  Similarity=0.550  Sum_probs=25.6

Q ss_pred             CceEecCCCeEEEe---CCCcEEEEeeecCcCCceeEEe
Q psy11568         80 PLFRIEPPYRFEFS---NESGGRLDCAAQGSPTPKIEWL  115 (116)
Q Consensus        80 p~~~~~~~~~~~~~---~g~~~~l~C~~~g~P~p~i~W~  115 (116)
                      |.+...+.....+.   .|+.+.|.|.+.|.|.|.++|+
T Consensus         5 P~~~~~~~~~~~~~~~~~g~~v~L~C~a~G~P~p~i~W~   43 (109)
T cd05773           5 PDLQKGPQLRKVASRGDGSSDANLVCQAQGVPRVQFRWA   43 (109)
T ss_pred             cccccCCceEEEEEecCCCCEEEEEEECcccCCCEEEEE
Confidence            55555542222222   3678999999999999999997


No 171
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins. Ig1_LILRB1_like: domain similar to the first immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1). This group includes, LILRA5 (LIR9), an activating natural cytotoxicity receptor NKp46, and the immune-type receptor glycoprotein VI (GPVI). LILRs are a family of immunoreceptors expressed on expressed on T and B cells, on monocytes, dendritic cells, and subgroups of natural killer (NK) cells. The human LILR family contains nine proteins (LILRA1-3,and 5, and LILRB1-5). From functional assays, and as the cytoplasmic domains of various LILRs, for example LILRB1 (LIR-1), LILRB2 (LIR-2), and LILRB3 (LIR-3) contain immunoreceptor tyrosine-based inhibitory motifs (ITIMs) it is thought that LIR proteins are inhibitory receptors. Of the eight LIR family proteins, only LIR-1(LILRB1), and LIR-2 (LILRB2),
Probab=97.36  E-value=0.00028  Score=38.25  Aligned_cols=24  Identities=21%  Similarity=0.535  Sum_probs=20.0

Q ss_pred             CeEEecCCCCCCCCCCCCceEEEEEEEcCC
Q psy11568         27 GSLMFPPFPETGFRPDVHSTVYRCRASNEA   56 (116)
Q Consensus        27 ~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~   56 (116)
                      ..+.|.+++.+      |+|.|+|.+.+..
T Consensus        53 ~~f~i~~v~~~------~~G~Y~C~~~~~~   76 (91)
T cd05751          53 AKFFIPSMKRE------HAGRYRCYYRSGV   76 (91)
T ss_pred             EEEEccCCChh------HCEEEEEEEECCC
Confidence            36889999665      9999999999863


No 172
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2. Ig1_NCAM-2:  first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 (OCAM/mamFas II, RNCAM). NCAM-2  is organized similarly to NCAM , including five N-terminal Ig-like domains and two fibronectin type III domains. NCAM-2 is differentially expressed in the developing and mature olfactory epithelium (OE), and may function like NCAM, as an adhesion molecule.
Probab=97.32  E-value=0.00052  Score=37.36  Aligned_cols=27  Identities=30%  Similarity=0.641  Sum_probs=24.5

Q ss_pred             CeEEEeCCCcEEEEeeecCcCCceeEEe
Q psy11568         88 YRFEFSNESGGRLDCAAQGSPTPKIEWL  115 (116)
Q Consensus        88 ~~~~~~~g~~~~l~C~~~g~P~p~i~W~  115 (116)
                      .+..+..|+++.|.|.+.|.|. .+.|+
T Consensus         8 ~~~~v~~G~~v~l~C~~~G~P~-~v~W~   34 (92)
T cd05866           8 SKVELSVGESKFFTCTAIGEPE-SIDWY   34 (92)
T ss_pred             cceEEcCCCeEEEEEEEEEeCC-eEEEE
Confidence            6677888999999999999998 89997


No 173
>KOG3515|consensus
Probab=97.32  E-value=0.0004  Score=50.48  Aligned_cols=74  Identities=20%  Similarity=0.275  Sum_probs=47.2

Q ss_pred             eEEecCCCCCCCCCCCCceEEEEEEEcCCC--ceE--EEEEEEEeCcEeeeeccCCCceEecCCCeEEEeCCCcEEEEee
Q psy11568         28 SLMFPPFPETGFRPDVHSTVYRCRASNEAG--VIL--SRFVHVKAGSVVSLLDIQGPLFRIEPPYRFEFSNESGGRLDCA  103 (116)
Q Consensus        28 ~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g--~~~--~~~~~v~~~~~~~~~~~~~p~~~~~~~~~~~~~~g~~~~l~C~  103 (116)
                      .+.+...+.+      +.|+|+|.|.|...  ...  ...+.+.++ +       ....+........+.+|+.+.|.|.
T Consensus       164 ~l~~~v~Rka------~~g~~tC~A~nr~s~~l~~~~~~~i~v~~~-~-------~~~~~~~~~~~qsF~~g~~inlvc~  229 (741)
T KOG3515|consen  164 LLKQTVSRKA------DNGNYTCPANNRNSPGLSFAKQLTIIVEAP-C-------KGIGITGAQEQQSFTEGQTINLVCN  229 (741)
T ss_pred             ceeeEEEEec------CCceeEcccccccCccccccceeEeecccc-c-------ccceecchhhcCcccccceEEEEeh
Confidence            4556555444      99999999999632  222  233444442 0       1233333333467788999999997


Q ss_pred             ecC-cCCceeEEe
Q psy11568        104 AQG-SPTPKIEWL  115 (116)
Q Consensus       104 ~~g-~P~p~i~W~  115 (116)
                      +.+ +|.+.++|+
T Consensus       230 ~~gg~P~~~~~w~  242 (741)
T KOG3515|consen  230 AQGGNPSQQQTWY  242 (741)
T ss_pred             hhcCCcchhhhhc
Confidence            754 799999996


No 174
>cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG). Ig_Aggrecan_like: immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG)s. Included in this group are the Ig domains of other CSPGs: versican, and neurocan. In CSPGs this Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggrecan and versican have a wide distribution in connective tissue and extracellular matrices. Neurocan is localized almost exclusively in nervous tissue. Aggregates having other CSPGs substi
Probab=97.26  E-value=0.005  Score=34.58  Aligned_cols=33  Identities=24%  Similarity=0.288  Sum_probs=24.0

Q ss_pred             eEEecCCCCCCCCCCCCceEEEEEEEcCCCceE-EEEEEE
Q psy11568         28 SLMFPPFPETGFRPDVHSTVYRCRASNEAGVIL-SRFVHV   66 (116)
Q Consensus        28 ~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~-~~~~~v   66 (116)
                      .|.|.+++.+      |+|.|.|.......... ...|.|
T Consensus        73 sL~I~~l~~s------D~G~Y~C~v~~~~~~~~~~v~l~V  106 (110)
T cd05878          73 SLEISRLRSS------DSGVYRCEVMHGIEDEQDTVPLEV  106 (110)
T ss_pred             EEEECCCChh------hCEEEEEEEEeCCCcceEEEEEEE
Confidence            6999999766      99999999988653333 244444


No 175
>cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2). Ig5_KIRREL3: the fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1). These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development. Neph1 and 2 may mediate axonal guidance and synapse formation in certain areas of the CNS. In the kidney, they participate in the formation of the slit diaphragm.
Probab=97.21  E-value=0.0015  Score=36.00  Aligned_cols=28  Identities=21%  Similarity=0.504  Sum_probs=23.8

Q ss_pred             CeEEEeCCCcEEEEeeecCcCCc-eeEEe
Q psy11568         88 YRFEFSNESGGRLDCAAQGSPTP-KIEWL  115 (116)
Q Consensus        88 ~~~~~~~g~~~~l~C~~~g~P~p-~i~W~  115 (116)
                      ....+.+|+++.|.|.+.+.|+| .|.|.
T Consensus         9 ~s~~~~~G~~~~L~C~~~s~P~P~~i~W~   37 (98)
T cd05898           9 QVQYAVRGERGKVKCFIGSTPPPDRIAWA   37 (98)
T ss_pred             ceEEEeCCCcEEEEEEEccCCCCcEEEEE
Confidence            67888899999999999998988 45674


No 176
>cd07705 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)). Ig2_Necl-1: second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)). These nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1 and Necl-2 have Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue and is important to the formation of synapses, axon bundles, and myel
Probab=97.17  E-value=0.0018  Score=34.54  Aligned_cols=51  Identities=10%  Similarity=0.177  Sum_probs=28.1

Q ss_pred             cEEEEEccCCeeeeccccceEEeeC-CeEEecC-C--CCCCCCCCCCceEEEEEEEcCC
Q psy11568          2 YVLLWLIRDNTVIAYVKDLRIALSN-GSLMFPP-F--PETGFRPDVHSTVYRCRASNEA   56 (116)
Q Consensus         2 p~v~W~~~~g~~~~~~~~~~~~~~~-~~l~i~~-v--~~~~~~~~~d~G~y~C~a~n~~   56 (116)
                      +.|+| ++||+++...........+ ++..+.. +  ...   ...|...|+|.+.+..
T Consensus        15 ~~ItW-~k~g~~l~~~~~~~~~~~~~~t~~~~s~l~~~~~---~~d~g~~~tC~v~h~~   69 (83)
T cd07705          15 ANIKW-RKGDQELEGAPTSVLEDGNGKTFTVSSSVEFQVT---REDDGAEITCSVGHES   69 (83)
T ss_pred             CEeEE-EECCEECCCcceeEEECCCCCEEEEEEEEEEEec---chhCCCEEEEEEECcc
Confidence            58999 9999987642211111222 2322211 1  011   1236789999999985


No 177
>cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin. Ig_Semaphorin_C; Immunoglobulin (Ig)-like domain in semaphorins. Semaphorins are transmembrane protein that have important roles in a variety of tissues. Functionally, semaphorins were initially characterized for their importance in the development of the nervous system and in axonal guidance. Later they have been found to be important for the formation and functioning of the cardiovascular, endocrine, gastrointestinal, hepatic, immune, musculoskeletal, renal, reproductive, and respiratory systems. Semaphorins function through binding to their receptors and transmembrane semaphorins also serves as receptors themselves. Although molecular mechanism of semaphorins is poorly understood, the Ig-like domains may involve in ligand binding or dimerization.
Probab=97.17  E-value=0.00088  Score=35.97  Aligned_cols=28  Identities=14%  Similarity=0.359  Sum_probs=24.2

Q ss_pred             CeEEEeCCCcEEEEeeecCcCCceeEEeC
Q psy11568         88 YRFEFSNESGGRLDCAAQGSPTPKIEWLI  116 (116)
Q Consensus        88 ~~~~~~~g~~~~l~C~~~g~P~p~i~W~~  116 (116)
                      ....+..|+.+.|.|.+.+ |.+.+.|+.
T Consensus         4 ~~~~v~~g~~v~L~C~~~~-p~~~i~W~k   31 (89)
T cd04979           4 KVVTVVEGNSVFLECSPKS-NLASVVWLF   31 (89)
T ss_pred             eEEEEECCCcEEEEEeCCC-CCceEEEEE
Confidence            5667788999999999987 889999973


No 178
>cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D. Ig_Sema4D_like; Immunoglobulin (Ig)-like domain of Sema4D. Sema4D is a Class IV semaphorin. Semaphorins are classified based on structural features additional to the Sema domain. Sema4D has extracellular Sema and Ig domains, a transmembrane domain, and a short cytoplasmic domain. Sema4D plays a part in the development of GABAergic synapses. Sema4D in addition is an immune semaphorin. It is abundant on resting T cells; its expression is weak on resting B cells and antigen presenting cells (APCs), but is upregulated by various stimuli. The receptor used by Sema4D in the immune system is CD72. Sem4D enhances the activation of B cells and DCs through binding CD72, perhaps by reducing CD72s inhibitory signals. The receptor used by Sema4D in the non-lymphatic tissues is plexin-B1. Sem4D is anchored to the cell surface but its extracellular domain can be released from the cell surface by a metalloproteas
Probab=97.15  E-value=0.00098  Score=35.95  Aligned_cols=28  Identities=14%  Similarity=0.433  Sum_probs=23.9

Q ss_pred             CeEEEeCCCcEEEEeeecCcCCceeEEeC
Q psy11568         88 YRFEFSNESGGRLDCAAQGSPTPKIEWLI  116 (116)
Q Consensus        88 ~~~~~~~g~~~~l~C~~~g~P~p~i~W~~  116 (116)
                      ....+..|+++.|.|.+.+ |.|.++|++
T Consensus         4 ~~~~v~~G~~v~L~C~~~~-~~~~i~W~~   31 (87)
T cd05873           4 RQRTFKLGNNAELKCSPKS-NLARVVWKF   31 (87)
T ss_pred             ceEEEECCCCEEEEEECCC-CCCeEEEEE
Confidence            6778889999999999864 788999974


No 179
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins. Ig1_NCAM-1 like: first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. NCAM-1 plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-nonNCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves the Ig1, Ig2, and Ig3 domains. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the s
Probab=97.14  E-value=0.0013  Score=35.73  Aligned_cols=27  Identities=26%  Similarity=0.454  Sum_probs=23.7

Q ss_pred             CeEEEeCCCcEEEEeeecCcCCceeEEe
Q psy11568         88 YRFEFSNESGGRLDCAAQGSPTPKIEWL  115 (116)
Q Consensus        88 ~~~~~~~g~~~~l~C~~~g~P~p~i~W~  115 (116)
                      ....+..|+++.|.|.+.|.| +.++|+
T Consensus         8 ~~~~v~~G~~~~l~C~~~G~p-~~i~W~   34 (92)
T cd04977           8 SQGEISVGESKFFLCQVIGEP-KDISWF   34 (92)
T ss_pred             CcEEECCCCeEEEEEEeEeeC-CeEEEE
Confidence            557788899999999999997 499997


No 180
>cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0). Ig_P0ex: immunoglobulin (Ig) domain of Protein zero (P0). P0 accounts for over 50% of the total protein in peripheral nervous system (PNS) myelin. P0 is a single-pass transmembrane glycoprotein with a highly basic intracellular domain and an Ig domain.  The extracellular domain of P0 (P0-ED) is similar to the Ig variable domain, carrying one acceptor sequence for N-linked glycosylation. P0 plays a role in membrane adhesion in the spiral wraps of the myelin sheath. The intracellular domain is thought to mediate membrane apposition of the cytoplasmic faces and may, through electrostatic interactions, interact directly with lipid headgroups. It is thought that homophilic interactions of the P0 extracellular domain mediate membrane juxtaposition in the extracellular space of PNS myelin.
Probab=97.10  E-value=0.0016  Score=37.06  Aligned_cols=24  Identities=17%  Similarity=0.375  Sum_probs=21.1

Q ss_pred             eEEecCCCCCCCCCCCCceEEEEEEEcCCC
Q psy11568         28 SLMFPPFPETGFRPDVHSTVYRCRASNEAG   57 (116)
Q Consensus        28 ~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g   57 (116)
                      ++.|.+++.+      |.|.|+|...|..+
T Consensus        81 SI~I~nv~~s------D~G~Y~C~v~n~p~  104 (116)
T cd05879          81 SIVIHNLDYT------DNGTFTCDVKNPPD  104 (116)
T ss_pred             EEEEccCCcc------cCEEEEEEEEcCCC
Confidence            7999999766      99999999999854


No 181
>cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins. Ig1_IL1R_like: domain similar to the first immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R). IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three Ig-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta.
Probab=97.07  E-value=0.00093  Score=36.50  Aligned_cols=29  Identities=14%  Similarity=0.184  Sum_probs=25.0

Q ss_pred             CeEEEeCCCcEEEEeeecC-----cCCceeEEeC
Q psy11568         88 YRFEFSNESGGRLDCAAQG-----SPTPKIEWLI  116 (116)
Q Consensus        88 ~~~~~~~g~~~~l~C~~~g-----~P~p~i~W~~  116 (116)
                      ....+.+|+.+.|.|.+.|     .|.|.++|+.
T Consensus         7 ~~~~v~~G~~~~L~C~~~g~~~~~~p~~~v~Wyk   40 (94)
T cd05756           7 KKSYVLEGEPVVIKCPLFYSYIAQSPGLNLTWYK   40 (94)
T ss_pred             eEEEEecCCCeEEECCCCCcccccCCCceEEEEE
Confidence            4566778999999999999     7999999973


No 182
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively). Ig1_Necl-1-3_like:  N-terminal immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 (also known as cell adhesion molecule 3 (CADM3)), Necl-2 (CADM1), and Necl-3 (CADM2). At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1, Necl-2, and Necl-3 have Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue, and is important to the form
Probab=97.03  E-value=0.0017  Score=35.32  Aligned_cols=28  Identities=11%  Similarity=0.382  Sum_probs=25.4

Q ss_pred             CeEEEeCCCcEEEEeeecCcCCceeEEe
Q psy11568         88 YRFEFSNESGGRLDCAAQGSPTPKIEWL  115 (116)
Q Consensus        88 ~~~~~~~g~~~~l~C~~~g~P~p~i~W~  115 (116)
                      +...+.+|+++.|.|.+.+.|.+.+.|+
T Consensus         5 ~~~~v~~G~~v~L~C~~~~~~~~~v~W~   32 (95)
T cd05717           5 QDVTVVEGGTATLKCRVKNNDNSSLQWS   32 (95)
T ss_pred             CcEEEcCCCCEEEEEEECCCCCceEEEe
Confidence            5678889999999999999999999996


No 183
>cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican. Ig_Versican: immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican. In CSPGs, the Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, the CSPG aggrecan (not included in this group) forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Like aggrecan, versican has a wide distribution in connective tissue and extracellular matrices. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many different tissues. Members of the vertebrate HPLN (hyaluronan/HA
Probab=97.02  E-value=0.0044  Score=35.31  Aligned_cols=34  Identities=21%  Similarity=0.294  Sum_probs=25.2

Q ss_pred             eEEecCCCCCCCCCCCCceEEEEEEEcCCCceE-EEEEEEE
Q psy11568         28 SLMFPPFPETGFRPDVHSTVYRCRASNEAGVIL-SRFVHVK   67 (116)
Q Consensus        28 ~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~-~~~~~v~   67 (116)
                      +|.|.+++..      |+|.|.|.......... ...|.|.
T Consensus        80 sL~i~~v~~s------D~G~Y~C~V~~g~~~~~~~v~L~V~  114 (117)
T cd05901          80 SLTIVKLRAS------DAGVYRCEVMHGIEDTQDTVSLDVS  114 (117)
T ss_pred             EEEEcccccc------cCEEEEEEEEECCcccEEEEEEEEE
Confidence            7999999766      99999999988764444 2444443


No 184
>cd00098 IgC Immunoglobulin Constant domain. IgC: Immunoglobulin constant domain (IgC). Members of the IgC family are components of immunoglobulin, T-cell receptors, CD1 cell surface glycoproteins, secretory glycoproteins A/C, and Major Histocompatibility Complex (MHC) class I/II molecules. In immunoglobulins, each chain is composed of one variable domain (IgV) and one or more IgC domains. These names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. The IgV domain is responsible for antigen binding, and the IgC domain is involved in oligomerization and molecular interactions.
Probab=96.98  E-value=0.00074  Score=36.57  Aligned_cols=49  Identities=16%  Similarity=0.325  Sum_probs=29.0

Q ss_pred             cEEEEEccCCeeeecccc--ceEEeeCCe------EEecCCCCCCCCCCCCceEEEEEEEcCCC
Q psy11568          2 YVLLWLIRDNTVIAYVKD--LRIALSNGS------LMFPPFPETGFRPDVHSTVYRCRASNEAG   57 (116)
Q Consensus         2 p~v~W~~~~g~~~~~~~~--~~~~~~~~~------l~i~~v~~~~~~~~~d~G~y~C~a~n~~g   57 (116)
                      +.|+| ++||.++.....  ......+++      |.+....      ..|.|.|.|.+.+...
T Consensus        30 ~~i~W-~~~g~~~~~~~~~~~~~~~~~gt~~~~s~l~v~~~~------~~~~~~y~C~v~h~~~   86 (95)
T cd00098          30 ITVTW-LKNGKELTSGVTTTPPVPNSDGTYSVSSQLTVSPSD------WNSGDTYTCVVTHESL   86 (95)
T ss_pred             cEEEE-EECCEECCCceeccccccCCCCCEEEEEEEEECHHH------hCCCCCEEEEEEeCCC
Confidence            47899 899998864221  111222332      3332221      1389999999999753


No 185
>cd00096 Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of this group are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as, T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as, butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=96.96  E-value=0.0023  Score=31.41  Aligned_cols=48  Identities=19%  Similarity=0.298  Sum_probs=30.1

Q ss_pred             cEEEEEccCCeeeecccc------ceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCC
Q psy11568          2 YVLLWLIRDNTVIAYVKD------LRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEA   56 (116)
Q Consensus         2 p~v~W~~~~g~~~~~~~~------~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~   56 (116)
                      +.+.| ++++........      .........|.|.++...      |.|.|.|.+.+..
T Consensus        13 ~~~~W-~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~------d~g~y~C~~~~~~   66 (74)
T cd00096          13 PTITW-LKNGKPLPSSVLTRVRSSRGTSSGSSTLTISNVTLE------DSGTYTCVASNSA   66 (74)
T ss_pred             CcEEE-EECCEECCCcccEEeccccCcceeEEEEEECccCcc------cCcEEEEEEecCc
Confidence            56889 666655432110      011122336888888655      9999999998876


No 186
>cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan. Ig_Neurocan: immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan. In CSPGs, the Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, the CSPG aggrecan (not included in this group) forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Unlike aggrecan which is widely distributed in connective tissue and extracellular matrices, neurocan is localized almost exclusively in nervous tissue. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many differen
Probab=96.96  E-value=0.0089  Score=33.67  Aligned_cols=23  Identities=26%  Similarity=0.430  Sum_probs=20.2

Q ss_pred             eEEecCCCCCCCCCCCCceEEEEEEEcCC
Q psy11568         28 SLMFPPFPETGFRPDVHSTVYRCRASNEA   56 (116)
Q Consensus        28 ~l~i~~v~~~~~~~~~d~G~y~C~a~n~~   56 (116)
                      +|.|.+++.+      |+|.|.|......
T Consensus        73 sL~i~nv~~~------D~G~Y~C~v~~g~   95 (110)
T cd05902          73 SLVLSRLRYS------DSGTYRCEVVLGI   95 (110)
T ss_pred             EEEECCCCHH------HCEEEEEEEEECC
Confidence            7999999766      9999999998865


No 187
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Ig1_FGFR: The first immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for all FGFs.
Probab=96.95  E-value=0.0021  Score=33.74  Aligned_cols=27  Identities=15%  Similarity=0.305  Sum_probs=23.1

Q ss_pred             CeEEEeCCCcEEEEeeecCcCCceeEEe
Q psy11568         88 YRFEFSNESGGRLDCAAQGSPTPKIEWL  115 (116)
Q Consensus        88 ~~~~~~~g~~~~l~C~~~g~P~p~i~W~  115 (116)
                      ....+..|+.+.|.|.+.+. .|.+.|+
T Consensus         2 ~~~~~~~G~~v~l~C~~~~~-~~~v~W~   28 (79)
T cd04973           2 ESYSAHPGDLLQLRCRLRDD-VQSINWT   28 (79)
T ss_pred             CcEEecCCCCEEEEEEecCC-CceEEEe
Confidence            45677889999999999996 5789997


No 188
>PHA02633 hypothetical protein; Provisional
Probab=96.94  E-value=0.004  Score=31.20  Aligned_cols=37  Identities=14%  Similarity=0.154  Sum_probs=25.2

Q ss_pred             CCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceE-EEEEEEEe
Q psy11568         26 NGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVIL-SRFVHVKA   68 (116)
Q Consensus        26 ~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~-~~~~~v~~   68 (116)
                      +..|.|-+...+      |+|.|.|..+|.--... +..+.|..
T Consensus        17 ~~nLwilpa~~s------DSGiYiC~~rn~t~c~~~si~l~V~~   54 (63)
T PHA02633         17 CNNMLILNPTQS------DSGIYMCITKNETYSDMMKFDLCICL   54 (63)
T ss_pred             cccEEEeccccc------cCcEEEEEEcCCCeeEEEEEEEEEee
Confidence            347888888655      99999999998743322 45555543


No 189
>PF07354 Sp38:  Zona-pellucida-binding protein (Sp38);  InterPro: IPR010857 This family contains a number of zona-pellucida-binding proteins that seem to be restricted to mammals. These are sperm proteins that bind to the 90 kDa family of zona pellucida glycoproteins in a calcium-dependent manner []. These represent some of the specific molecules that mediate the first steps of gamete interaction, allowing fertilisation to occur [].; GO: 0007339 binding of sperm to zona pellucida, 0005576 extracellular region
Probab=96.89  E-value=0.0024  Score=40.98  Aligned_cols=48  Identities=25%  Similarity=0.366  Sum_probs=35.5

Q ss_pred             cEEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCC
Q psy11568          2 YVLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEA   56 (116)
Q Consensus         2 p~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~   56 (116)
                      |...|...+|+.+... ..-...+.|.|.+.+....      ++|.|+|......
T Consensus        13 P~y~W~GP~g~~l~gn-~~~nIT~TG~L~~~~F~es------mSG~YTCtLsYk~   60 (271)
T PF07354_consen   13 PTYLWTGPNGKPLSGN-SYVNITETGKLMFKNFQES------MSGSYTCTLSYKP   60 (271)
T ss_pred             CceEEECCCCcccCCC-CeEEEccCceEEeeccccc------cCCceEEEEEEEe
Confidence            7889977778877631 2223456678999999665      9999999977653


No 190
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins. Ig2_FGFR_like: domain similar to the second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. FGF receptors bind FGF signaling polypeptides. FGFs participate in multiple processes such as morphogenesis, development, and angiogenesis. FGFs bind to four FGF receptor tyrosine kinases (FGFR1, -2, -3, -4). Receptor diversity is controlled by alternative splicing producing splice variants with different ligand binding characteristics and different expression patterns. FGFRs have an extracellular region comprised of three Ig-like domains, a single transmembrane helix, and an intracellular tyrosine kinase domain. Ligand binding and specificity reside in the Ig-like domains 2 and 3, and the linker region that connects these two. FGFR activation and signaling depend on FGF-induced dimerization, a process involving cell surface heparin or heparin 
Probab=96.86  E-value=0.0025  Score=33.45  Aligned_cols=26  Identities=42%  Similarity=0.838  Sum_probs=22.8

Q ss_pred             EEEeCCCcEEEEeeecCcCCceeEEe
Q psy11568         90 FEFSNESGGRLDCAAQGSPTPKIEWL  115 (116)
Q Consensus        90 ~~~~~g~~~~l~C~~~g~P~p~i~W~  115 (116)
                      ..+..|+.+.|.|.+.+.|.|.+.|+
T Consensus         4 ~~~~~G~~~~l~C~~~~~p~~~v~W~   29 (85)
T cd05729           4 HAVPAGSTVRLKCPASGNPRPTITWL   29 (85)
T ss_pred             eEecCCCcEEEEEEcCCCCCCeEEEE
Confidence            34557999999999999999999996


No 191
>PF13895 Ig_2:  Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A ....
Probab=96.74  E-value=0.0032  Score=32.52  Aligned_cols=34  Identities=24%  Similarity=0.693  Sum_probs=26.2

Q ss_pred             CceEecCCCeEEEeCCCcEEEEeeecCcCCceeEEeC
Q psy11568         80 PLFRIEPPYRFEFSNESGGRLDCAAQGSPTPKIEWLI  116 (116)
Q Consensus        80 p~~~~~~~~~~~~~~g~~~~l~C~~~g~P~p~i~W~~  116 (116)
                      |.+...+   ..+..|+.+.|.|.+.+.|.+.+.|++
T Consensus         2 P~l~~~~---~~v~~g~~~~l~C~~~~~p~~~~~w~~   35 (80)
T PF13895_consen    2 PVLSSSP---QSVEEGDSVTLTCSVSGNPPPQVQWYK   35 (80)
T ss_dssp             -EEEEES---SEEETTSEEEEEEEEESSSSSEEEEEE
T ss_pred             cEEEccc---eEEeCCCcEEEEEEEEcccceeeeeee
Confidence            4444443   346889999999999999999999973


No 192
>cd05884 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)). Ig2_Necl-3: second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. Necl-3 has been shown to accumulate in tissues of the central and peripheral nervous system, where it is expressed in ependymal cells and myelinated axons.  It is observed at the interface between the axon shaft and the myelin sheath. Ig domains are likely to participate in ligand binding and recognition.
Probab=96.66  E-value=0.0085  Score=31.93  Aligned_cols=48  Identities=21%  Similarity=0.282  Sum_probs=27.1

Q ss_pred             cEEEEEccCCeeeeccccceEEee-CC------eEEecCCCCCCCCCCCCceEEEEEEEcCC
Q psy11568          2 YVLLWLIRDNTVIAYVKDLRIALS-NG------SLMFPPFPETGFRPDVHSTVYRCRASNEA   56 (116)
Q Consensus         2 p~v~W~~~~g~~~~~~~~~~~~~~-~~------~l~i~~v~~~~~~~~~d~G~y~C~a~n~~   56 (116)
                      ..|+| ++||+++........... ++      .|.+..-.      ..+...|+|.+.+..
T Consensus        15 ~~itW-~kng~~l~~~~~~~~~~~~~~t~~~~s~L~~~~~~------~d~g~~ytC~v~h~~   69 (83)
T cd05884          15 ADIRW-FKNDKEIKDVKYLKEEDANRKTFTVSSTLDFRVDR------SDDGVAIICRVDHES   69 (83)
T ss_pred             CEEEE-EECCEECcCceeeEeeCCCCCEEEEEEEEEEEccc------ccCCCEEEEEEechh
Confidence            57899 999998754211111111 12      24443221      225679999999874


No 193
>cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins. Ig1_ MRC-OX-2_like: domain similar to the first immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200). MRC OX-2 is a membrane glycoprotein expressed in a variety of lymphoid and non-lymphoid cells in rats. It has a similar broad distribution pattern in humans. MRC OX-2 may regulate myeloid cell activity. The protein has an extracellular portion containing two Ig-like domains, a transmembrane portion, and a cytoplasmic portion.
Probab=96.66  E-value=0.007  Score=33.05  Aligned_cols=28  Identities=14%  Similarity=0.152  Sum_probs=21.8

Q ss_pred             eEEecCCCCCCCCCCCCceEEEEEEEcC-CCceEE
Q psy11568         28 SLMFPPFPETGFRPDVHSTVYRCRASNE-AGVILS   61 (116)
Q Consensus        28 ~l~i~~v~~~~~~~~~d~G~y~C~a~n~-~g~~~~   61 (116)
                      +|.|.+++.+      |+|.|.|..... .|....
T Consensus        62 sL~I~nv~~~------D~G~Y~C~~~~~p~g~~~~   90 (97)
T cd05846          62 SITIWNVTLE------DEGCYKCIFNTFPDGSKSG   90 (97)
T ss_pred             EEEEeCCcee------eeEEEEEEEEeCCCCCeee
Confidence            6999999766      999999997765 455443


No 194
>cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA). Ig_EVA: immunoglobulin (Ig) domain of epithelial V-like antigen 1 (EVA). EVA is also known as myelin protein zero-like 2. EVA is an adhesion molecule, which may play a role in structural organization of the thymus and early lymphocyte development.
Probab=96.62  E-value=0.0028  Score=35.88  Aligned_cols=24  Identities=21%  Similarity=0.447  Sum_probs=20.8

Q ss_pred             eEEecCCCCCCCCCCCCceEEEEEEEcCCC
Q psy11568         28 SLMFPPFPETGFRPDVHSTVYRCRASNEAG   57 (116)
Q Consensus        28 ~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g   57 (116)
                      .|.|.++..+      |+|.|.|.+.|...
T Consensus        80 sL~I~~v~~~------D~G~Y~C~v~~~~~  103 (115)
T cd05880          80 SILIWQLQPT------DNGTYTCQVKNPPD  103 (115)
T ss_pred             EEEEeeCChh------hCEEEEEEEEeCCC
Confidence            6999999766      99999999998754


No 195
>cd07691 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain of CD3 gamma and delta chains. Ig_CD3_gamma_delta; immunoglobulin (Ig)-like domain of CD3 gamma and delta chains. CD3 is a T cell surface receptor that is associated with alpha/beta T cell receptors (TCRs).  The CD3 complex consists of one gamma, one delta, two epsilon, and two zeta chains.  The CD3 subunits form heterodimers as gamma/epsilon, delta/epsilon, and zeta/zeta.  The gamma, delta, and epsilon chains each contain an extracellular Ig domain, whereas the extracellular domains of the zeta chains are very small and have unknown structure. The CD3 domain participates in intracellular signalling once the TCR has bound an MHC/antigen complex.
Probab=96.58  E-value=0.012  Score=30.11  Aligned_cols=37  Identities=24%  Similarity=0.347  Sum_probs=24.8

Q ss_pred             EEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEc
Q psy11568          3 VLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASN   54 (116)
Q Consensus         3 ~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n   54 (116)
                      +|+| ++ |..+...       .+.++-+..+..+      -.|.|.|.+.+
T Consensus        18 si~W-~k-G~~~~~~-------~~~tlnLGs~~~D------PRG~Y~C~~s~   54 (69)
T cd07691          18 NITW-KK-GKEILEV-------SNTLLDLGSRIND------PRGTYSCKESE   54 (69)
T ss_pred             cEEE-ec-Ccccccc-------cccEEeccCcccC------CCcceEecCcc
Confidence            4889 77 5444311       1446667777555      68999999987


No 196
>PHA02987 Ig domain OX-2-like protein; Provisional
Probab=96.57  E-value=0.023  Score=34.93  Aligned_cols=39  Identities=8%  Similarity=0.152  Sum_probs=27.4

Q ss_pred             eCCeEEecCCCCCCCCCCCCceEEEEEEEcC-CC-ceEE-EEEEEEeC
Q psy11568         25 SNGSLMFPPFPETGFRPDVHSTVYRCRASNE-AG-VILS-RFVHVKAG   69 (116)
Q Consensus        25 ~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~-~g-~~~~-~~~~v~~~   69 (116)
                      .+..|.|.+++++      |+|.|.|....- .| .... ..|.|...
T Consensus        83 ~~StItIknVt~s------DeGcY~C~F~tfp~G~~~~gt~CLtVt~~  124 (189)
T PHA02987         83 NESTILIKNVSLK------DNGCYTCIFNTLLSKNNEKGVVCLNVTTD  124 (189)
T ss_pred             CcceEEEEeCChh------hCeEEEEEEEecCCCCCceeEEEEEEEch
Confidence            3457999999766      999999987665 45 4443 45666653


No 197
>smart00408 IGc2 Immunoglobulin C-2 Type.
Probab=96.56  E-value=0.0029  Score=30.72  Aligned_cols=23  Identities=39%  Similarity=0.872  Sum_probs=20.2

Q ss_pred             CCCcEEEEeeecCcCCceeEEeC
Q psy11568         94 NESGGRLDCAAQGSPTPKIEWLI  116 (116)
Q Consensus        94 ~g~~~~l~C~~~g~P~p~i~W~~  116 (116)
                      +|+++.|.|.+.+.|.+.+.|+.
T Consensus         1 ~g~~~~l~C~~~~~~~~~v~W~~   23 (63)
T smart00408        1 EGQSVTLTCPAEGDPVPNITWLK   23 (63)
T ss_pred             CCceEEEEeeCccCCCCeEEEEE
Confidence            47899999999999999999973


No 198
>cd00099 IgV Immunoglobulin variable domain (IgV). IgV: Immunoglobulin variable domain (IgV). Members of the IgV family are components of immunoglobulin (Ig) and T cell receptors. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. Within the variable domain, there are regions of even more variability called the hypervariable or complementarity-determining regions (CDRs) which are responsible for antigen binding. A predominant feature of most Ig domains is the disulfide bridge connecting 2 beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=96.48  E-value=0.0028  Score=34.86  Aligned_cols=24  Identities=29%  Similarity=0.528  Sum_probs=21.1

Q ss_pred             eEEecCCCCCCCCCCCCceEEEEEEEcCCC
Q psy11568         28 SLMFPPFPETGFRPDVHSTVYRCRASNEAG   57 (116)
Q Consensus        28 ~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g   57 (116)
                      .|.|.+++.+      |+|.|.|.+.+..+
T Consensus        68 sL~I~~v~~~------D~G~Y~C~v~~~~~   91 (105)
T cd00099          68 TLTISSLQPE------DSAVYYCAVSLSGG   91 (105)
T ss_pred             EEEECCCCHH------HCEEEEEEEecCCC
Confidence            7999999766      99999999998765


No 199
>cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins. Ig_P0ex-like: domain similar to the immunoglobulin (Ig) domain of Protein zero (P0). P0 accounts for over 50% of the total protein in peripheral nervous system (PNS) myelin. P0 is a single-pass transmembrane glycoprotein with a highly basic intracellular domain and an extracellular Ig domain. The extracellular domain of P0 (P0-ED) is similar to the Ig variable domain, carrying one acceptor sequence for N-linked glycosylation. P0 plays a role in membrane adhesion in the spiral wraps of the myelin sheath. The intracellular domain is thought to mediate membrane apposition of the cytoplasmic faces and may, through electrostatic interactions, interact directly with lipid headgroups. It is thought that homophilic interactions of the P0 extracellular domain mediate membrane juxtaposition in the extracellular space of PNS myelin. This group also contains the Ig domain of Sodium channel subunit beta-2 
Probab=96.42  E-value=0.0046  Score=34.95  Aligned_cols=24  Identities=21%  Similarity=0.403  Sum_probs=20.5

Q ss_pred             eEEecCCCCCCCCCCCCceEEEEEEEcCCC
Q psy11568         28 SLMFPPFPETGFRPDVHSTVYRCRASNEAG   57 (116)
Q Consensus        28 ~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g   57 (116)
                      .|.|.++..+      |+|.|.|...|...
T Consensus        81 sL~I~~v~~~------D~G~Y~C~v~~~~~  104 (116)
T cd05715          81 SIVIHNLQFT------DNGTYTCDVKNPPD  104 (116)
T ss_pred             EEEEeeCCcc------cCEEEEEEEEeCCC
Confidence            6999999766      99999999998754


No 200
>cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins. IgV_TCR_alpha: immunoglobulin (Ig) variable domain of the alpha chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group represents the variable domain of the alpha chain of TCRs and also includes the variable domain of delta chains of TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor.  Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.
Probab=96.37  E-value=0.0045  Score=34.36  Aligned_cols=23  Identities=30%  Similarity=0.400  Sum_probs=19.9

Q ss_pred             eEEecCCCCCCCCCCCCceEEEEEEEcCC
Q psy11568         28 SLMFPPFPETGFRPDVHSTVYRCRASNEA   56 (116)
Q Consensus        28 ~l~i~~v~~~~~~~~~d~G~y~C~a~n~~   56 (116)
                      .|.|.+++.+      |+|.|.|.+.+..
T Consensus        71 ~L~I~~~~~~------DsG~Y~C~~~~~~   93 (109)
T cd04983          71 SLHISAAQLS------DSAVYFCALSESG   93 (109)
T ss_pred             EEEECCCCHH------HCEEEEEEEecCC
Confidence            6999999766      9999999998764


No 201
>cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin. Ig_Semaphorin_class III; Immunoglobulin (Ig)-like domain of class III semaphorins. Semaphorins are classified into various classes on the basis of structural features additional to the Sema domain. Class III semaphorins are a vertebrate class having a Sema domain, an Ig domain, a short basic domain, and are secreted. They have been shown to be axonal guidance cues and have a part in the regulation of the cardiovascular, immune and respiratory systems. Sema3A, the prototype member of this class III subfamily, induces growth cone collapse and is an inhibitor of axonal sprouting. In perinatal rat cortex as a chemoattractant, it functions to direct, for pyramidal neurons, the orientated extension of apical dendrites. It may play a role, prior to the development of apical dendrites, in signaling the radial migration of newborn cortical neurons towards the upper layers. Sema3A selectively inhibits vascula
Probab=96.20  E-value=0.01  Score=32.11  Aligned_cols=26  Identities=23%  Similarity=0.474  Sum_probs=22.1

Q ss_pred             eEEEeCCCcEEEEeeecCcCCceeEEe
Q psy11568         89 RFEFSNESGGRLDCAAQGSPTPKIEWL  115 (116)
Q Consensus        89 ~~~~~~g~~~~l~C~~~g~P~p~i~W~  115 (116)
                      .....+|+.+.|.|.. +.|.|.++|+
T Consensus         5 ~~~~~eG~~v~L~C~~-~~p~p~v~Wy   30 (91)
T cd05871           5 VVYGVENNSTFLECLP-KSPQASVKWL   30 (91)
T ss_pred             EEEEecCCcEEEEEEC-CCCCceEEEE
Confidence            4456789999999996 5899999997


No 202
>PF11465 Receptor_2B4:  Natural killer cell receptor 2B4;  InterPro: IPR024303 2B4 is a transmembrane receptor which is expressed primarily on natural killer (NK) cells. It plays a role in activating NK-mediated cytotoxicity through its interaction with CD48 on target cells in a subset of CD8 T cells []. The structure of 2B4 consists of an immunoglobulin variable domain fold and contains two beta-sheets. One of the beta-sheets, the six-stranded sheet, contains structural features that may have a role in ligand recognition and receptor function []. This entry represents the 2B4 immunoglobulin domain.; GO: 0005488 binding; PDB: 2PTU_D 2PTT_B 1Z2K_A.
Probab=96.18  E-value=0.057  Score=30.15  Aligned_cols=38  Identities=21%  Similarity=0.299  Sum_probs=27.8

Q ss_pred             EeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEEEEEEE
Q psy11568         23 ALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILSRFVHV   66 (116)
Q Consensus        23 ~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~~~~~v   66 (116)
                      ...+-+|.|..+..+      |+|.|.-..++..|.+....+.|
T Consensus        67 ~~enlaLlIkaAq~q------DSG~Y~LEvT~~sG~V~~~~FqV  104 (108)
T PF11465_consen   67 TSENLALLIKAAQPQ------DSGLYCLEVTNESGKVCTKNFQV  104 (108)
T ss_dssp             ETTTTEEEESS-SGG------G-EEEEEEEEETTSCEEEEEEEE
T ss_pred             eccCceEEEeecCcc------cCceEEEEEEcCCCcEEEEEEEE
Confidence            445568999999655      99999999999999887644333


No 203
>cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins. Ig2_Contactin-2-like: second Ig domain of the neural cell adhesion molecule contactin-2. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (aliases TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. The first four Ig domains form the intermolecular binding fragment which arranges as a compact U-shaped module by contacts between Ig domains 1 and 4, and domains 2 and 3. It has been proposed that a linear zipper-like array forms, from contactin-2 molecules alternatively provided by the two apposed membranes.
Probab=96.15  E-value=0.011  Score=32.44  Aligned_cols=28  Identities=21%  Similarity=0.335  Sum_probs=23.7

Q ss_pred             CeEEEeCCCcEEEEee-ecCcCCceeEEe
Q psy11568         88 YRFEFSNESGGRLDCA-AQGSPTPKIEWL  115 (116)
Q Consensus        88 ~~~~~~~g~~~~l~C~-~~g~P~p~i~W~  115 (116)
                      ....+.+|+.+.|.|. -.|.|.|.++|+
T Consensus        11 ~~~~v~eG~~~~L~C~pP~g~P~p~~~W~   39 (96)
T cd05727          11 DEVKVKEGWGVVLFCDPPPHYPDLSYRWL   39 (96)
T ss_pred             CceeeeeCCcEEEeeCCCCCCCCCEEEEE
Confidence            4567888999999995 477899999997


No 204
>cd07694 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4. Ig2_CD4; second immunoglobulin (Ig) domain of CD4.  CD4 and CD8 are the two primary co-receptor proteins found on the surface of T cells, and the presence of either CD4 or CD8 determines the function of the T cell.  CD4 is found on helper T cells, where it is required for the binding of MHC (major histocompatibility complex) class II molecules, while CD8 is found on cytotoxic T cells, where it is required for the binding of MHC class I molecules.  CD4 contains four immunoglobulin domains, with the first three included in this hierarchy.  The fourth domain has a general Ig architecture, but has slight topological changes in the arrangement of beta strands relative to the other structures in this family and is not specifically included in the hierarchy.
Probab=96.12  E-value=0.076  Score=28.68  Aligned_cols=24  Identities=17%  Similarity=0.263  Sum_probs=19.5

Q ss_pred             CCeEEecCCCCCCCCCCCCceEEEEEEEcC
Q psy11568         26 NGSLMFPPFPETGFRPDVHSTVYRCRASNE   55 (116)
Q Consensus        26 ~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~   55 (116)
                      ..+|.+..+...      |+|.++|.....
T Consensus        50 ~ktL~~~qv~~q------dSG~WtC~V~~~   73 (88)
T cd07694          50 KKTLNLVQLGPN------DSGTWDCIVSVN   73 (88)
T ss_pred             ccEEEeceeCcc------cCCEEEEEEEEC
Confidence            347889999665      999999998755


No 205
>smart00409 IG Immunoglobulin.
Probab=96.07  E-value=0.017  Score=29.59  Aligned_cols=29  Identities=24%  Similarity=0.584  Sum_probs=24.5

Q ss_pred             CeEEEeCCCcEEEEeeecCcCCceeEEeC
Q psy11568         88 YRFEFSNESGGRLDCAAQGSPTPKIEWLI  116 (116)
Q Consensus        88 ~~~~~~~g~~~~l~C~~~g~P~p~i~W~~  116 (116)
                      ....+..|+++.|.|.+.+.+.+.+.|+.
T Consensus         2 ~~~~~~~g~~~~l~C~~~~~~~~~~~W~~   30 (86)
T smart00409        2 PSVTVKEGESVTLSCEVSGSPPPEVTWYK   30 (86)
T ss_pred             CcEEEeCCCeEEEEEEEccCCCCeEEEEE
Confidence            34566789999999999999899999963


No 206
>smart00410 IG_like Immunoglobulin like. IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.
Probab=96.07  E-value=0.017  Score=29.59  Aligned_cols=29  Identities=24%  Similarity=0.584  Sum_probs=24.5

Q ss_pred             CeEEEeCCCcEEEEeeecCcCCceeEEeC
Q psy11568         88 YRFEFSNESGGRLDCAAQGSPTPKIEWLI  116 (116)
Q Consensus        88 ~~~~~~~g~~~~l~C~~~g~P~p~i~W~~  116 (116)
                      ....+..|+++.|.|.+.+.+.+.+.|+.
T Consensus         2 ~~~~~~~g~~~~l~C~~~~~~~~~~~W~~   30 (86)
T smart00410        2 PSVTVKEGESVTLSCEVSGSPPPEVTWYK   30 (86)
T ss_pred             CcEEEeCCCeEEEEEEEccCCCCeEEEEE
Confidence            34566789999999999999899999963


No 207
>PF07686 V-set:  Immunoglobulin V-set domain;  InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents the V-set domains, which are Ig-like domains resembling the antibody variable domain. V-set domains are found in diverse protein families, including immunoglobulin light and heavy chains; in several T-cell receptors such as CD2 (Cluster of Differentiation 2), CD4, CD80, and CD86; in myelin membrane adhesion molecules; in junction adhesion molecules (JAM); in tyrosine-protein kinase receptors; and in the programmed cell death protein 1 (PD1).; PDB: 1PY9_A 2NXY_D 1U9K_B 3RNK_A 3BP6_A 3BIK_B 3SBW_A 1NPU_A 3BP5_A 3RNQ_A ....
Probab=96.03  E-value=0.022  Score=31.34  Aligned_cols=22  Identities=27%  Similarity=0.455  Sum_probs=19.7

Q ss_pred             eEEecCCCCCCCCCCCCceEEEEEEEcC
Q psy11568         28 SLMFPPFPETGFRPDVHSTVYRCRASNE   55 (116)
Q Consensus        28 ~l~i~~v~~~~~~~~~d~G~y~C~a~n~   55 (116)
                      +|.|.+++.+      |+|.|.|.....
T Consensus        80 sL~i~~l~~~------DsG~Y~C~v~~~  101 (114)
T PF07686_consen   80 SLTIKNLQPS------DSGTYFCQVSTS  101 (114)
T ss_dssp             EEEESSESGG------GEEEEEEEEEES
T ss_pred             EEEECCCCcC------cCEEEEEEEEEC
Confidence            5999999766      999999998887


No 208
>PF13927 Ig_3:  Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C ....
Probab=95.96  E-value=0.011  Score=29.95  Aligned_cols=34  Identities=35%  Similarity=0.696  Sum_probs=23.5

Q ss_pred             CceEecCCCeEEEeCCCcEEEEeeecCcC-CceeEEe
Q psy11568         80 PLFRIEPPYRFEFSNESGGRLDCAAQGSP-TPKIEWL  115 (116)
Q Consensus        80 p~~~~~~~~~~~~~~g~~~~l~C~~~g~P-~p~i~W~  115 (116)
                      |.+...+ .......+. +.|.|.+.+.| .+.++|+
T Consensus         2 P~I~~~~-~~~~~~~~~-~~l~C~~~~~~~~~~~~W~   36 (75)
T PF13927_consen    2 PQISVPP-PPVVTSGGS-VTLTCSAEGGPPPPSISWY   36 (75)
T ss_dssp             SEEEEES-TSEEETTEE-EEEEEEESSEESSEEEEEE
T ss_pred             CEEEEcC-CCcEeecee-EEEEEEEccccCCeEEEEE
Confidence            5555554 333333333 99999999988 8899996


No 209
>PF00047 ig:  Immunoglobulin domain The Prosite family only concerns antibodies and MHCs.;  InterPro: IPR013151 Members of the immunoglobulin superfamily are found in hundreds of proteins of different functions. Examples include antibodies, the giant muscle kinase titin and receptor tyrosine kinases. Immunoglobulin-like domains may be involved in protein-protein and protein-ligand interactions. The Pfam alignments do not include the first and last strand of the immunoglobulin-like domain.; PDB: 1B6U_A 3O4O_C 3VH8_H 1BIH_A 2C9A_A 2V5Y_A 1BQH_K 2ATP_A 3B9K_A 1NEZ_H ....
Probab=95.79  E-value=0.014  Score=28.97  Aligned_cols=22  Identities=27%  Similarity=0.653  Sum_probs=19.2

Q ss_pred             CCcEEEEeee-cCcCCceeEEeC
Q psy11568         95 ESGGRLDCAA-QGSPTPKIEWLI  116 (116)
Q Consensus        95 g~~~~l~C~~-~g~P~p~i~W~~  116 (116)
                      |+++.|.|.+ .+.|.+.++|++
T Consensus         1 G~~v~L~C~~~~~~~~~~~~W~~   23 (64)
T PF00047_consen    1 GSSVTLTCSVSSGPPPTTVTWSK   23 (64)
T ss_dssp             TSEEEEEEEEEESSSTSEEEEEE
T ss_pred             CCeEEEEeecCCCCCCcEEEEEE
Confidence            7889999999 777888999973


No 210
>cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain. IgV_L_kappa: Immunoglobulin (Ig) light chain, kappa type, variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=95.78  E-value=0.037  Score=30.63  Aligned_cols=28  Identities=18%  Similarity=0.396  Sum_probs=23.7

Q ss_pred             CeEEEeCCCcEEEEeeecCcC-CceeEEe
Q psy11568         88 YRFEFSNESGGRLDCAAQGSP-TPKIEWL  115 (116)
Q Consensus        88 ~~~~~~~g~~~~l~C~~~g~P-~p~i~W~  115 (116)
                      ....+.+|+++.|.|.+.+.. ...+.|+
T Consensus         8 ~~~~v~~G~~v~L~C~~~~~~~~~~~~Wy   36 (106)
T cd04980           8 ATLSVSPGESATISCKASQSVSSNYLAWY   36 (106)
T ss_pred             CcEEECCCCCEEEEEEECCCCCCCcEEEE
Confidence            667888899999999997765 6789997


No 211
>PF08205 C2-set_2:  CD80-like C2-set immunoglobulin domain ;  InterPro: IPR013162 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents the C2-set type domains found in the T-cell antigen CD80, as well as in related proteins. CD80 (B7-1) is a glycoprotein expressed on antigen-presenting cells []. The shared ligands on CD80 and CD86 (B7-2) deliver the co-stimulatory signal through CD28 and CTLA-4 on T-cells, where CD28 augments the T-cell response and CTLA-4 attenuates it [].; PDB: 3S58_A 3O3U_N 3CJJ_A 3S59_A 2PF6_B 2PET_A 3ALP_A 3SKU_D 3U83_A 3U82_B ....
Probab=95.76  E-value=0.0093  Score=31.86  Aligned_cols=22  Identities=32%  Similarity=0.821  Sum_probs=17.3

Q ss_pred             CCcEEEEeee-cCcCCceeEEeC
Q psy11568         95 ESGGRLDCAA-QGSPTPKIEWLI  116 (116)
Q Consensus        95 g~~~~l~C~~-~g~P~p~i~W~~  116 (116)
                      |+.+.+.|.+ .|.|.|.|+|++
T Consensus        14 ~~~~~~~C~s~~~~P~~~i~W~~   36 (89)
T PF08205_consen   14 GEEVTLTCSSSGGYPPPQITWYL   36 (89)
T ss_dssp             TEEEEEEEEEEEEBS-EEEEEEE
T ss_pred             ceEEEEEEEeCCeECCeEEEEEE
Confidence            6799999955 557999999973


No 212
>KOG3515|consensus
Probab=95.74  E-value=0.024  Score=41.75  Aligned_cols=96  Identities=16%  Similarity=0.212  Sum_probs=56.5

Q ss_pred             cEEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEEEEEEEEeCcEeeeeccCCCc
Q psy11568          2 YVLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILSRFVHVKAGSVVSLLDIQGPL   81 (116)
Q Consensus         2 p~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~~~~~v~~~~~~~~~~~~~p~   81 (116)
                      +.+.| ++++....   ..+....+.++......++      ..+.|.|.+.|..+......+.....       .+ |.
T Consensus        38 ~~~eW-~h~~~~~~---~~~~~~~~~~~~~~~~~~~------~~~~~~c~a~ns~~~~~~~~~~l~v~-------~~-pa   99 (741)
T KOG3515|consen   38 IDVEW-YHSTSGEH---GRYATIADPTLVTTGDVRD------TVAELNCRAFNSVGMPSRCPMILDVD-------YP-PA   99 (741)
T ss_pred             cceEE-EecCcccc---cccccccCCceeeecchhh------hhhhhhhhhcccccCceecceeeccc-------cC-cc
Confidence            46779 66655443   2233455667777776444      78999999999966555432222211       00 32


Q ss_pred             eEecCCCeEEEeCCCcEEEEeee--cCcCCceeEEeC
Q psy11568         82 FRIEPPYRFEFSNESGGRLDCAA--QGSPTPKIEWLI  116 (116)
Q Consensus        82 ~~~~~~~~~~~~~g~~~~l~C~~--~g~P~p~i~W~~  116 (116)
                      ..... .......+..+.+.|.+  .+.|.+.+.|.+
T Consensus       100 ~~~~~-~e~~~~~~~vvqi~c~~~~~~~P~~nlrW~~  135 (741)
T KOG3515|consen  100 CLPEL-GEIFQVDKGVVQIICSAKVAGRPNPNLRWGF  135 (741)
T ss_pred             ccccc-cchhhhcCCeEEEEEeecCCCCCCcceeeee
Confidence            22222 33344557888888844  456888999964


No 213
>cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain. IgV_TCR_beta: immunoglobulin (Ig) variable domain of the beta chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group includes the variable domain of the alpha chain of alpha/beta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor.  Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.
Probab=95.63  E-value=0.013  Score=32.63  Aligned_cols=23  Identities=30%  Similarity=0.379  Sum_probs=19.6

Q ss_pred             eEEecCCCCCCCCCCCCceEEEEEEEcCC
Q psy11568         28 SLMFPPFPETGFRPDVHSTVYRCRASNEA   56 (116)
Q Consensus        28 ~l~i~~v~~~~~~~~~d~G~y~C~a~n~~   56 (116)
                      .|.|.++..+      |+|.|.|.+.+..
T Consensus        73 ~L~I~~~~~~------Dsg~Y~Ca~~~~~   95 (110)
T cd05899          73 SLTIKSAEPE------DSAVYLCASSLGG   95 (110)
T ss_pred             EEEECCCChh------hCEEEEEEeeCCC
Confidence            6999999766      9999999988753


No 214
>cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain. IgV_L_kappa: Immunoglobulin (Ig) light chain, kappa type, variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=95.58  E-value=0.011  Score=32.72  Aligned_cols=22  Identities=18%  Similarity=0.412  Sum_probs=18.6

Q ss_pred             eEEecCCCCCCCCCCCCceEEEEEEEcC
Q psy11568         28 SLMFPPFPETGFRPDVHSTVYRCRASNE   55 (116)
Q Consensus        28 ~l~i~~v~~~~~~~~~d~G~y~C~a~n~   55 (116)
                      .|.|.++..+      |+|.|.|.+.+.
T Consensus        72 ~L~I~~~~~~------Dsg~Y~Ca~~~~   93 (106)
T cd04980          72 TLTISRVEPE------DAAVYYCQQYGT   93 (106)
T ss_pred             EEEECCCChH------HCEEEEEEEeCC
Confidence            5899999665      999999998764


No 215
>cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR). Ig_pIgR: Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR). pIgR delivers dimeric IgA and pentameric IgM to mucosal secretions. Polymeric immunoglobulin (pIgs) are the first defense against pathogens and toxins. IgA and IgM can form polymers via an 18-residue extension at their c-termini referred to as the tailpiece. pIgR transports pIgs across mucosal epithelia into mucosal secretions. Human pIgR is a glycosylated type I transmembrane protein, comprised of a 620 residue extracellular region, a 23 residue transmembrane region, and a 103 residue cytoplasmic tail. The extracellular region contains five domains that share sequence similarity with Ig variable (v) regions.
Probab=95.56  E-value=0.026  Score=30.72  Aligned_cols=23  Identities=9%  Similarity=0.381  Sum_probs=19.4

Q ss_pred             eEEecCCCCCCCCCCCCceEEEEEEEcCC
Q psy11568         28 SLMFPPFPETGFRPDVHSTVYRCRASNEA   56 (116)
Q Consensus        28 ~l~i~~v~~~~~~~~~d~G~y~C~a~n~~   56 (116)
                      .|.|.+++.+      |+|.|.|......
T Consensus        65 ~L~I~~v~~~------DsG~Y~C~~~~~~   87 (98)
T cd05716          65 TVTLNQLRKE------DAGWYWCGVGDDG   87 (98)
T ss_pred             EEEEcCCCHH------HCEEEEEEcccCC
Confidence            6999999766      9999999887754


No 216
>smart00407 IGc1 Immunoglobulin C-Type.
Probab=95.53  E-value=0.073  Score=27.57  Aligned_cols=47  Identities=17%  Similarity=0.331  Sum_probs=25.3

Q ss_pred             EEEEEccCCeeeeccccc-eEE-eeCCe------EEecCCCCCCCCCCCCceEEEEEEEcCC
Q psy11568          3 VLLWLIRDNTVIAYVKDL-RIA-LSNGS------LMFPPFPETGFRPDVHSTVYRCRASNEA   56 (116)
Q Consensus         3 ~v~W~~~~g~~~~~~~~~-~~~-~~~~~------l~i~~v~~~~~~~~~d~G~y~C~a~n~~   56 (116)
                      .|+| ++||+++...... ... ..+++      |.+....      ..+...|+|.+.+..
T Consensus        17 ~v~W-~k~g~~~~~~~~~~~~~~~~~gt~~~~s~L~v~~~~------~~~~~~~tC~V~H~~   71 (75)
T smart00407       17 TVTW-LRNGQEVTSGVSTTDPLKNSDGTYFLSSYLTVSAST------WESGDTYTCQVTHEG   71 (75)
T ss_pred             EEEE-EECCEECCCCEEECceEECCCCCEEEEEEEEEcccc------CCCCCEEEEEEEEcC
Confidence            6899 8899875421111 111 12332      3333222      226689999987753


No 217
>cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain. IgV_L_lambda: Immunoglobulin (Ig) light chain, lambda type, variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=95.51  E-value=0.018  Score=31.43  Aligned_cols=22  Identities=18%  Similarity=0.292  Sum_probs=18.5

Q ss_pred             eEEecCCCCCCCCCCCCceEEEEEEEcC
Q psy11568         28 SLMFPPFPETGFRPDVHSTVYRCRASNE   55 (116)
Q Consensus        28 ~l~i~~v~~~~~~~~~d~G~y~C~a~n~   55 (116)
                      .|.|.++..+      |+|.|.|.+.+.
T Consensus        64 ~L~I~~~~~~------Dsg~Y~C~~~~~   85 (98)
T cd04984          64 SLTISGAQTE------DEADYYCQVWDS   85 (98)
T ss_pred             EEEECCCChh------hCEEEEEEEccC
Confidence            5899999665      999999998754


No 218
>smart00406 IGv Immunoglobulin V-Type.
Probab=95.33  E-value=0.011  Score=30.62  Aligned_cols=18  Identities=22%  Similarity=0.425  Sum_probs=15.7

Q ss_pred             eEEecCCCCCCCCCCCCceEEEEE
Q psy11568         28 SLMFPPFPETGFRPDVHSTVYRCR   51 (116)
Q Consensus        28 ~l~i~~v~~~~~~~~~d~G~y~C~   51 (116)
                      .|.|.+++.+      |+|.|.|.
T Consensus        63 ~L~i~~~~~~------D~G~Y~C~   80 (81)
T smart00406       63 SLTISNLRVE------DTGTYYCA   80 (81)
T ss_pred             EEEEcCCCHH------HCEEEEEc
Confidence            5999999766      99999996


No 219
>cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs) and similar proteins. Ig2_FcgammaR_like: domain similar to the second immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs). Interactions between IgG and FcgammaR are important to the initiation of cellular and humoral response. IgG binding to FcgammaR leads to a cascade of signals and ultimately to functions such as antibody-dependent-cellular-cytotoxicity (ADCC), endocytosis, phagocytosis, release of inflammatory mediators, etc. FcgammaR has two Ig-like domains. This group also contains FcepsilonRI, which binds IgE with high affinity.
Probab=95.27  E-value=0.049  Score=28.86  Aligned_cols=26  Identities=15%  Similarity=0.137  Sum_probs=21.1

Q ss_pred             EEEeCCCcEEEEeeecC-cCCceeEEe
Q psy11568         90 FEFSNESGGRLDCAAQG-SPTPKIEWL  115 (116)
Q Consensus        90 ~~~~~g~~~~l~C~~~g-~P~p~i~W~  115 (116)
                      ..+.+|+++.|.|.+.+ .|.+.+.|+
T Consensus         9 ~~V~~G~~vtL~C~~~~~~~~~~~~w~   35 (83)
T cd05753           9 RVVFEGEPLVLRCHGWKNKPVYKVTYY   35 (83)
T ss_pred             ceecCCCCEEEEeeCCCCCcceEEEEE
Confidence            36778999999999854 567788996


No 220
>cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI. IG_FcalphaRI : immunoglobulin (IG)-like domain of of FcalphaRI. FcalphaRI (CD89) is an IgA-specific receptor that is expressed on monocytes, eosinophils, neutrophils and macrophages. FcalphaRI mediates IgA-induced immune effector responses such as phagocytosis, antibody-dependent cell-mediated cytotoxicity and respiratory burst. Both monomeric and dimeric IgA can bind to FcalphaRI, and monomeric or dimeric IgA immune complexes can activate phagocytosis and other immune responses through the clustering of FcalphaRI. The Fc RI ectodomain is comprised of two Ig-like domains oriented at about 90 degree to each another.
Probab=95.07  E-value=0.049  Score=29.63  Aligned_cols=22  Identities=32%  Similarity=0.614  Sum_probs=17.3

Q ss_pred             eEEecCCCCCCCCCCCCceEEEEEEEcC
Q psy11568         28 SLMFPPFPETGFRPDVHSTVYRCRASNE   55 (116)
Q Consensus        28 ~l~i~~v~~~~~~~~~d~G~y~C~a~n~   55 (116)
                      .+.|..++.+      |+|.|+|.....
T Consensus        56 ~f~I~~~~~~------~~G~Y~C~~~~~   77 (94)
T cd05711          56 SFPLGPVTPA------HAGTYRCYGSYN   77 (94)
T ss_pred             EEEecCCCcc------cCEEEEEEEECC
Confidence            5688888655      999999997643


No 221
>KOG1480|consensus
Probab=94.98  E-value=0.012  Score=43.19  Aligned_cols=51  Identities=24%  Similarity=0.304  Sum_probs=37.0

Q ss_pred             EEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          3 VLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         3 ~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      .+.| ++++..+.. ..+.+......+.+..++.      .|.|+|+|++.|..+...+
T Consensus       161 e~~w-~k~e~~~~p-d~n~~~~~d~~li~~~arl------sd~~nytc~a~ni~~~r~~  211 (909)
T KOG1480|consen  161 EVEW-LKNEVVIDP-DANVIRASDHNLIISQARL------SDSGNYTCEATNIVAKRKS  211 (909)
T ss_pred             hhhc-cccCCCCCc-cccchhhhcCCccccchhh------hhcccceeeeehhhccccc
Confidence            3579 888877764 2223445566788888854      4999999999999877664


No 222
>cd05755 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like domain of  intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins. Ig2_ ICAM-1_like: domain similar to the second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule-1 (ICAM-1, CD54). During the inflammation process, these molecules recruit leukocytes onto the vascular endothelium before extravasation to the injured tissues. ICAM-1 may be involved in organ targeted tumor metastasis. The interaction of ICAM-1 with leukocyte function-associated antigen-1 (LFA-1) plays a part in leukocyte-endothelial cell recognition. This group also contains ICAM-2, which also interacts with LFA-1. Transmigration of immature dendritic cells across resting endothelium is dependent on the interaction of ICAM-2 with, yet unidentified, ligand(s) on the dendritic cells. ICAM-1 has five Ig-like domains and ICAM-2 has two. ICAM-1 may also act as host receptor for viruses and parasites.
Probab=94.88  E-value=0.065  Score=29.68  Aligned_cols=26  Identities=19%  Similarity=0.261  Sum_probs=21.2

Q ss_pred             EEEeCCCcEEEEeeecC-cCCce--eEEe
Q psy11568         90 FEFSNESGGRLDCAAQG-SPTPK--IEWL  115 (116)
Q Consensus        90 ~~~~~g~~~~l~C~~~g-~P~p~--i~W~  115 (116)
                      ..+.+|+.+.|.|.+.| .|.+.  |+|+
T Consensus        11 ~~~~eG~~~tL~C~v~g~~P~a~L~i~W~   39 (100)
T cd05755          11 SWQPVGKNYTLQCDVPGVAPRQNLTVVLL   39 (100)
T ss_pred             CcccCCCcEEEEEEEcCcCCCCcEEEEEe
Confidence            34578999999999977 57776  6897


No 223
>cd05770 IgC_beta2m Class I major histocompatibility complex (MHC) beta2-microglobulin. IgC_beta2m: Immunoglobulin-like domain in beta2-Microglobulin (beta2m). Beta2m is the non-covalently bound light chain of the human class I major histocompatibility complex (MHC-I). Beta2m is structured as a beta-sandwich domain composed of two facing beta-sheets (four stranded and three stranded), that is typical of the C-type immunoglobulin superfamily. This structure is stabilized by an intramolecular disulfide bridge connecting two Cys residues in the facing beta -sheets. In vivo, MHC-I continuously exposes beta2m on the cell surface, where it may be released to plasmatic fluids, transported to the kidneys, degraded and then excreted.
Probab=94.86  E-value=0.081  Score=28.88  Aligned_cols=48  Identities=10%  Similarity=0.155  Sum_probs=25.5

Q ss_pred             EEEEEccCCeeeeccccceEE--eeCCeEEecCCCCCCCCCCCCceEEEEEEEcC
Q psy11568          3 VLLWLIRDNTVIAYVKDLRIA--LSNGSLMFPPFPETGFRPDVHSTVYRCRASNE   55 (116)
Q Consensus         3 ~v~W~~~~g~~~~~~~~~~~~--~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~   55 (116)
                      .|+| ++||+++.. ......  ..+++..+.....-   ...+...|.|.+...
T Consensus        33 ~v~W-~~dg~~~~~-~~~~~~~p~~d~tyq~~s~l~~---~~~~~~~ysC~V~H~   82 (93)
T cd05770          33 EIRL-LKNGVKIPK-VEQSDLSFSKDWTFYLLKSTEF---TPTKGDEYACRVRHN   82 (93)
T ss_pred             EEEE-EECCEECCC-cEECcEEECCCCCEEEEEEEEE---CCCCCCeEEEEEEEC
Confidence            5799 999998762 111111  22334333111000   123677899998875


No 224
>cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain. IgV_TCR_gamma: immunoglobulin (Ig) variable (V) domain of the gamma chain of gamma/delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha/beta TCRs but a small subset contain gamma/delta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma/delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma/delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds. The variable domain of gamma/delta TCRs is responsible for antigen recognition and is
Probab=94.74  E-value=0.027  Score=31.64  Aligned_cols=22  Identities=18%  Similarity=0.351  Sum_probs=18.5

Q ss_pred             eEEecCCCCCCCCCCCCceEEEEEEEcC
Q psy11568         28 SLMFPPFPETGFRPDVHSTVYRCRASNE   55 (116)
Q Consensus        28 ~l~i~~v~~~~~~~~~d~G~y~C~a~n~   55 (116)
                      .|.|.++..+      |+|.|.|.+...
T Consensus        78 ~L~I~~~~~~------Dsg~Y~C~~~~~   99 (116)
T cd04982          78 TLTIQNLEKE------DSATYYCAYWES   99 (116)
T ss_pred             EEEEEECCHH------HCEEEEEEEecC
Confidence            6999999766      999999998653


No 225
>cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)). Ig1_Necl-2: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-2, Necl-2 (also known as cell adhesion molecule 1 (CADM1), SynCAM1, IGSF4A, Tslc1, sgIGSF, and RA175).  Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region, belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-2 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-2 is expressed in a wide variety of tissues, and is a 
Probab=94.67  E-value=0.092  Score=28.77  Aligned_cols=28  Identities=11%  Similarity=0.184  Sum_probs=23.6

Q ss_pred             CeEEEeCCCcEEEEeeecCcCCceeEEe
Q psy11568         88 YRFEFSNESGGRLDCAAQGSPTPKIEWL  115 (116)
Q Consensus        88 ~~~~~~~g~~~~l~C~~~g~P~p~i~W~  115 (116)
                      ++..+.+|+++.|.|.+.+.....+.|+
T Consensus         5 ~nvtv~~G~ta~L~C~v~~~~~~~v~w~   32 (95)
T cd05881           5 EDVTVVEGEVAIISCRVKNNDDSVIQLL   32 (95)
T ss_pred             CceEEcCCCcEEEEEEEccCCccEEEEE
Confidence            5678889999999999999876667774


No 226
>cd05755 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like domain of  intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins. Ig2_ ICAM-1_like: domain similar to the second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule-1 (ICAM-1, CD54). During the inflammation process, these molecules recruit leukocytes onto the vascular endothelium before extravasation to the injured tissues. ICAM-1 may be involved in organ targeted tumor metastasis. The interaction of ICAM-1 with leukocyte function-associated antigen-1 (LFA-1) plays a part in leukocyte-endothelial cell recognition. This group also contains ICAM-2, which also interacts with LFA-1. Transmigration of immature dendritic cells across resting endothelium is dependent on the interaction of ICAM-2 with, yet unidentified, ligand(s) on the dendritic cells. ICAM-1 has five Ig-like domains and ICAM-2 has two. ICAM-1 may also act as host receptor for viruses and parasites.
Probab=94.64  E-value=0.11  Score=28.81  Aligned_cols=48  Identities=8%  Similarity=0.140  Sum_probs=26.6

Q ss_pred             EEEEccCCeeeeccccce----EEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCc
Q psy11568          4 LLWLIRDNTVIAYVKDLR----IALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGV   58 (116)
Q Consensus         4 v~W~~~~g~~~~~~~~~~----~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~   58 (116)
                      |+| +++++.+.......    ......++.+. +.++     .|.-.|+|.|.+..+.
T Consensus        36 i~W-~rG~~~l~~~~~~~~~~~~~~~~stlt~~-~~r~-----D~g~~~sC~A~l~l~~   87 (100)
T cd05755          36 VVL-LRGNETLSRQPFGDNTKSPVNAPATITIT-VDRE-----DHGANFSCETELDLRP   87 (100)
T ss_pred             EEE-eeCCEEcccceeccccCCCceeEEEEEEe-cchh-----hCCcEEEEEEEeccCc
Confidence            799 88888885311100    01111234443 3333     2555999999998643


No 227
>cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B. Ig_Sema4B_like; Immunoglobulin (Ig)-like domain of Sema4B_like. Sema4B is a Class IV semaphorin. Semaphorins are classified based on structural features additional to the Sema domain. Sema4B has extracellular Sema and Ig domains, a transmembrane domain and a short cytoplasmic domain. Sema4B has been shown to preferentially regulate the development of the postsynaptic specialization at the glutamatergic synapses. This cytoplasmic domain includes a PDZ-binding motif upon which the synaptic localization of Sem4B is dependent. Sema4B is a ligand of CLCP1, CLCP1 was identified in an expression profiling analysis, which compared a highly metastic lung cancer subline with its low metastic parental line. Sema4B was shown to promote CLCP1 endocytosis, and their interaction is a potential target for therapeutic intervention of metastasis.
Probab=94.63  E-value=0.054  Score=29.06  Aligned_cols=28  Identities=14%  Similarity=0.243  Sum_probs=23.5

Q ss_pred             CeEEEeCCCcEEEEeeecCcCCceeEEeC
Q psy11568         88 YRFEFSNESGGRLDCAAQGSPTPKIEWLI  116 (116)
Q Consensus        88 ~~~~~~~g~~~~l~C~~~g~P~p~i~W~~  116 (116)
                      +...+..|+.+.|.|...+. .+.+.|++
T Consensus         4 ~~~tv~~g~~v~L~C~~~s~-~A~v~W~~   31 (85)
T cd05872           4 KNRTVAPGADVVLPCQLRSN-LASPVWLF   31 (85)
T ss_pred             eEEEEecCCCEEEECCCCCC-CccEEEEE
Confidence            56778899999999998775 67999975


No 228
>cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain. Ig_CD8_alpha: immunoglobulin (Ig)-like domain in CD8 alpha. The CD8 glycoprotein plays an essential role in the control of T-cell selection, maturation and the T-cell receptor (TCR)-mediated response to peptide antigen. CD8 is comprised of alpha and beta subunits and is expressed as either an alphaalpha or alphabeta dimer. Both dimeric isoforms can serve as a coreceptor for T cell activation and differentiation, however they have distinct physiological roles, different cellular distributions, unique binding partners etc. Each CD8 subunit is comprised of an extracellular domain containing a v-type Ig-like domain, a single pass transmembrane portion and a short intracellular domain. The Ig domain of CD8 alpha binds to antibodies.
Probab=94.41  E-value=0.033  Score=30.85  Aligned_cols=21  Identities=19%  Similarity=0.445  Sum_probs=17.9

Q ss_pred             eEEecCCCCCCCCCCCCceEEEEEEEc
Q psy11568         28 SLMFPPFPETGFRPDVHSTVYRCRASN   54 (116)
Q Consensus        28 ~l~i~~v~~~~~~~~~d~G~y~C~a~n   54 (116)
                      .|.|.++..+      |+|+|.|...+
T Consensus        70 ~L~I~~~~~s------DsgtY~Ca~~~   90 (104)
T cd05720          70 VLTLKNFQKE------NEGYYFCSVAS   90 (104)
T ss_pred             EEEECCCCHH------HCEEEEEEEcc
Confidence            5999999766      99999998764


No 229
>cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain. IgV_CD8_beta: immunoglobulin (Ig)-like domain in CD8 beta. The CD8 glycoprotein plays an essential role in the control of T-cell selection, maturation and the T-cell receptor (TCR)-mediated response to peptide antigen. CD8 is comprised of alpha and beta subunits and is expressed as either an alpha/alpha or alpha/beta dimer. Both dimeric isoforms can serve as a coreceptor for T cell activation and differentiation, however they have distinct physiological roles, different cellular distributions, unique binding partners etc. Each CD8 subunit is comprised of an extracellular domain containing a V-type Ig-like domain, a single pass transmembrane portion and a short intracellular domain.
Probab=94.35  E-value=0.071  Score=29.60  Aligned_cols=22  Identities=18%  Similarity=0.255  Sum_probs=18.1

Q ss_pred             eEEecCCCCCCCCCCCCceEEEEEEEcC
Q psy11568         28 SLMFPPFPETGFRPDVHSTVYRCRASNE   55 (116)
Q Consensus        28 ~l~i~~v~~~~~~~~~d~G~y~C~a~n~   55 (116)
                      .|.|.++..+      |+|.|.|...+.
T Consensus        73 ~L~I~~~~~~------Dsg~YyCa~~~~   94 (107)
T cd07700          73 RLHINRVKPE------DSGTYFCMTVGS   94 (107)
T ss_pred             EEEECCCCHH------HCEEEEEeEcCC
Confidence            4999999666      999999997643


No 230
>cd05766 IgC_MHC_II_beta Class II major histocompatibility complex (MHC) beta chain immunoglobulin domain. IgC_MHC_II_beta: Immunoglobulin (Ig) domain of major histocompatibility complex (MHC) class II beta chain.  MHC class II molecules play a key role in the initiation of the antigen-specific immune reponse. In both humans and in mice these molecules have been shown to be expressed constitutively on the cell surface of professional antigen-presenting cells (APCs), for example on B-lymphocytes, monocytes, and macrophages. The expression of these molecules has been shown to be induced in nonprofessional APCs such as keratinocyctes, and they are expressed on the surface of activated human T cells and on T cells from other species. The MHC II molecules present antigenic peptides to CD4(+) T-lymphocytes. These peptides derive mostly from protelytic processing via the endocytic pathway, of antigens internalized by the APC. These peptides bind to the MHC class II molecules in the endosome be
Probab=94.28  E-value=0.13  Score=28.00  Aligned_cols=50  Identities=12%  Similarity=0.203  Sum_probs=25.2

Q ss_pred             EEEEEccCCeeeecc-ccce-EEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCC
Q psy11568          3 VLLWLIRDNTVIAYV-KDLR-IALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEA   56 (116)
Q Consensus         3 ~v~W~~~~g~~~~~~-~~~~-~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~   56 (116)
                      .|+| ++||+++... .... ....+++..+.....-   ...+...|.|.+....
T Consensus        32 ~v~W-~~~g~~~~~~~~~~~~~~~~dgTy~~~s~L~~---~~~~~~~ysC~V~H~~   83 (94)
T cd05766          32 TVKW-FKNGQEETEGVVSTELIPNGDWTYQILVMLET---TPSRGDTYTCVVEHSS   83 (94)
T ss_pred             EEEE-EECCeecCCCceecceEECCCCcEEEEEEEEE---cCCCCCEEEEEEEeCC
Confidence            5799 9999987642 1111 1112233222111100   1225668999988764


No 231
>cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain. IgV_TCR_delta: immunoglobulin (Ig) variable (V) domain of the delta chain of gamma/delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha/beta TCRs but a small subset contain gamma/delta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma/delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma/delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds. The variable domain of gamma/delta TCRs is responsible for antigen recognition and is
Probab=94.25  E-value=0.041  Score=30.95  Aligned_cols=22  Identities=27%  Similarity=0.333  Sum_probs=18.7

Q ss_pred             eEEecCCCCCCCCCCCCceEEEEEEEcC
Q psy11568         28 SLMFPPFPETGFRPDVHSTVYRCRASNE   55 (116)
Q Consensus        28 ~l~i~~v~~~~~~~~~d~G~y~C~a~n~   55 (116)
                      .|.|.++..+      |+|.|.|.....
T Consensus        73 sL~I~~~~~~------Dsg~Y~C~~~~~   94 (116)
T cd07706          73 SLTISALQLE------DSAKYFCALSTL   94 (116)
T ss_pred             EEEECCCCHH------HCEEEEEEEECC
Confidence            6999999766      999999998853


No 232
>cd07692 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of CD3 epsilon chain. Ig_CD3_epsilon; immunoglobulin (Ig)-like domain of CD3 epsilon chain. CD3 is a T cell surface receptor that is associated with alpha/beta T cell receptors (TCRs).  The CD3 complex consists of one gamma, one delta, two epsilon, and two zeta chains.  The CD3 subunits form heterodimers as gamma/epsilon, delta/epsilon, and zeta/zeta.  The gamma, delta, and epsilon chains each contain an extracellular Ig domain, whereas the extracellular domains of the zeta chains are very small and have unknown structure. The CD3 domain participates in intracellular signalling once the TCR has bound an MHC/antigen complex.
Probab=94.13  E-value=0.097  Score=26.61  Aligned_cols=37  Identities=22%  Similarity=0.373  Sum_probs=22.4

Q ss_pred             EEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCC
Q psy11568          4 LLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEA   56 (116)
Q Consensus         4 v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~   56 (116)
                      |.| .+|+..+..        .+..+.+.+-. +      ++|.|.|.+.+..
T Consensus        21 i~W-~~n~~~~~g--------~~~~~~~~~~~-e------~~G~Y~C~~~~~~   57 (65)
T cd07692          21 IKW-KKNDQVSQG--------SDEKYLSLNHF-S------SSGYYHCTADNAN   57 (65)
T ss_pred             ceE-EeCCccCCC--------CCceEEeeccC-C------CCceEEEEeCCCc
Confidence            778 777644431        12233344443 3      8999999997653


No 233
>cd05767 IgC_MHC_II_alpha Class II major histocompatibility complex (MHC) alpha chain immunoglobulin domain. IgC_MHC_II_alpha: Immunoglobulin (Ig) domain of major histocompatibility complex (MHC) class II alpha chain.  MHC class II molecules play a key role in the initiation of the antigen-specific immune reponse. In both humans and in mice these molecules have been shown to be expressed constitutively on the cell surface of professional antigen-presenting cells (APCs), for example on B-lymphocytes, monocytes, and macrophages. The expression of these molecules has been shown to be induced in nonprofessional APCs such as keratinocyctes, and they are expressed on the surface of activated human T cells and on T cells from other species. The MHC II molecules present antigenic peptides to CD4(+) T-lymphocytes. These peptides derive mostly from protelytic processing via the endocytic pathway, of antigens internalized by the APC. These peptides bind to the MHC class II molecules in the endosom
Probab=94.13  E-value=0.11  Score=28.44  Aligned_cols=49  Identities=10%  Similarity=0.150  Sum_probs=24.9

Q ss_pred             EEEEEccCCeeeecccc-ceEE-eeCCeEEe-cCCCCCCCCCCCCceEEEEEEEcCC
Q psy11568          3 VLLWLIRDNTVIAYVKD-LRIA-LSNGSLMF-PPFPETGFRPDVHSTVYRCRASNEA   56 (116)
Q Consensus         3 ~v~W~~~~g~~~~~~~~-~~~~-~~~~~l~i-~~v~~~~~~~~~d~G~y~C~a~n~~   56 (116)
                      .|+| ++||+++..... .... ..+++..+ ..+..    .+.+...|+|.+....
T Consensus        33 ~v~W-~~~g~~~~~~~~~~~~~~~~Dgty~~~s~L~v----~~~~~~~ytC~V~H~~   84 (94)
T cd05767          33 NVTW-LKNGVPVTDGVSETRYYPRQDLSFQKFSYLNF----TPEEGDIYSCIVEHWG   84 (94)
T ss_pred             EEEE-EECCeEccCceEEeeeEeCCCCcEEEEEEEEE----ECCCCCeEEEEEEeCC
Confidence            5799 899998753211 1111 12233222 11111    1225679999988753


No 234
>cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins). Ig_Siglec_N: immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins). Siglec refers to a structurally related protein family that specifically recognizes sialic acid in oligosaccharide chains of glycoproteins and glycolipids. Siglecs are type I transmembrane proteins, organized as an extracellular module composed of Ig-like domains (an N-terminal variable set of Ig-like carbohydrate recognition domains, and 1 to 16 constant Ig-like domains), followed by transmembrane and short cytoplasmic domains. Human siglecs are classified into two subgroups, one subgroup is comprised of sialoadhesin (Siglec-1), CD22 (Siglec-2), and MAG, the other subgroup is comprised of CD33-related Siglecs which include CD33 (Siglec-3) and human Siglecs 5-11.
Probab=94.08  E-value=0.071  Score=30.23  Aligned_cols=22  Identities=23%  Similarity=0.175  Sum_probs=18.5

Q ss_pred             eEEecCCCCCCCCCCCCceEEEEEEEcC
Q psy11568         28 SLMFPPFPETGFRPDVHSTVYRCRASNE   55 (116)
Q Consensus        28 ~l~i~~v~~~~~~~~~d~G~y~C~a~n~   55 (116)
                      .|.|.++..+      |+|.|.|.....
T Consensus        81 sL~I~~l~~~------Dsg~Y~C~~~~~  102 (119)
T cd05712          81 SLLISDAQPE------DSGKYFFRVELG  102 (119)
T ss_pred             EEEEccCChh------hCeEEEEEEEcC
Confidence            5999999665      999999987664


No 235
>PF08205 C2-set_2:  CD80-like C2-set immunoglobulin domain ;  InterPro: IPR013162 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents the C2-set type domains found in the T-cell antigen CD80, as well as in related proteins. CD80 (B7-1) is a glycoprotein expressed on antigen-presenting cells []. The shared ligands on CD80 and CD86 (B7-2) deliver the co-stimulatory signal through CD28 and CTLA-4 on T-cells, where CD28 augments the T-cell response and CTLA-4 attenuates it [].; PDB: 3S58_A 3O3U_N 3CJJ_A 3S59_A 2PF6_B 2PET_A 3ALP_A 3SKU_D 3U83_A 3U82_B ....
Probab=93.83  E-value=0.34  Score=25.66  Aligned_cols=13  Identities=46%  Similarity=0.774  Sum_probs=11.0

Q ss_pred             CceEEEEEEEcCC
Q psy11568         44 HSTVYRCRASNEA   56 (116)
Q Consensus        44 d~G~y~C~a~n~~   56 (116)
                      +...++|.+.+..
T Consensus        72 ~~~~~~C~~~~~~   84 (89)
T PF08205_consen   72 HGKTLTCRASHPA   84 (89)
T ss_dssp             TTEEEEEEEEETT
T ss_pred             CCeEEEEEEECCc
Confidence            6779999999875


No 236
>cd07704 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3), nectin-4 (poliovirus receptor related protein 4) and similar proteins. Ig2_Nectin-3-4_like: domain similar to the second immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and nectin-4 (poliovirus receptor related protein 4). Nectin-3 and nectin-4 belong to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through 4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion.  Nectin-2 and nectin-3 localize at Sertoli-spermatid junctions where they form heterophilic trans-interactions between the cells that are essential for the formation and maintenance of the junctions and for spermatid development.  Nect
Probab=93.38  E-value=0.27  Score=27.12  Aligned_cols=27  Identities=26%  Similarity=0.690  Sum_probs=19.8

Q ss_pred             eEEEeCCCcEEE-Eeee-cCcCCceeEEe
Q psy11568         89 RFEFSNESGGRL-DCAA-QGSPTPKIEWL  115 (116)
Q Consensus        89 ~~~~~~g~~~~l-~C~~-~g~P~p~i~W~  115 (116)
                      ...+.+|+.+.+ .|.+ .|.|.+.|+|+
T Consensus        10 ~~~~~~g~~~~vA~C~sa~gkPaa~IsW~   38 (97)
T cd07704          10 SLLIDGGNGTTLAACCAAEGRPAADVTWE   38 (97)
T ss_pred             eeEeecCcceeEEEEEccCCccCCEeEEe
Confidence            344556777777 6755 66899999997


No 237
>cd07698 IgC_MHC_I_alpha3 Class I major histocompatibility complex (MHC) alpha chain immunoglobulin domain. IgC_MHC_I_alpha3;  Immunoglobulin (Ig) domain of major histocompatibility complex (MHC) class I alpha chain. Class I MHC proteins bind antigenic peptide fragments and present them to CD8+ T lymphocytes.  Class I molecules consist of a transmembrane alpha chain and a small chain called the beta2 microglobulin. The alpha chain contains three extracellular domains, two of which fold together to form the peptide-binding cleft (alpha1 and alpha2), and one which has an Ig fold (alpha3).  Peptide binding to class I molecules occurs in the endoplasmic reticulum (ER) and involves both chaperones and dedicated factors to assist in peptide loading.  Class I MHC molecules are expressed on most nucleated cells.
Probab=93.29  E-value=0.27  Score=26.55  Aligned_cols=13  Identities=23%  Similarity=0.644  Sum_probs=10.9

Q ss_pred             CceEEEEEEEcCC
Q psy11568         44 HSTVYRCRASNEA   56 (116)
Q Consensus        44 d~G~y~C~a~n~~   56 (116)
                      +.+.|+|.+.+..
T Consensus        71 ~~~~ytC~V~H~~   83 (93)
T cd07698          71 DKARYSCRVEHSG   83 (93)
T ss_pred             CCCEEEEEEEeCC
Confidence            7889999998764


No 238
>cd05772 IgC_SIRP Signal-regulatory protein (SIRP) immunoglobulin-like domain. IgC_SIRP: Immunoglobulin-like domain of signal-regulatory proteins (SIRP); the signal-regulatory proteins (SIRP) are Ig-like cell surface receptors detected in hematopoietic and non-hematopoietic cells. While their extracellular domains are similar, SIRP are classified as alpha or beta based on the length of the intracytoplasmic domain.  Those having a 110- to 113-amino acid tail are classified as SIRP-alpha, and those having a 5-amino acid tail as SIRP-beta. SIRP-alpha and SIRP-beta molecules are thought to have complementary roles in signal regulation:  SIRP-alpha inhibit signalling via their immunoreceptor tyrosine (IT)-based inhibition motifs while SIRP-beta are activating.  SIRP-beta lack the cytoplasmic domainof SIRP-alpha, and associate with at least one other transmembrane protein (DAP-12 or KARAP). The IT-based activation motifs within DAP-12's cytoplasmic domain may link SIRP-beta to the activating 
Probab=93.28  E-value=0.26  Score=27.76  Aligned_cols=13  Identities=8%  Similarity=0.572  Sum_probs=10.9

Q ss_pred             EEEEEccCCeeeec
Q psy11568          3 VLLWLIRDNTVIAY   16 (116)
Q Consensus         3 ~v~W~~~~g~~~~~   16 (116)
                      .|+| ++||+++..
T Consensus        39 ~v~W-~kng~~~~~   51 (111)
T cd05772          39 TVKW-LKNGNELSA   51 (111)
T ss_pred             EEEE-EECCEECcc
Confidence            6899 999999864


No 239
>cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR). Ig4_SCFR: The fourth Immunoglobulin (Ig)-like domain in stem cell factor receptor (SCFR). SCFR is organized as an extracellular component having five IG-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. SCFR and its ligand SCF are critical for normal hematopoiesis, mast cell development, melanocytes and gametogenesis. SCF binds to the second and third Ig-like domains of SCFR. This fourth Ig-like domain participates in SCFR dimerization, which follows ligand binding. Deletion of this fourth domain abolishes the ligand-induced dimerization of SCFR and completely inhibits signal transduction.
Probab=92.88  E-value=0.35  Score=26.88  Aligned_cols=28  Identities=14%  Similarity=0.268  Sum_probs=25.3

Q ss_pred             CeEEEeCCCcEEEEeeecCcCCce-eEEe
Q psy11568         88 YRFEFSNESGGRLDCAAQGSPTPK-IEWL  115 (116)
Q Consensus        88 ~~~~~~~g~~~~l~C~~~g~P~p~-i~W~  115 (116)
                      ....+..|+.+.|.|.+..-|+|. +.|.
T Consensus        11 ~~~~v~~gE~~~L~V~ieAYP~p~~~~W~   39 (101)
T cd05860          11 TTIFVNAGENLDLIVEYEAYPKPEHQQWI   39 (101)
T ss_pred             ceEEEECCCCEEEEEEEEeCCCCeeeEEE
Confidence            567788999999999999999997 9996


No 240
>cd07694 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4. Ig2_CD4; second immunoglobulin (Ig) domain of CD4.  CD4 and CD8 are the two primary co-receptor proteins found on the surface of T cells, and the presence of either CD4 or CD8 determines the function of the T cell.  CD4 is found on helper T cells, where it is required for the binding of MHC (major histocompatibility complex) class II molecules, while CD8 is found on cytotoxic T cells, where it is required for the binding of MHC class I molecules.  CD4 contains four immunoglobulin domains, with the first three included in this hierarchy.  The fourth domain has a general Ig architecture, but has slight topological changes in the arrangement of beta strands relative to the other structures in this family and is not specifically included in the hierarchy.
Probab=92.80  E-value=0.28  Score=26.49  Aligned_cols=26  Identities=15%  Similarity=0.183  Sum_probs=20.5

Q ss_pred             EEEeCCCcEEEEeeecCcC--CceeEEe
Q psy11568         90 FEFSNESGGRLDCAAQGSP--TPKIEWL  115 (116)
Q Consensus        90 ~~~~~g~~~~l~C~~~g~P--~p~i~W~  115 (116)
                      ..+..|+++.|.|.....+  .+.+.|+
T Consensus         9 ~~lL~G~sLtLtl~~~s~s~p~~~i~w~   36 (88)
T cd07694           9 DHVLSGTNLTLTLHGSSNSLPAFKVEWR   36 (88)
T ss_pred             CeeecCCcEEEEEecCCCCCCCccEEEe
Confidence            3567799999999996644  4599996


No 241
>cd00098 IgC Immunoglobulin Constant domain. IgC: Immunoglobulin constant domain (IgC). Members of the IgC family are components of immunoglobulin, T-cell receptors, CD1 cell surface glycoproteins, secretory glycoproteins A/C, and Major Histocompatibility Complex (MHC) class I/II molecules. In immunoglobulins, each chain is composed of one variable domain (IgV) and one or more IgC domains. These names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. The IgV domain is responsible for antigen binding, and the IgC domain is involved in oligomerization and molecular interactions.
Probab=92.20  E-value=0.23  Score=26.59  Aligned_cols=23  Identities=30%  Similarity=0.554  Sum_probs=19.2

Q ss_pred             eCCCcEEEEeeecCc-C-CceeEEe
Q psy11568         93 SNESGGRLDCAAQGS-P-TPKIEWL  115 (116)
Q Consensus        93 ~~g~~~~l~C~~~g~-P-~p~i~W~  115 (116)
                      ..|+.+.|.|.+.|. | .+.++|+
T Consensus        11 ~~~~~~~L~C~a~g~~P~~~~i~W~   35 (95)
T cd00098          11 LLGGSVTLTCLATGFYPPDITVTWL   35 (95)
T ss_pred             HcCCCeEEEEEEeeEECCCcEEEEE
Confidence            358999999999997 6 3689997


No 242
>PF07654 C1-set:  Immunoglobulin C1-set domain;  InterPro: IPR003597 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents C1-set domains, which are classical Ig-like domains resembling the antibody constant domain. C1-set domains are found almost exclusively in molecules involved in the immune system, such as in immunoglobulin light and heavy chains, in the major histocompatibility complex (MHC) class I and II complex molecules [, ], and in various T-cell receptors.; PDB: 3BVN_D 3BXN_A 3PWV_E 3L9R_F 2XFX_B 1BMG_A 1K8I_A 3M1B_G 3M17_C 1EXU_A ....
Probab=92.13  E-value=0.24  Score=26.07  Aligned_cols=44  Identities=18%  Similarity=0.416  Sum_probs=25.4

Q ss_pred             EEEEEccCCeeeeccccce-EE-eeCCe------EEecCCCCCCCCCCCCceEEEEEEEcCC
Q psy11568          3 VLLWLIRDNTVIAYVKDLR-IA-LSNGS------LMFPPFPETGFRPDVHSTVYRCRASNEA   56 (116)
Q Consensus         3 ~v~W~~~~g~~~~~~~~~~-~~-~~~~~------l~i~~v~~~~~~~~~d~G~y~C~a~n~~   56 (116)
                      .|+| ++||+.+....... .. ..+++      |.+.   ..      +...|.|.+....
T Consensus        26 ~v~W-~~~~~~~~~~~~~~~~~~~~dgty~~~s~l~v~---~~------~~~~ysC~V~H~~   77 (83)
T PF07654_consen   26 TVTW-LKNGKEVTEGVETTPPPPNSDGTYSVTSSLTVT---WN------SGDEYSCRVTHES   77 (83)
T ss_dssp             EEEE-EETTEEETTTEEEEEEEEETTSEEEEEEEEEEE---TT------TTGGEEEEEEETT
T ss_pred             EEEE-EeccceeeeeeeecccccccccceeeeEEEEec---CC------CCCEEEEEEEECC
Confidence            6899 99999876422111 11 13342      3333   22      5568999988764


No 243
>cd07699 IgC_L Immunoglobulin Constant domain. IgC_L: Immunoglobulin (Ig) light chain constant (C) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=92.03  E-value=0.19  Score=27.68  Aligned_cols=50  Identities=14%  Similarity=0.282  Sum_probs=25.4

Q ss_pred             EEEEEccCCeeeecccc-ce-EEeeCCeEEecC---CCCCCCCCCCCceEEEEEEEcCC
Q psy11568          3 VLLWLIRDNTVIAYVKD-LR-IALSNGSLMFPP---FPETGFRPDVHSTVYRCRASNEA   56 (116)
Q Consensus         3 ~v~W~~~~g~~~~~~~~-~~-~~~~~~~l~i~~---v~~~~~~~~~d~G~y~C~a~n~~   56 (116)
                      .|+| ++||+++..... .. ....+++..+..   +..+   ...+...|+|.+....
T Consensus        35 ~v~W-~~~g~~~~~~~~~~~~~~~~dgty~~~s~L~v~~~---~w~~~~~~sC~V~H~~   89 (100)
T cd07699          35 TVQW-KVDGATVSSGVQTSTTEQQSDNTYSLSSYLTLTKS---DWNKHKVYTCEVTHEG   89 (100)
T ss_pred             EEEE-EECCEECcccEeccccEECCCCCEEEEEEEEEcHH---HhCCCCeEEEEEEecC
Confidence            6899 999998753111 11 111234332211   1111   0113579999988764


No 244
>cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain. IgV_H: Immunoglobulin (Ig) heavy chain (H), variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin: IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which can associate with any of the heavy chains. This family includes alpha, gamma, delta, epsilon, and mu heavy chains.
Probab=91.93  E-value=0.15  Score=28.87  Aligned_cols=21  Identities=19%  Similarity=0.377  Sum_probs=17.9

Q ss_pred             eEEecCCCCCCCCCCCCceEEEEEEEc
Q psy11568         28 SLMFPPFPETGFRPDVHSTVYRCRASN   54 (116)
Q Consensus        28 ~l~i~~v~~~~~~~~~d~G~y~C~a~n   54 (116)
                      .|.|.++..+      |+|.|.|....
T Consensus        77 ~L~I~~~~~~------Dsa~YyCa~~~   97 (117)
T cd04981          77 YLQLNSLTPE------DTAVYYCARGL   97 (117)
T ss_pred             EEEECCCCHH------HCEEEEEEEEc
Confidence            5899999766      99999998765


No 245
>cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins. Ig2_IL1R_like: domain similar to the second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R).  IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three IG-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta. This group also contains ILIR-like 1 (IL1
Probab=91.59  E-value=0.23  Score=26.90  Aligned_cols=27  Identities=19%  Similarity=0.605  Sum_probs=21.3

Q ss_pred             eEEEeCCCcEEEEeeecC-----cCCceeEEe
Q psy11568         89 RFEFSNESGGRLDCAAQG-----SPTPKIEWL  115 (116)
Q Consensus        89 ~~~~~~g~~~~l~C~~~g-----~P~p~i~W~  115 (116)
                      ...+..|+++.|.|...+     +|.|.+.|+
T Consensus         4 ~~~~~~g~~~~l~Cp~~~~~~~~~~~p~i~Wy   35 (92)
T cd05757           4 KQILFSTKGGKIVCPDLDDFKNENTLPPVQWY   35 (92)
T ss_pred             eEEEeeccCCEEECCChHHccCCCCCCcEEEe
Confidence            355677999999998754     268899997


No 246
>cd07697 IgC_TCR_gamma T cell receptor (TCR) gamma chain constant immunoglobulin domain. IgC_TCR_gamma;  immunoglobulin (Ig) constant (C) domain of the gamma chain of gamma-delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha-beta TCRs but a small subset contain gamma-delta TCRs. Alpha-beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma-delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma-delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds.
Probab=91.31  E-value=0.3  Score=26.79  Aligned_cols=13  Identities=15%  Similarity=0.299  Sum_probs=10.3

Q ss_pred             EEEEEccCCeeeec
Q psy11568          3 VLLWLIRDNTVIAY   16 (116)
Q Consensus         3 ~v~W~~~~g~~~~~   16 (116)
                      .|+| ++||+.+..
T Consensus        34 ~v~W-~kng~~~~~   46 (96)
T cd07697          34 QVHW-REGNSPSIL   46 (96)
T ss_pred             EEEE-EECCEECcC
Confidence            5799 999998753


No 247
>cd05719 Ig2_PVR_like Second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins. Ig2_PVR_like: domain similar to the second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155). Poliovirus (PV) binds to its cellular receptor (PVR/CD155) to initiate infection. CD155 is a membrane-anchored, single-span glycoprotein; its extracellular region has three Ig-like domains. There are four different isotypes of CD155 (referred to as alpha, beta, gamma, and delta), these result from alternate splicing of the CD155 mRNA, and have identical extracellular domains. CD155-beta and - gamma, are secreted, CD155-alpha and delta are membrane-bound and function as PV receptors. The virus recognition site is contained in the amino-terminal domain, D1. Having the virus attachment site on the receptor distal from the plasma membrane may be important for successful initiation of infection of cells by the virus. CD155 binds in the poliovirus 
Probab=90.81  E-value=0.37  Score=26.35  Aligned_cols=21  Identities=29%  Similarity=0.639  Sum_probs=16.9

Q ss_pred             CCcEEEEeee-cCcCCceeEEe
Q psy11568         95 ESGGRLDCAA-QGSPTPKIEWL  115 (116)
Q Consensus        95 g~~~~l~C~~-~g~P~p~i~W~  115 (116)
                      .....+.|.+ .|+|.+.|+|+
T Consensus        15 ~~~~va~C~s~~gkP~a~ItW~   36 (95)
T cd05719          15 EPVTVATCVSANGKPPATISWE   36 (95)
T ss_pred             CccEEEEEECCCCcCCCEEEEE
Confidence            3456778988 67899999997


No 248
>cd05847 IgC_CH2_IgE CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin E (IgE). IgC_CH2_IgE: The second constant domain of the heavy chain of immunoglobulin E (IgE). The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma, and mu, all consisting of a variable domain (VH) and three (in alpha, delta, and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). The different classes of antibodies vary in their heavy chains; the IgE class has the epsilon type. This domain (Cepsilon2) of IgE is in place of the flexible hinge region found in IgG.
Probab=90.73  E-value=0.84  Score=24.86  Aligned_cols=13  Identities=15%  Similarity=0.695  Sum_probs=10.2

Q ss_pred             CceEEEEEEEcCC
Q psy11568         44 HSTVYRCRASNEA   56 (116)
Q Consensus        44 d~G~y~C~a~n~~   56 (116)
                      +...|.|.+....
T Consensus        74 ~~~~ytC~V~H~~   86 (94)
T cd05847          74 SGKTYTCKVTHQG   86 (94)
T ss_pred             CCCeEEEEEEECC
Confidence            4579999998864


No 249
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins. Ig1_LILRB1_like: domain similar to the first immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1). This group includes, LILRA5 (LIR9), an activating natural cytotoxicity receptor NKp46, and the immune-type receptor glycoprotein VI (GPVI). LILRs are a family of immunoreceptors expressed on expressed on T and B cells, on monocytes, dendritic cells, and subgroups of natural killer (NK) cells. The human LILR family contains nine proteins (LILRA1-3,and 5, and LILRB1-5). From functional assays, and as the cytoplasmic domains of various LILRs, for example LILRB1 (LIR-1), LILRB2 (LIR-2), and LILRB3 (LIR-3) contain immunoreceptor tyrosine-based inhibitory motifs (ITIMs) it is thought that LIR proteins are inhibitory receptors. Of the eight LIR family proteins, only LIR-1(LILRB1), and LIR-2 (LILRB2),
Probab=90.17  E-value=0.73  Score=24.69  Aligned_cols=33  Identities=15%  Similarity=0.142  Sum_probs=22.7

Q ss_pred             CceEecCCCeEEEeCCCcEEEEeeecCcCCceeEEe
Q psy11568         80 PLFRIEPPYRFEFSNESGGRLDCAAQGSPTPKIEWL  115 (116)
Q Consensus        80 p~~~~~~~~~~~~~~g~~~~l~C~~~g~P~p~i~W~  115 (116)
                      |.+...|  ...+..|+++.|.|... .+...+.|+
T Consensus         3 P~L~a~p--~~vV~~G~~VtL~C~~~-~~~~~f~l~   35 (91)
T cd05751           3 PSLWAEP--SSVVPLGKPVTLRCQGP-YGAVEYRLY   35 (91)
T ss_pred             CEEEecC--CCccCCCCcEEEEEecC-CCCCEEEEE
Confidence            5555554  24667899999999875 555566664


No 250
>cd07703 Ig2_Nectin-2_like Second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112) and similar proteins. Ig2_Nectin-2_like: domain similar to the second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112). Nectin-2 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through 4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion.  Nectin-2 and nectin-3 localize at Sertoli-spermatid junctions where they form heterophilic trans-interactions between the cells that are essential for the formation and maintenance of the junctions and for spermatid development.
Probab=89.93  E-value=0.44  Score=26.09  Aligned_cols=20  Identities=25%  Similarity=0.645  Sum_probs=16.2

Q ss_pred             CcEEEEeeec-CcCCceeEEe
Q psy11568         96 SGGRLDCAAQ-GSPTPKIEWL  115 (116)
Q Consensus        96 ~~~~l~C~~~-g~P~p~i~W~  115 (116)
                      ....+.|.+. |+|.+.|+|+
T Consensus        16 ~~~va~C~s~~gkPaa~IsW~   36 (95)
T cd07703          16 PVPVAKCVSANGRPPARISWS   36 (95)
T ss_pred             ccEEEEEEcCCCCCCcEEEEE
Confidence            4567889765 7899999997


No 251
>PF08204 V-set_CD47:  CD47 immunoglobulin-like domain;  InterPro: IPR013270 This family represents the CD47 leukocyte antigen V-set like Ig domain [, ].; PDB: 2VSC_B 2JJS_D 2JJT_C.
Probab=89.89  E-value=0.51  Score=27.48  Aligned_cols=22  Identities=9%  Similarity=0.055  Sum_probs=14.5

Q ss_pred             ceEEEEEEEcCCCceEE-EEEEE
Q psy11568         45 STVYRCRASNEAGVILS-RFVHV   66 (116)
Q Consensus        45 ~G~y~C~a~n~~g~~~~-~~~~v   66 (116)
                      .|.|+|.+......... ..|..
T Consensus        97 ~GnYTCeVt~~~~ege~~i~Lk~  119 (130)
T PF08204_consen   97 EGNYTCEVTELSREGETTIELKY  119 (130)
T ss_dssp             -EEEEEEEEETTEEEEEEEEEEE
T ss_pred             ccceEEEEEecCCCceEEEEEEE
Confidence            69999999988754443 33433


No 252
>PHA02982 hypothetical protein; Provisional
Probab=89.19  E-value=4.1  Score=25.92  Aligned_cols=29  Identities=10%  Similarity=0.214  Sum_probs=23.7

Q ss_pred             CCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceE
Q psy11568         26 NGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVIL   60 (116)
Q Consensus        26 ~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~   60 (116)
                      .++|+|.++..+      ..|-|+|.+....+...
T Consensus        99 ~STLTIkk~~i~------N~GCYtc~~ks~~~k~E  127 (251)
T PHA02982         99 SSTFTMKKPDPQ------NLGCFTCEAKDAEGKEE  127 (251)
T ss_pred             ceeEEeccCCcc------cCCceEEEEecCCCchh
Confidence            458999999765      89999999999776554


No 253
>cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI. IG_FcalphaRI : immunoglobulin (IG)-like domain of of FcalphaRI. FcalphaRI (CD89) is an IgA-specific receptor that is expressed on monocytes, eosinophils, neutrophils and macrophages. FcalphaRI mediates IgA-induced immune effector responses such as phagocytosis, antibody-dependent cell-mediated cytotoxicity and respiratory burst. Both monomeric and dimeric IgA can bind to FcalphaRI, and monomeric or dimeric IgA immune complexes can activate phagocytosis and other immune responses through the clustering of FcalphaRI. The Fc RI ectodomain is comprised of two Ig-like domains oriented at about 90 degree to each another.
Probab=87.03  E-value=1.6  Score=23.55  Aligned_cols=33  Identities=12%  Similarity=0.204  Sum_probs=20.6

Q ss_pred             CceEecCCCeEEEeCCCcEEEEeeecCcCCceeEEe
Q psy11568         80 PLFRIEPPYRFEFSNESGGRLDCAAQGSPTPKIEWL  115 (116)
Q Consensus        80 p~~~~~~~~~~~~~~g~~~~l~C~~~g~P~p~i~W~  115 (116)
                      |.+...+  ...+..|++++|.|.... +.-.+.|+
T Consensus         2 P~l~a~p--~~vV~~G~~VTL~C~~~~-~~~~f~l~   34 (94)
T cd05711           2 PFLSAHP--SPVVPSGENVTLQCHSDI-RFDRFILY   34 (94)
T ss_pred             CEEEecC--CCccCCCCeEEEEEecCC-CCCEEEEE
Confidence            4444433  456678999999997654 33345554


No 254
>PHA02987 Ig domain OX-2-like protein; Provisional
Probab=86.48  E-value=1.7  Score=26.95  Aligned_cols=29  Identities=14%  Similarity=0.305  Sum_probs=23.4

Q ss_pred             CeEEEeCCCcEEEEeeec-CcCCceeEEeC
Q psy11568         88 YRFEFSNESGGRLDCAAQ-GSPTPKIEWLI  116 (116)
Q Consensus        88 ~~~~~~~g~~~~l~C~~~-g~P~p~i~W~~  116 (116)
                      ....+.+|+++.|.|... +...+.++|+.
T Consensus        23 ~~v~V~ege~VtLsCs~t~s~~~~qVtWkK   52 (189)
T PHA02987         23 VKITVSEHVNVKISCNKTSSFNSILITWKK   52 (189)
T ss_pred             EEEEEcCCCCEEEEEecCCCCccceEEEEE
Confidence            456778899999999984 66688999973


No 255
>cd05768 IgC_CH4 CH4 domain (fourth constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH4: The fourth immunoglobulin constant domain (IgC), of immunoglobulin (Ig) heavy chains. This domain is found on the Fc fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=86.08  E-value=0.69  Score=25.57  Aligned_cols=22  Identities=27%  Similarity=0.688  Sum_probs=16.7

Q ss_pred             CCCcEEEEeeecCc-CCc-eeEEe
Q psy11568         94 NESGGRLDCAAQGS-PTP-KIEWL  115 (116)
Q Consensus        94 ~g~~~~l~C~~~g~-P~p-~i~W~  115 (116)
                      .++.+.|.|.+.|- |.. .++|+
T Consensus        15 ~~~~~tL~C~a~gFyP~~i~v~W~   38 (102)
T cd05768          15 LQETATLTCLVKGFSPSDIFVKWL   38 (102)
T ss_pred             cCCceEEEEEEeeEeCCCCEEEEE
Confidence            36889999999995 433 55896


No 256
>cd04985 IgC_CH1 CH1 domain (first constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH1: The first immunoglobulin constant domain (IgC), of immunoglobulin (Ig) heavy chains. This domain is found on the Fab antigen-binding fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=85.17  E-value=0.73  Score=25.15  Aligned_cols=10  Identities=10%  Similarity=0.415  Sum_probs=8.6

Q ss_pred             EEEEEccCCee
Q psy11568          3 VLLWLIRDNTV   13 (116)
Q Consensus         3 ~v~W~~~~g~~   13 (116)
                      .|+| ++||++
T Consensus        34 ~vtW-~k~g~~   43 (95)
T cd04985          34 TFTW-NSGSNS   43 (95)
T ss_pred             EEEE-eECCEE
Confidence            5789 999997


No 257
>cd07698 IgC_MHC_I_alpha3 Class I major histocompatibility complex (MHC) alpha chain immunoglobulin domain. IgC_MHC_I_alpha3;  Immunoglobulin (Ig) domain of major histocompatibility complex (MHC) class I alpha chain. Class I MHC proteins bind antigenic peptide fragments and present them to CD8+ T lymphocytes.  Class I molecules consist of a transmembrane alpha chain and a small chain called the beta2 microglobulin. The alpha chain contains three extracellular domains, two of which fold together to form the peptide-binding cleft (alpha1 and alpha2), and one which has an Ig fold (alpha3).  Peptide binding to class I molecules occurs in the endoplasmic reticulum (ER) and involves both chaperones and dedicated factors to assist in peptide loading.  Class I MHC molecules are expressed on most nucleated cells.
Probab=83.46  E-value=1.8  Score=23.31  Aligned_cols=21  Identities=33%  Similarity=0.784  Sum_probs=17.3

Q ss_pred             CCcEEEEeeecCc-CCc-eeEEe
Q psy11568         95 ESGGRLDCAAQGS-PTP-KIEWL  115 (116)
Q Consensus        95 g~~~~l~C~~~g~-P~p-~i~W~  115 (116)
                      ++.+.|.|.+.|- |.+ .++|+
T Consensus        14 ~~~~~L~C~a~gF~P~~i~v~W~   36 (93)
T cd07698          14 DGSLTLSCHATGFYPRDIEVTWL   36 (93)
T ss_pred             CCcEEEEEEEEEEeCCCcEEEEE
Confidence            6789999999995 554 78896


No 258
>PHA03042 CD47-like protein; Provisional
Probab=83.04  E-value=3.1  Score=27.42  Aligned_cols=43  Identities=28%  Similarity=0.315  Sum_probs=24.4

Q ss_pred             EEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCC
Q psy11568          3 VLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAG   57 (116)
Q Consensus         3 ~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g   57 (116)
                      .|.| +.|++.+....+.    ...+|.+..-       ..-.|+|+|.+.+...
T Consensus        52 ~V~W-kf~~~~If~~n~t----n~aSL~~~f~-------~~l~GNYTCEv~~l~n   94 (286)
T PHA03042         52 HINW-KFNNKVIFKKNNT----NTSSLKFNFS-------KNLSGNYTCEAINKFN   94 (286)
T ss_pred             EEEE-EeCCeeEEEecCC----cceEEEEecc-------ccCCCceeEEEeeccc
Confidence            4788 7777766431110    1123444322       2257999999988654


No 259
>cd05890 Ig2_Nectin-1_like Second immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins. Ig2_Nectin-1_like: domain similar to the second immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111). Nectin-1 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through 4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. Nectins also heterophilically trans-interact with other CAMs such as nectin-like molecules (necls); nectin-1 for example, has been shown to trans-interact with necl-1. Nectins also interact with various other proteins, including the actin filament (F-actin)-binding protein, afadin. Mutation in the human nectin-1 gene is associ
Probab=82.83  E-value=1.7  Score=23.96  Aligned_cols=20  Identities=25%  Similarity=0.509  Sum_probs=15.9

Q ss_pred             CcEEEEee-ecCcCCceeEEe
Q psy11568         96 SGGRLDCA-AQGSPTPKIEWL  115 (116)
Q Consensus        96 ~~~~l~C~-~~g~P~p~i~W~  115 (116)
                      ..+.-.|. +.|+|++.|+|.
T Consensus        21 ~v~VA~CiSa~GrPpa~ItW~   41 (98)
T cd05890          21 KMLVATCVSANGKPPSVVRWD   41 (98)
T ss_pred             eEEEEEEEcCCCcCCcEeEEE
Confidence            44566797 788999999995


No 260
>PF05790 C2-set:  Immunoglobulin C2-set domain;  InterPro: IPR008424 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents C2-set domains, which are Ig-like domains resembling the antibody constant domain. C2-set domains are found primarily in the mammalian T-cell surface antigens CD2 (Cluster of Differentiation 2), CD4 and CD80, as well as in vascular (VCAM) and intercellular (ICAM) cell adhesion molecules. CD2 mediates T-cell adhesion via its ectodomain, and signal transduction utilising its 117-amino acid cytoplasmic tail []. CD2 displays structural and functional similarities with African swine fever virus (ASFV) LMW8-DR, a protein that is involved in cell-cell adhesion and immune response modulation, suggesting a possible role in the pathogenesis of ASFV infection []. CD4 is the primary receptor for HIV-1. CD4 has four immunoglobulin-like domains in its extracellular region that share the same structure, but can differ in sequence. Certain extracellular domains may be involved in dimerisation [].; GO: 0007155 cell adhesion, 0016021 integral to membrane; PDB: 1CID_A 1CDU_A 1WIQ_B 2NY4_B 2NY2_B 1WIP_B 1WIO_A 3S4S_G 1CDY_A 3S5L_G ....
Probab=81.62  E-value=6  Score=20.92  Aligned_cols=23  Identities=22%  Similarity=0.205  Sum_probs=16.0

Q ss_pred             eEEecCCCCCCCCCCCCceEEEEEE-EcCC
Q psy11568         28 SLMFPPFPETGFRPDVHSTVYRCRA-SNEA   56 (116)
Q Consensus        28 ~l~i~~v~~~~~~~~~d~G~y~C~a-~n~~   56 (116)
                      .........+      |+|.+.|.| .+..
T Consensus        44 ~~~~~~~~~~------d~G~w~C~a~~~~~   67 (80)
T PF05790_consen   44 LVSTFTPTTE------DSGTWVCTASDNEP   67 (80)
T ss_dssp             EEEEESBTCG------GSEEEEEEEEECTT
T ss_pred             EEEEecCCCC------CCEEEEEEEcCCce
Confidence            4555666444      999999999 4444


No 261
>PHA03189 UL14 tegument protein; Provisional
Probab=80.45  E-value=5.2  Score=26.89  Aligned_cols=23  Identities=43%  Similarity=0.834  Sum_probs=15.9

Q ss_pred             CceEEEEEEEcCC-CceEEEEEEE
Q psy11568         44 HSTVYRCRASNEA-GVILSRFVHV   66 (116)
Q Consensus        44 d~G~y~C~a~n~~-g~~~~~~~~v   66 (116)
                      .+|.|.|...|.. |.+....+.|
T Consensus       144 taG~Y~CvLrN~tHglv~~rf~iv  167 (348)
T PHA03189        144 TAGMYECVLRNETHGLVLQRFVIV  167 (348)
T ss_pred             ccceEEEEeccccceeeeEEeeee
Confidence            7899999999984 5444433333


No 262
>cd07696 IgC_CH3 CH3 domain (third constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH3: The third immunoglobulin constant domain (IgC) of immunoglobulin (Ig) heavy chains. This domain is found on the Fc fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=79.19  E-value=1.7  Score=23.71  Aligned_cols=24  Identities=17%  Similarity=0.446  Sum_probs=18.0

Q ss_pred             EeCCCcEEEEeeecCc--CCc-eeEEe
Q psy11568         92 FSNESGGRLDCAAQGS--PTP-KIEWL  115 (116)
Q Consensus        92 ~~~g~~~~l~C~~~g~--P~p-~i~W~  115 (116)
                      +..++.+.|.|.+.|-  |.. .++|+
T Consensus        11 l~~~~~~tLtC~v~gf~yP~~i~v~W~   37 (96)
T cd07696          11 LLLTKSVKLTCLVTNLTSPEGVNVTWT   37 (96)
T ss_pred             hccCCCeEEEEEEeCCCCCCCcEEEEE
Confidence            3457999999999998  432 56886


No 263
>PHA02914 Immunoglobulin-like domain protein; Provisional
Probab=74.01  E-value=16  Score=25.69  Aligned_cols=27  Identities=19%  Similarity=0.187  Sum_probs=21.7

Q ss_pred             eeCCeEEecCCCCCCCCCCCCceEEEEEEEcCC
Q psy11568         24 LSNGSLMFPPFPETGFRPDVHSTVYRCRASNEA   56 (116)
Q Consensus        24 ~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~   56 (116)
                      +.+++|+|.++...      ..|-|.|++....
T Consensus       343 lk~STLTIkka~I~------N~GCY~~~a~~g~  369 (500)
T PHA02914        343 LKNSTLTIKKAHIN------NAGCYEAQAFMGK  369 (500)
T ss_pred             hhhceEEeeeEEEE------cCCceEEEEecCc
Confidence            34558999999665      8999999998874


No 264
>cd04986 IgC_CH2 CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH2: The second immunoglobulin constant domain (IgC), of immunoglobulin (Ig) heavy chains. This domain is found on the Fc fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=73.79  E-value=4.9  Score=22.24  Aligned_cols=24  Identities=25%  Similarity=0.562  Sum_probs=17.8

Q ss_pred             EeCCCcEEEEeeecC-c-CC-ceeEEe
Q psy11568         92 FSNESGGRLDCAAQG-S-PT-PKIEWL  115 (116)
Q Consensus        92 ~~~g~~~~l~C~~~g-~-P~-p~i~W~  115 (116)
                      ...++.+.|.|.+.+ . |. -.++|.
T Consensus        16 l~~~~~atLtClV~~f~~P~~i~V~W~   42 (99)
T cd04986          16 LLLGSSASLTCTLSGLRDPEGAVFTWT   42 (99)
T ss_pred             hCcCCccEEEEEEeccCCCCCeEEEEE
Confidence            345789999999999 3 53 367886


No 265
>cd05769 IgC_TCR_beta T cell receptor (TCR) beta chain constant immunoglobulin domain. IgC_TCR_beta: Constant domain of the beta chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group includes the variable domain of the beta chain. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The antigen binding site is formed by the variable domains of the alpha and beta chains, located at the N-terminus of each chain. Alpha/beta TCRs recognize antigens differently from gamma/delta TCRs.
Probab=71.55  E-value=4.4  Score=23.01  Aligned_cols=22  Identities=32%  Similarity=0.656  Sum_probs=17.0

Q ss_pred             CCCcEEEEeeecCc-CCc-eeEEe
Q psy11568         94 NESGGRLDCAAQGS-PTP-KIEWL  115 (116)
Q Consensus        94 ~g~~~~l~C~~~g~-P~p-~i~W~  115 (116)
                      .+..+.|.|.+.|- |.. .++|+
T Consensus        17 ~~~~~tL~Cla~gFyP~~I~V~W~   40 (115)
T cd05769          17 NKRKATLVCLATGFYPDHVSLSWK   40 (115)
T ss_pred             cCCCcEEEEEEEeEeCCCcEEEEE
Confidence            46789999999995 543 77896


No 266
>PF11049 KSHV_K1:  Glycoprotein K1 of Kaposi's sarcoma-associated herpes virus;  InterPro: IPR021022  This is a highly glycosylated cytoplasmic and membrane protein similar to the immunoglobulin receptor family that is expressed as an inducible early-lytic-cycle gene product in primary effusion lymphoma cell-lines. This domain would appear to be the cytoplasmic region of the protein []. 
Probab=70.84  E-value=6.8  Score=20.00  Aligned_cols=36  Identities=14%  Similarity=0.353  Sum_probs=22.1

Q ss_pred             EEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCC
Q psy11568          3 VLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEA   56 (116)
Q Consensus         3 ~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~   56 (116)
                      .++| +-||..+.       ++...++.+.++          .++|+|......
T Consensus        12 Pisw-YcN~TRLl-------Rlt~~Tlt~~~l----------tcNFtCV~qSGh   47 (71)
T PF11049_consen   12 PISW-YCNGTRLL-------RLTQQTLTVVTL----------TCNFTCVGQSGH   47 (71)
T ss_pred             cccE-EECCceee-------eecCCeEeeeee----------eEEeeecCCCCC
Confidence            3678 66655443       233446666555          789999876654


No 267
>cd07689 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106) and intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins. Ig2_ VCAM-1_like: domain similar to the second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106). During the inflammation process, these molecules recruit leukocytes onto the vascular endothelium before extravasation to the injured tissues. The interaction of VCAM-1 binding to the beta1 integrin very late antigen (VLA-4) expressed by lymphocytes and monocytes mediates the adhesion of leucocytes to blood vessel walls, and regulates migration across the endothelium. During metastasis, some circulating cancer cells extravasate to a secondary site by a similar process.  VCAM-1 may be involved in organ targeted tumor metastasis and may also act as host receptors for viruses and parasites.  VCAM-1 contains seven Ig domains.
Probab=70.27  E-value=8.2  Score=21.44  Aligned_cols=23  Identities=22%  Similarity=0.339  Sum_probs=17.3

Q ss_pred             eCCCcEEEEeeecCc-CC--ceeEEe
Q psy11568         93 SNESGGRLDCAAQGS-PT--PKIEWL  115 (116)
Q Consensus        93 ~~g~~~~l~C~~~g~-P~--p~i~W~  115 (116)
                      .+|+.+.+.|.+.+. |.  ..+.|+
T Consensus        13 ~~G~~vtv~C~v~~v~P~~~l~v~Ll   38 (99)
T cd07689          13 EEGKPVTVKCEVPDVYPFDRLEIELL   38 (99)
T ss_pred             cCCceEEEEEEecCcccCCceEEEEe
Confidence            679999999999763 54  456774


No 268
>cd05721 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4). IgV_CTLA-4: domain similar to the variable(v)-type immunoglobulin (Ig) domain found in cytotoxic T lymphocyte-associated antigen 4 (CTLA-4).  CTLA-4 is involved in the regulation of T cell response, acting as an inhibitor of intracellular signalling.  CTLA-4 is similar to CD28, a T cell co-receptor protein that recognizes the B7 proteins (CD80 and CD86). CD28 binding of the B7 proteins occurs after the presentation of antigen to the T cell receptor (TCR) via the peptide-MHC complex on the surface of an antigen presenting cell (APC).  CTLA-4 also binds the B7 molecules with a higher affinity than does CD28.  The B7/CTLA-4 interaction generates inhibitory signals down-regulating the response, and may prevent T cell activation by weak TCR signals. CD28 and CTLA-4 then elicit opposing signals in the regulation of T cell responsiveness and homeostasis. T cell activation leads to increased 
Probab=69.68  E-value=5.7  Score=22.69  Aligned_cols=22  Identities=9%  Similarity=0.362  Sum_probs=18.2

Q ss_pred             eEEecCCCCCCCCCCCCceEEEEEEEcC
Q psy11568         28 SLMFPPFPETGFRPDVHSTVYRCRASNE   55 (116)
Q Consensus        28 ~l~i~~v~~~~~~~~~d~G~y~C~a~n~   55 (116)
                      .|.|.+++.+      |.+.|.|....-
T Consensus        75 ~L~l~~L~a~------DTa~Y~Ca~e~m   96 (115)
T cd05721          75 NFTLQNLRAN------QTDIYFCKIELM   96 (115)
T ss_pred             EEEEcCCCHH------HCeEEEEEeeec
Confidence            5899999766      999999987544


No 269
>PF02480 Herpes_gE:  Alphaherpesvirus glycoprotein E;  InterPro: IPR003404 Glycoprotein E (gE) of Alphaherpesvirus forms a complex with glycoprotein I (gI), functioning as an immunoglobulin G (IgG) Fc binding protein. gE is involved in virus spread but is not essential for propagation [].; GO: 0016020 membrane; PDB: 2GJ7_F 2GIY_B.
Probab=66.70  E-value=6.5  Score=27.87  Aligned_cols=86  Identities=23%  Similarity=0.278  Sum_probs=14.0

Q ss_pred             eCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE--EEEEEEeCcEeeeecc---------CCCceEecCCCeEEEe
Q psy11568         25 SNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS--RFVHVKAGSVVSLLDI---------QGPLFRIEPPYRFEFS   93 (116)
Q Consensus        25 ~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~--~~~~v~~~~~~~~~~~---------~~p~~~~~~~~~~~~~   93 (116)
                      ..+.|.|.+++.+      |+|.|+=...+..+....  +.|.|...........         ....+...........
T Consensus        87 ~~~~l~i~~a~~~------~~GvY~l~~~~~~~~~~~~~~~v~v~~~~~~~~~p~p~~p~~p~~~~~~~~~~~~~s~vf~  160 (439)
T PF02480_consen   87 NKGGLSILNATEQ------DSGVYTLYVRNDSGWAHQSVVFVTVKGPAPDPRTPPPHHPIVPHRHGATFHLKNYHSHVFS  160 (439)
T ss_dssp             -----------------------------------------------------------------SEEEEEE--SEEE--
T ss_pred             cCCceEEeccccc------cCeeEEEEecCCCCceEEEEEEEEEcCCCcCCCCCCCCCCCCCcccccEEEEeccceEEec
Confidence            3457999999655      999999998877765553  3344432111100000         0012223333555666


Q ss_pred             CCCcEEEEeeecCcC------CceeEEeC
Q psy11568         94 NESGGRLDCAAQGSP------TPKIEWLI  116 (116)
Q Consensus        94 ~g~~~~l~C~~~g~P------~p~i~W~~  116 (116)
                      .|+++.+.-......      ...|.|++
T Consensus       161 ~Gdtf~~~v~l~~~~~d~~~f~~~i~W~~  189 (439)
T PF02480_consen  161 PGDTFHLSVHLQSEAHDDPPFSLEIDWYY  189 (439)
T ss_dssp             TT--EE---EEEEEESSS--EEEEEEEEE
T ss_pred             CCCcEEEeEEEEeccCCCCCeeEEEEEEE
Confidence            788887766554432      23566763


No 270
>PHA03052 Hypothetical protein; Provisional
Probab=66.69  E-value=16  Score=18.78  Aligned_cols=28  Identities=18%  Similarity=0.292  Sum_probs=19.4

Q ss_pred             CeEEEeCCCcEEEEeeecC-cC--CceeEEe
Q psy11568         88 YRFEFSNESGGRLDCAAQG-SP--TPKIEWL  115 (116)
Q Consensus        88 ~~~~~~~g~~~~l~C~~~g-~P--~p~i~W~  115 (116)
                      ....+..|+++.+.|.+.= .|  .+.+.|.
T Consensus         5 ~~i~~slGs~ltI~Ckv~lg~g~~~a~V~W~   35 (69)
T PHA03052          5 EGIVTSLGSNLTITCKVSLRPPTTDADVFWI   35 (69)
T ss_pred             ccEEEEccCCceEeEEEEecCCCcceEEEEE
Confidence            4566777999999998843 33  4456674


No 271
>PHA03269 envelope glycoprotein C; Provisional
Probab=66.32  E-value=48  Score=24.14  Aligned_cols=71  Identities=13%  Similarity=0.184  Sum_probs=43.7

Q ss_pred             eEEecCCCCCCCCCCCCceEEEEEEEcC-CCceE-EEEEEEEeCcEeeeeccCCCceEecCCCeEEEeCCCcEEEEeeec
Q psy11568         28 SLMFPPFPETGFRPDVHSTVYRCRASNE-AGVIL-SRFVHVKAGSVVSLLDIQGPLFRIEPPYRFEFSNESGGRLDCAAQ  105 (116)
Q Consensus        28 ~l~i~~v~~~~~~~~~d~G~y~C~a~n~-~g~~~-~~~~~v~~~~~~~~~~~~~p~~~~~~~~~~~~~~g~~~~l~C~~~  105 (116)
                      .|.|.++...      ++|.|.=...+. .+... ...+.|..-        ..|.+...+.   .+..|++..-.|.+.
T Consensus       290 pL~I~sltaA------TeGvY~Wrv~~~~n~t~~~~~~VtV~~y--------r~PsVsV~p~---PVL~Ge~YkAtC~vA  352 (566)
T PHA03269        290 SLHILSLDAS------TEGTYIWRVIHTANKNVINEHHITVMSY--------KRPNITVIGD---PVLLGNPYAAYCKVN  352 (566)
T ss_pred             ceEEeecccc------cCceEEEEEecCCCCceeeeeEEEEEEe--------cCCCccccCC---ccccCCCceEEEEee
Confidence            4888999665      999998665433 22222 333444431        0265544442   346799999999987


Q ss_pred             Cc-C--CceeEEe
Q psy11568        106 GS-P--TPKIEWL  115 (116)
Q Consensus       106 g~-P--~p~i~W~  115 (116)
                      .- |  +-.++|+
T Consensus       353 ~YYPp~SvrlrWf  365 (566)
T PHA03269        353 KYYPPHSVIVKWT  365 (566)
T ss_pred             eecCCCceEEEEE
Confidence            75 3  3367897


No 272
>PHA03273 envelope glycoprotein C; Provisional
Probab=65.57  E-value=48  Score=23.87  Aligned_cols=70  Identities=20%  Similarity=0.289  Sum_probs=44.6

Q ss_pred             EEecCCCCCCCCCCCCceEEEEEEEcCCCceE-EEEEEEEeCcEeeeeccCCCceEecCCCeEEEeCCCcEEEEeeecCc
Q psy11568         29 LMFPPFPETGFRPDVHSTVYRCRASNEAGVIL-SRFVHVKAGSVVSLLDIQGPLFRIEPPYRFEFSNESGGRLDCAAQGS  107 (116)
Q Consensus        29 l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~-~~~~~v~~~~~~~~~~~~~p~~~~~~~~~~~~~~g~~~~l~C~~~g~  107 (116)
                      |.|..+...      ++|.|.=...+..+... ...+.|..-        ..|.+...++   .+..|+...-.|.+..-
T Consensus       200 LtI~sltaa------TeGvYtWr~~~~n~t~~~~~~VtV~~y--------r~Psvsv~~~---PvL~Ge~y~A~C~aa~Y  262 (486)
T PHA03273        200 LTIKSVDWR------TAGVYVWSLYAKNGTLVNSTSVTVSTY--------NAPLVDLSVH---PSLKGENYRAVCVVASY  262 (486)
T ss_pred             eEEEecchh------hceEEEEEEecCCCceeeeeEEEEEEe--------cCCcccccCC---ccccCCCceEEEEeeee
Confidence            888888665      89999855445544333 344555431        1266555542   34679999999998775


Q ss_pred             -C--CceeEEe
Q psy11568        108 -P--TPKIEWL  115 (116)
Q Consensus       108 -P--~p~i~W~  115 (116)
                       |  ...+.|+
T Consensus       263 YPp~Sv~~rWf  273 (486)
T PHA03273        263 FPHSSVKLRWY  273 (486)
T ss_pred             cCCCceEEEEE
Confidence             3  3367887


No 273
>KOG4597|consensus
Probab=59.89  E-value=5.4  Score=28.52  Aligned_cols=28  Identities=11%  Similarity=0.083  Sum_probs=25.0

Q ss_pred             CeEEEeCCCcEEEEeeecCcCCceeEEe
Q psy11568         88 YRFEFSNESGGRLDCAAQGSPTPKIEWL  115 (116)
Q Consensus        88 ~~~~~~~g~~~~l~C~~~g~P~p~i~W~  115 (116)
                      ....+..+++..+.|.+.|+|.+.++|.
T Consensus       204 a~w~vg~wetcS~tCg~~G~q~r~V~c~  231 (560)
T KOG4597|consen  204 AEWFVGDWETCSSTCGVQGRQYRVVTCE  231 (560)
T ss_pred             chhhcccchhhcccccccCCcCceeeee
Confidence            5566788999999999999999999995


No 274
>PHA03270 envelope glycoprotein C; Provisional
Probab=59.71  E-value=62  Score=23.17  Aligned_cols=70  Identities=14%  Similarity=0.248  Sum_probs=46.1

Q ss_pred             EEecCCCCCCCCCCCCceEEEEEEEcCCCceE-EEEEEEEeCcEeeeeccCCCceEecCCCeEEEeCCCcEEEEeeecCc
Q psy11568         29 LMFPPFPETGFRPDVHSTVYRCRASNEAGVIL-SRFVHVKAGSVVSLLDIQGPLFRIEPPYRFEFSNESGGRLDCAAQGS  107 (116)
Q Consensus        29 l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~-~~~~~v~~~~~~~~~~~~~p~~~~~~~~~~~~~~g~~~~l~C~~~g~  107 (116)
                      |.|..+...      .+|.|+=...+..+... ...+.|..-        ..|.+...+.   .+..|++..-.|.+...
T Consensus       184 L~I~slt~a------TeGvY~Wr~~~~~~~~~~~~~VtV~~y--------r~Psvsv~~~---PvL~Ge~Y~AtC~va~Y  246 (466)
T PHA03270        184 LVIQELTLA------TQGMYYWARGPADRPHRYGTWTRVRMF--------RRPSLSIRPH---AVLEGEPFGATCVAANY  246 (466)
T ss_pred             EEEEEcccc------cceEEEEEEecCCCceeeeeEEEEEEe--------cCCcccccCC---ccccCCCceEEEEeeee
Confidence            888888665      89999998777654333 333555431        1266555542   34579999999998765


Q ss_pred             -C--CceeEEe
Q psy11568        108 -P--TPKIEWL  115 (116)
Q Consensus       108 -P--~p~i~W~  115 (116)
                       |  .-.+.||
T Consensus       247 YPp~Sv~lrWf  257 (466)
T PHA03270        247 YPGDRAAFRWF  257 (466)
T ss_pred             cCCCceEEEEE
Confidence             3  3367887


No 275
>PHA03282 envelope glycoprotein E; Provisional
Probab=58.40  E-value=12  Score=26.89  Aligned_cols=31  Identities=32%  Similarity=0.418  Sum_probs=24.3

Q ss_pred             cceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcC
Q psy11568         19 DLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNE   55 (116)
Q Consensus        19 ~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~   55 (116)
                      ..|+...|++|.|.+++.+      |+|.|+-.....
T Consensus       116 ~~rvs~~n~tl~l~~a~~~------DsG~Y~L~~~~~  146 (540)
T PHA03282        116 PPRVAVVNGTLVLREARET------DSGMYVLSVSRA  146 (540)
T ss_pred             CcceeEecceEEEeecccc------CCceEEEEecCC
Confidence            3466677889999999766      999999986443


No 276
>PHA03283 envelope glycoprotein E; Provisional
Probab=46.93  E-value=1.2e+02  Score=22.46  Aligned_cols=36  Identities=25%  Similarity=0.222  Sum_probs=26.0

Q ss_pred             CeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE-EEEEEEe
Q psy11568         27 GSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS-RFVHVKA   68 (116)
Q Consensus        27 ~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~-~~~~v~~   68 (116)
                      +.|.|.+.+.+      ++|.|.=..++..+...+ +.|.|..
T Consensus       134 ~~l~I~~at~~------~aGVYtly~r~d~~~~~~vflvtVk~  170 (542)
T PHA03283        134 SVLQIQRATPN------IAGVYTLHVSSDGMMKHSVFFVTVKK  170 (542)
T ss_pred             CeeEEEecccc------cCeEEEEEecCCCceEEEEEEEEecC
Confidence            46889999655      999999999988764443 4455543


No 277
>PHA02914 Immunoglobulin-like domain protein; Provisional
Probab=46.07  E-value=92  Score=22.24  Aligned_cols=22  Identities=14%  Similarity=0.152  Sum_probs=15.5

Q ss_pred             eEEecCCCCCCCCCCCCceEEEEEEEcC
Q psy11568         28 SLMFPPFPETGFRPDVHSTVYRCRASNE   55 (116)
Q Consensus        28 ~l~i~~v~~~~~~~~~d~G~y~C~a~n~   55 (116)
                      ...+.+++..      |+|.|+|.---.
T Consensus        82 sf~~~Nvs~s------dEGrYrCIFYLn  103 (500)
T PHA02914         82 SFIEENIGEH------EDGDFKCIFYLG  103 (500)
T ss_pred             EEEecCcccc------cCCcEEEEEEeC
Confidence            3566777544      999999985444


No 278
>PF15096 G6B:  G6B family
Probab=43.75  E-value=21  Score=22.35  Aligned_cols=15  Identities=20%  Similarity=0.414  Sum_probs=11.7

Q ss_pred             CCCceEEEEEEEcCC
Q psy11568         42 DVHSTVYRCRASNEA   56 (116)
Q Consensus        42 ~~d~G~y~C~a~n~~   56 (116)
                      ..|+|+|.|......
T Consensus        83 ~GDSGTFfCkGr~e~   97 (224)
T PF15096_consen   83 AGDSGTFFCKGRQEE   97 (224)
T ss_pred             cCCccceEecCcccc
Confidence            359999999976654


No 279
>PF06328 Lep_receptor_Ig:  Ig-like C2-type domain;  InterPro: IPR010457 This entry represents a ligand-binding domain that displays similarity to C2-set immunoglobulin domains (antibody constant domain 2) []. The two cysteine residues form a disulphide bridge.; PDB: 3L5H_A 1P9M_A 1I1R_A 2D9Q_B.
Probab=36.87  E-value=72  Score=17.19  Aligned_cols=27  Identities=19%  Similarity=0.268  Sum_probs=17.7

Q ss_pred             EEEeCCCcEEEEeeecCc-----CCceeEEeC
Q psy11568         90 FEFSNESGGRLDCAAQGS-----PTPKIEWLI  116 (116)
Q Consensus        90 ~~~~~g~~~~l~C~~~g~-----P~p~i~W~~  116 (116)
                      ..+..|+++...|...-.     ....|.|.+
T Consensus        13 pvv~lGS~vtasC~l~~~c~~~~~a~~I~Wkl   44 (89)
T PF06328_consen   13 PVVSLGSNVTASCVLKQNCSHSVNASQIVWKL   44 (89)
T ss_dssp             SEEETTS-EEEEEEE-CCCHCT-STTCEEEEC
T ss_pred             CEEeCCCCEEEEEEEECCCCCCcccceEEEEE
Confidence            355679999999987532     456778864


No 280
>COG3738 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=36.36  E-value=36  Score=20.96  Aligned_cols=34  Identities=9%  Similarity=0.125  Sum_probs=16.9

Q ss_pred             EEEEEccCCeeeeccccceEEeeCCeEEecCCCC
Q psy11568          3 VLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPE   36 (116)
Q Consensus         3 ~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~   36 (116)
                      .++|++.||.+....-..+...++..|.+.|+..
T Consensus       146 IvsWRLdngl~HiGv~sd~~~~~g~plViHNIGa  179 (200)
T COG3738         146 IVSWRLDNGLAHIGVVSDGFTRDGTPLVIHNIGA  179 (200)
T ss_pred             eEEEEcCCCCceeEEEecCCCCCCCeEEEeecCC
Confidence            3678777765433211111223344577777743


No 281
>COG5475 Uncharacterized small protein [Function unknown]
Probab=34.76  E-value=63  Score=15.94  Aligned_cols=26  Identities=19%  Similarity=0.390  Sum_probs=19.0

Q ss_pred             eEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568         28 SLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus        28 ~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      ..++....        ..|.|.|..-+.+|...+
T Consensus        19 ~Mtvs~~s--------s~Gmy~C~Wf~g~g~~~~   44 (60)
T COG5475          19 RMTVSGYS--------SDGMYECRWFDGYGVKRE   44 (60)
T ss_pred             eEEEeccc--------cCCeEEEEEecCCCcccc
Confidence            56666663        349999999999885553


No 282
>PF06832 BiPBP_C:  Penicillin-Binding Protein C-terminus Family;  InterPro: IPR009647 This conserved region of approximately 90 residues is found in a sub-group of bacterial Penicillin-Binding Proteins (PBPs). A variable length loop region separates this region from the transpeptidase unit (IPR001460 from INTERPRO). It is predicted to be a beta fold.
Probab=32.07  E-value=84  Score=16.55  Aligned_cols=44  Identities=14%  Similarity=0.189  Sum_probs=25.7

Q ss_pred             cEEEEEccCCeeeeccccceEEeeCCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE
Q psy11568          2 YVLLWLIRDNTVIAYVKDLRIALSNGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS   61 (116)
Q Consensus         2 p~v~W~~~~g~~~~~~~~~~~~~~~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~   61 (116)
                      +.+.| +-||+.+.....      ...+.+..-         ..|.|+-.+....|...+
T Consensus        43 ~~~~W-~vdg~~~g~~~~------~~~~~~~~~---------~~G~h~l~vvD~~G~~~~   86 (89)
T PF06832_consen   43 GPVYW-FVDGEPLGTTQP------GHQLFWQPD---------RPGEHTLTVVDAQGRSAS   86 (89)
T ss_pred             CcEEE-EECCEEcccCCC------CCeEEeCCC---------CCeeEEEEEEcCCCCEEE
Confidence            35788 888887732111      122333221         578888888777776554


No 283
>PHA02935 Hypothetical protein; Provisional
Probab=31.87  E-value=1.3e+02  Score=19.20  Aligned_cols=32  Identities=19%  Similarity=0.298  Sum_probs=20.1

Q ss_pred             EEecCCCCCCCCCCCCceEEEEEEEcCCCceEEEEEEE
Q psy11568         29 LMFPPFPETGFRPDVHSTVYRCRASNEAGVILSRFVHV   66 (116)
Q Consensus        29 l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~~~~~v   66 (116)
                      |-|+.++-+      |+|.|.-...-..|.....+..+
T Consensus       104 lnisslrye------dsgsykgvshlkdgvivtttmni  135 (349)
T PHA02935        104 LNISSLRYE------DSGSYKGVSHLKDGVIVTTTMNI  135 (349)
T ss_pred             eeccceeec------cCCcccCchhhcCceEEEEEEEE
Confidence            445555433      99999887777777665443333


No 284
>PF13220 DUF4028:  Protein of unknown function (DUF4028)
Probab=31.84  E-value=44  Score=16.26  Aligned_cols=16  Identities=25%  Similarity=0.470  Sum_probs=13.1

Q ss_pred             CceEEEEEEEcCCCce
Q psy11568         44 HSTVYRCRASNEAGVI   59 (116)
Q Consensus        44 d~G~y~C~a~n~~g~~   59 (116)
                      .+..|.|...|..|..
T Consensus         9 ssnsflctvqnkng~~   24 (65)
T PF13220_consen    9 SSNSFLCTVQNKNGDQ   24 (65)
T ss_pred             CCCceEEEEecccHhH
Confidence            5678999999988754


No 285
>PF04004 Leo1:  Leo1-like protein;  InterPro: IPR007149 Members of this family are part of the Paf1/RNA polymerase II complex [, ]. The Paf1 complex probably functions during the elongation phase of transcription [].
Probab=31.13  E-value=1.1e+02  Score=18.78  Aligned_cols=29  Identities=21%  Similarity=0.387  Sum_probs=14.5

Q ss_pred             cEEEEEccC---Ceeeeccccce-EEeeCCeEEe
Q psy11568          2 YVLLWLIRD---NTVIAYVKDLR-IALSNGSLMF   31 (116)
Q Consensus         2 p~v~W~~~~---g~~~~~~~~~~-~~~~~~~l~i   31 (116)
                      .+|.|++..   |..+.. +.-+ +.+++|++.+
T Consensus        47 ntIRWR~~~~~~g~~~~e-SNAriVrWsDGS~sL   79 (171)
T PF04004_consen   47 NTIRWRYSPDETGEKVKE-SNARIVRWSDGSLSL   79 (171)
T ss_pred             cEEEEeecCCCCCCEeee-cccEEEEEcCCceEE
Confidence            368895544   444332 1222 4667775443


No 286
>COG4953 PbpC Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell envelope biogenesis, outer membrane]
Probab=30.05  E-value=2.1e+02  Score=22.09  Aligned_cols=24  Identities=13%  Similarity=0.151  Sum_probs=18.8

Q ss_pred             CCceEEEEEEEcCCCceEEEEEEE
Q psy11568         43 VHSTVYRCRASNEAGVILSRFVHV   66 (116)
Q Consensus        43 ~d~G~y~C~a~n~~g~~~~~~~~v   66 (116)
                      .+.|.|.-.+....|...+..+.|
T Consensus       708 ~~~G~~~ltVid~~G~~~svk~~i  731 (733)
T COG4953         708 EDAGYYKLTVIDASGRSASVKFNI  731 (733)
T ss_pred             CCCCeEEEEEEccCCceeeEEEEe
Confidence            379999999999998887755443


No 287
>PHA02865 MHC-like TNF binding protein; Provisional
Probab=29.58  E-value=69  Score=22.12  Aligned_cols=14  Identities=14%  Similarity=0.076  Sum_probs=9.6

Q ss_pred             CCceEEEEEEEcCC
Q psy11568         43 VHSTVYRCRASNEA   56 (116)
Q Consensus        43 ~d~G~y~C~a~n~~   56 (116)
                      .+...|+|......
T Consensus       291 ~~~~~Y~C~V~Hsg  304 (338)
T PHA02865        291 DMSNQIVCVVFHST  304 (338)
T ss_pred             CCCCCcEEEEEeCC
Confidence            36667888877653


No 288
>PHA03281 envelope glycoprotein E; Provisional
Probab=25.86  E-value=2.9e+02  Score=20.77  Aligned_cols=84  Identities=24%  Similarity=0.306  Sum_probs=45.8

Q ss_pred             CCeEEecCCCCCCCCCCCCceEEEEEEEcCCCceE-E-EEEEEEeCcEeeeeccC-------CCceEecCCCeEEEeCCC
Q psy11568         26 NGSLMFPPFPETGFRPDVHSTVYRCRASNEAGVIL-S-RFVHVKAGSVVSLLDIQ-------GPLFRIEPPYRFEFSNES   96 (116)
Q Consensus        26 ~~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~-~-~~~~v~~~~~~~~~~~~-------~p~~~~~~~~~~~~~~g~   96 (116)
                      .+.|.|.+.+..      ++|.|.=..+...|... + +-|.|.... ......+       ...|....-.......|+
T Consensus       297 ~~vL~I~nAT~~------naGVYtly~rg~~G~s~~svfLVtVkg~~-~~rip~p~Vtpk~hga~F~vknYhShVF~pGD  369 (642)
T PHA03281        297 PGVLKFEHMEAH------HAGVYIWNLQGSDGENMYATFLVKLKGDE-ENHIDLPAVTPKPKGAEFHMWHYHSHVFSVGD  369 (642)
T ss_pred             CCeeEEEecccc------cceeEEEEecCCCCcceeEEEEEEecCCc-ccCCCCCCccccccCceEEEeccceeEecCCC
Confidence            457888888655      99999988886666433 3 334443211 0111110       122333332344556788


Q ss_pred             cEEEEeeecCc----C-CceeEEeC
Q psy11568         97 GGRLDCAAQGS----P-TPKIEWLI  116 (116)
Q Consensus        97 ~~~l~C~~~g~----P-~p~i~W~~  116 (116)
                      ++.+.-.....    | ...+.|++
T Consensus       370 TFsl~v~L~s~ihD~pFsleI~Wyy  394 (642)
T PHA03281        370 TFSLAMHLQYKIHDAPFDLLLEWLY  394 (642)
T ss_pred             eeEEEEEEeeeccCCCceeEEEEEE
Confidence            88777665543    2 34667863


No 289
>KOG1026|consensus
Probab=25.77  E-value=50  Score=25.47  Aligned_cols=27  Identities=26%  Similarity=0.565  Sum_probs=23.4

Q ss_pred             eEEEeCCCcEEEEeeecCcCCceeEEe
Q psy11568         89 RFEFSNESGGRLDCAAQGSPTPKIEWL  115 (116)
Q Consensus        89 ~~~~~~g~~~~l~C~~~g~P~p~i~W~  115 (116)
                      ...+..+..+.+.|.+.+.|.|.+.|+
T Consensus       201 ~~~v~~~~~~~~~c~~~~~~vp~~~~~  227 (774)
T KOG1026|consen  201 NLTVEEGSSITLKCSQAGIPVPCHYWF  227 (774)
T ss_pred             hhhhcccchheeeeecccCCCcceeee
Confidence            345667899999999999999999996


No 290
>PHA03286 envelope glycoprotein E; Provisional
Probab=25.33  E-value=2.7e+02  Score=20.30  Aligned_cols=83  Identities=10%  Similarity=0.001  Sum_probs=46.2

Q ss_pred             CeEEecCCCCCCCCCCCCceEEEEEEEcCCCceEE--EEEEEEeCcE--e---e----eeccCCCceEecCCCeEEEeCC
Q psy11568         27 GSLMFPPFPETGFRPDVHSTVYRCRASNEAGVILS--RFVHVKAGSV--V---S----LLDIQGPLFRIEPPYRFEFSNE   95 (116)
Q Consensus        27 ~~l~i~~v~~~~~~~~~d~G~y~C~a~n~~g~~~~--~~~~v~~~~~--~---~----~~~~~~p~~~~~~~~~~~~~~g   95 (116)
                      +.|.|.+.+.+      .+|.|.=..+|.-|....  +-|.|...+.  .   .    ..... ..+............|
T Consensus       127 ~~L~I~nAt~q------naGiYtly~rnd~~~~~~~vflVtV~~~~~~r~p~~~~pv~p~~~~-~~f~l~ny~S~lF~~G  199 (492)
T PHA03286        127 KELTILNASSQ------NAGIYIRYSRNGTRTAVMDVLVVWVSGHGRARDPTMNIPITPPSTR-VDLSLKNFKAFLYNVG  199 (492)
T ss_pred             CceEEeecccc------ccceEEEEEcCCCCcEEEEEEEEEEecCCCCCCCCcccCCCCcccc-eEEEEecccceEecCC
Confidence            36888888655      999999999998776553  4455532100  0   0    00011 2333333355566678


Q ss_pred             CcEEEEeeecC--c--C-CceeEEeC
Q psy11568         96 SGGRLDCAAQG--S--P-TPKIEWLI  116 (116)
Q Consensus        96 ~~~~l~C~~~g--~--P-~p~i~W~~  116 (116)
                      +++.+.-....  .  + ...+.|++
T Consensus       200 DTF~vSv~l~~~~~d~~Fsl~i~W~y  225 (492)
T PHA03286        200 DTVDASVTAHLTNWAGAFSLEFRVLF  225 (492)
T ss_pred             CeEEEEEEEeecccCCCceEEEEEEE
Confidence            88866544431  1  1 44667763


No 291
>TIGR00864 PCC polycystin cation channel protein. Note: this model has been restricted to the amino half because for technical reasons.
Probab=25.19  E-value=5.6e+02  Score=23.79  Aligned_cols=62  Identities=10%  Similarity=-0.026  Sum_probs=35.8

Q ss_pred             CceEEEEE--EEcCCCceE-EEEEEEEeCcEeeeeccCCCceEecCCCeEEEeCCCcEEEEeeecCcCCceeEEe
Q psy11568         44 HSTVYRCR--ASNEAGVIL-SRFVHVKAGSVVSLLDIQGPLFRIEPPYRFEFSNESGGRLDCAAQGSPTPKIEWL  115 (116)
Q Consensus        44 d~G~y~C~--a~n~~g~~~-~~~~~v~~~~~~~~~~~~~p~~~~~~~~~~~~~~g~~~~l~C~~~g~P~p~i~W~  115 (116)
                      ++|.|.-.  |.|..+... +..+.|+.+-         -.+.... ....+..|+.+.|.+.....+.-.+.|.
T Consensus      1838 ~aG~ytV~L~AsN~vs~~~~s~~~~VQe~I---------~~L~L~a-s~~~~~~n~~v~fsa~l~~GS~Vtf~w~ 1902 (2740)
T TIGR00864      1838 DAGTFAIRLNASNAVSGKSASREFFAEEPI---------FGLELKA-SKKIAAIGEKVEFQILLAAGSAVNFRLQ 1902 (2740)
T ss_pred             CCeEEEEEEEEEcccCcceeeeeEEEEEec---------ceEEEec-ccccccCCCEEEEEEEecCCCceEEEEE
Confidence            78888875  778877665 4556665430         0111111 2234455778888776666555555664


No 292
>PHA03270 envelope glycoprotein C; Provisional
Probab=24.34  E-value=2.8e+02  Score=20.11  Aligned_cols=12  Identities=8%  Similarity=0.415  Sum_probs=9.7

Q ss_pred             EEEEEccCCeeee
Q psy11568          3 VLLWLIRDNTVIA   15 (116)
Q Consensus         3 ~v~W~~~~g~~~~   15 (116)
                      .++| +.||.++.
T Consensus       253 ~lrW-f~ng~~V~  264 (466)
T PHA03270        253 AFRW-FEGGDEVF  264 (466)
T ss_pred             EEEE-EeCCcccc
Confidence            4789 99988875


No 293
>PF01688 Herpes_gI:  Alphaherpesvirus glycoprotein I;  InterPro: IPR002874 This family consists of glycoprotein I from various members of the alphaherpesvirinae. These include Human herpesvirus 1 (HHV-1), Human herpesvirus 3 (HHV-3) and Suid herpesvirus 1 (Pseudorabies virus). Glycoprotein I (gI) is important during natural infection, mutants lacking gI produce smaller lesions at the site of infection and show reduced neuronal spread []. gI forms a heterodimeric complex with gE; this complex displays Fc receptor activity (binds to the Fc region of immunoglobulin) []. Glycoproteins are also important in the production of virus-neutralizing antibodies and cell mediated immunity []. The alphaherpesviridae have a dsDNA genome and have no RNA stage during viral replication.; GO: 0033643 host cell part
Probab=23.51  E-value=89  Score=19.10  Aligned_cols=23  Identities=17%  Similarity=0.073  Sum_probs=17.5

Q ss_pred             eEEecCCCCCCCCCCCCceEEEEEEEcCC
Q psy11568         28 SLMFPPFPETGFRPDVHSTVYRCRASNEA   56 (116)
Q Consensus        28 ~l~i~~v~~~~~~~~~d~G~y~C~a~n~~   56 (116)
                      -|.|.+.+.+      |+|.|.-...-..
T Consensus       125 lL~i~~p~~~------dsG~Y~lRV~l~~  147 (161)
T PF01688_consen  125 LLRIRNPRPE------DSGIYYLRVWLDG  147 (161)
T ss_pred             EEEeCCCCcc------cceEEEEEEEECC
Confidence            4888888666      9999988766543


No 294
>PF10461 Peptidase_S68:  Peptidase S68;  InterPro: IPR019502 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ].  This entry contains serine peptidases belonging to MEROPS peptidase family S68 (PIDD auto-processing protein, clan S-). These proteins are known as Pidd (short for p53-induced protein with a death domain) proteins. Pidd forms a complex with Raidd and procaspase-2 that is known as the 'Piddosome'. The Piddosome forms when DNA damage occurs and either activates NF-kappaB, leading to cell survival, or caspase-2, which leads to apoptosis. 
Probab=23.48  E-value=36  Score=14.95  Aligned_cols=7  Identities=29%  Similarity=1.350  Sum_probs=5.1

Q ss_pred             ceeEEeC
Q psy11568        110 PKIEWLI  116 (116)
Q Consensus       110 p~i~W~~  116 (116)
                      |.++||+
T Consensus        24 ~hFSWFl   30 (35)
T PF10461_consen   24 PHFSWFL   30 (35)
T ss_pred             cccEEEE
Confidence            6688874


No 295
>PF10430 Ig_Tie2_1:  Tie-2 Ig-like domain 1;  InterPro: IPR018941 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Tyrosine-protein kinases can transfer a phosphate group from ATP to a tyrosine residue in a protein. These enzymes can be divided into two main groups []:   Receptor tyrosine kinases (RTK), which are transmembrane proteins involved in signal transduction; they play key roles in growth, differentiation, metabolism, adhesion, motility, death and oncogenesis []. RTKs are composed of 3 domains: an extracellular domain (binds ligand), a transmembrane (TM) domain, and an intracellular catalytic domain (phosphorylates substrate). The TM domain plays an important role in the dimerisation process necessary for signal transduction [].      Cytoplasmic / non-receptor tyrosine kinases, which act as regulatory proteins, playing key roles in cell differentiation, motility, proliferation, and survival. For example, the Src-family of protein-tyrosine kinases [].   Angiogenesis is a physiological process whereby new blood vessels are formed from existing ones. It is essential for tissue repair and regeneration during wound healing but also plays important roles in many pathological processes including tumor growth and metastasis [, ]. Angiogenesis is regulated in part by the receptor protein tyrosine kinase Tie2 and its ligands, the angiopoietins. The angiopoietin-binding site is harbord by the N-terminal two immunoglobulin-like (Ig-like) domains of Tie2 []. The angiopoietin-1 receptor contains the Tie-2 Ig-like domain. This protein is a tyrosine-kinase transmembrane receptor for angiopoietin 1. It probably regulates endothelial cell proliferation, differentiation and guides the proper patterning of endothelial cells during blood vessel formation. Tie2 contains not two but three immunoglobulin domains. They fold together with the three epidermal growth factor domains to form a compact, arrowhead-shaped structure [].; GO: 0004714 transmembrane receptor protein tyrosine kinase activity, 0005524 ATP binding, 0006468 protein phosphorylation, 0007169 transmembrane receptor protein tyrosine kinase signaling pathway, 0005887 integral to plasma membrane; PDB: 2GY7_B 2GY5_A.
Probab=21.43  E-value=98  Score=16.94  Aligned_cols=13  Identities=15%  Similarity=0.460  Sum_probs=9.0

Q ss_pred             CceEEEEEEE-cCC
Q psy11568         44 HSTVYRCRAS-NEA   56 (116)
Q Consensus        44 d~G~y~C~a~-n~~   56 (116)
                      .-|.|.|... ++.
T Consensus        74 ~~GayyCegk~r~~   87 (96)
T PF10430_consen   74 AIGAYYCEGKVRDE   87 (96)
T ss_dssp             --EEEEEEEEETTE
T ss_pred             ccceEEEEEEecCc
Confidence            3499999988 443


No 296
>PRK14051 negative regulator GrlR; Provisional
Probab=20.45  E-value=1.3e+02  Score=17.10  Aligned_cols=19  Identities=26%  Similarity=0.508  Sum_probs=15.2

Q ss_pred             EeCCCcEEEEeeecCcCCc
Q psy11568         92 FSNESGGRLDCAAQGSPTP  110 (116)
Q Consensus        92 ~~~g~~~~l~C~~~g~P~p  110 (116)
                      ...+.++.|.|++.++..-
T Consensus        80 ~sn~~~~~l~~HV~~Nekl   98 (123)
T PRK14051         80 LSNDNNLTLHCHVRGNEKL   98 (123)
T ss_pred             eeCCCCeEEEEEEcCCcEE
Confidence            3468999999999997653


No 297
>PF02440 Adeno_E3_CR1:  Adenovirus E3 region protein CR1;  InterPro: IPR003471 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host []. This region called CR1 (conserved region 1) [] is found three times in Human adenovirus 19 (a subgroup D virus) 49 Kd protein in the E3 region. CR1 is also found in the 20.1 Kd protein of subgroup B adenoviruses. The function of this 80 amino acid region is unknown. This region is probably a divergent immunoglobulin domain.
Probab=20.35  E-value=1.4e+02  Score=15.08  Aligned_cols=19  Identities=21%  Similarity=0.345  Sum_probs=10.2

Q ss_pred             eCCCcEEEEeeecCcCCceeEEe
Q psy11568         93 SNESGGRLDCAAQGSPTPKIEWL  115 (116)
Q Consensus        93 ~~g~~~~l~C~~~g~P~p~i~W~  115 (116)
                      ..|+++.|.-.    |...++|+
T Consensus         3 ~~G~N~TL~Gp----~~~~V~Wy   21 (63)
T PF02440_consen    3 TVGSNVTLVGP----PDGPVTWY   21 (63)
T ss_pred             eEcCcEEEeCC----CCCceEEE
Confidence            34666666442    33456675


Done!