Diaphorina citri psyllid: psy11574


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130------
MHIATGASMYQVGQLYSVAEASKNETGGGEGIEVLVNEPFDNVPLLGGKFTKGQYTKKIYHLQRSSRQISRSELICVRKCEKNPPKTSFFGFLALWFSGQNLHHHFRVPGKKTFNLIYRSTSPIYLKKLKEEESWI
cCCccccHHHHHHHHHHHHHHHHHcccccccEEEEEcccccccccccccccccEEEEEEEEEcccHHHHHHHHHcccccCECcccccccccEEEEEEEccccccccccccccCEEccccccccccccccccccccc
MHIATGASMYQVGQLYSV**********GEGIEVLVNEPFDNVPLLGGKFTKGQYTKKIYHLQRSSRQISRSELICVRKCEKNPPKTSFFGFLALWFSGQNLHHHFRVPGKKTFNLIYRSTSPIYLKKL*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHIATGASMYQVGQLYSVAEASKNETGGGEGIEVLVNEPFDNVPLLGGKFTKGQYTKKIYHLQRSSRQISRSELICVRKCEKNPPKTSFFGFLALWFSGQNLHHHFRVPGKKTFNLIYRSTSPIYLKKLKEEESWI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phosphatidylinositol transfer protein alpha isoform Catalyzes the transfer of PtdIns and phosphatidylcholine between membranes.confidentP48738
Phosphatidylinositol transfer protein alpha isoform Catalyzes the transfer of PtdIns and phosphatidylcholine between membranes.confidentP53810
Phosphatidylinositol transfer protein alpha isoform Catalyzes the transfer of PtdIns and phosphatidylcholine between membranes.confidentQ00169

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000003 [BP]reproductionprobableGO:0008150
GO:0006810 [BP]transportprobableGO:0051234, GO:0008150, GO:0051179
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0005622 [CC]intracellularprobableGO:0005575, GO:0044464, GO:0005623
GO:0006915 [BP]apoptotic processprobableGO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1KCM, chain A
Confidence level:very confident
Coverage over the Query: 2-127
View the alignment between query and template
View the model in PyMOL