Query         psy11575
Match_columns 80
No_of_seqs    104 out of 224
Neff          4.9 
Searched_HMMs 46136
Date          Fri Aug 16 22:01:05 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy11575.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/11575hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3668|consensus              100.0 9.5E-40 2.1E-44  243.6   9.2   80    1-80    189-268 (269)
  2 cd08888 SRPBCC_PITPNA-B_like L 100.0 1.7E-39 3.7E-44  242.4   8.9   69    1-69    189-257 (258)
  3 cd08890 SRPBCC_PITPNC1_like Li 100.0 5.5E-39 1.2E-43  238.9   8.2   69    1-69    181-249 (250)
  4 cd07815 SRPBCC_PITP Lipid-bind 100.0 9.2E-39   2E-43  237.8   8.9   69    1-69    182-250 (251)
  5 cd08889 SRPBCC_PITPNM1-2_like  100.0 1.5E-38 3.2E-43  237.6   8.1   69    1-69    190-259 (260)
  6 PF02121 IP_trans:  Phosphatidy 100.0 5.7E-38 1.2E-42  233.5   8.5   65    1-65    189-254 (254)
  7 PF10698 DUF2505:  Protein of u  87.9     1.6 3.4E-05   29.8   5.0   37    7-43    123-159 (159)
  8 PF10544 T5orf172:  T5orf172 do  63.3      12 0.00027   22.5   3.3   37   16-57     56-95  (100)
  9 PF08671 SinI:  Anti-repressor   60.6       6 0.00013   20.9   1.3   11   47-57     15-25  (30)
 10 cd03495 SQR_TypeC_SdhD_like Su  56.7      16 0.00035   23.4   3.1   31   13-43     60-90  (100)
 11 PF09510 Rtt102p:  Rtt102p-like  53.2     6.8 0.00015   26.9   0.9    8   48-55    110-117 (130)
 12 PF10471 APC_CDC26:  Anaphase-p  51.2     3.8 8.3E-05   25.2  -0.5   21   47-67      9-29  (79)
 13 PF05914 RIB43A:  RIB43A;  Inte  38.7      43 0.00093   26.5   3.5   21   43-63    271-291 (379)
 14 PF04707 PRELI:  PRELI-like fam  37.0   1E+02  0.0022   21.0   4.7   39    3-42    108-149 (157)
 15 PF09278 MerR-DNA-bind:  MerR,   36.6      23 0.00049   20.1   1.3   12   47-58     13-24  (65)
 16 cd01104 HTH_MlrA-CarA Helix-Tu  36.1      52  0.0011   18.5   2.8   18   39-58     50-67  (68)
 17 PF15581 Imm35:  Immunity prote  32.4      27 0.00059   23.0   1.2   12   44-55     41-52  (93)
 18 cd04763 HTH_MlrA-like Helix-Tu  32.3      61  0.0013   18.6   2.7   19   37-57     48-66  (68)
 19 cd01388 SOX-TCF_HMG-box SOX-TC  31.5      88  0.0019   18.2   3.3   28   44-71     38-65  (72)
 20 PF14045 YIEGIA:  YIEGIA protei  29.6      43 0.00092   26.1   2.1   17   51-67     71-87  (285)
 21 PF13455 MUG113:  Meiotically u  29.4      40 0.00086   21.1   1.6   38   16-57     37-79  (83)
 22 PF06868 DUF1257:  Protein of u  28.4      51  0.0011   21.5   2.0   24    3-27     48-71  (105)
 23 PF09346 SMI1_KNR4:  SMI1 / KNR  27.9      45 0.00097   20.1   1.6   18   48-65      1-18  (130)
 24 cd01389 MATA_HMG-box MATA_HMG-  27.7 1.2E+02  0.0025   17.9   3.4   27   44-70     38-64  (77)
 25 PF11460 DUF3007:  Protein of u  27.4 1.1E+02  0.0024   20.5   3.5   23   48-70     61-88  (104)
 26 PF01486 K-box:  K-box region;   27.2      83  0.0018   19.7   2.8   39   31-71     30-68  (100)
 27 PF09011 HMG_box_2:  HMG-box do  26.9      86  0.0019   18.3   2.7   25   43-67     40-64  (73)
 28 PTZ00285 glucosamine-6-phospha  26.9      24 0.00053   25.6   0.3   32   34-65     62-93  (253)
 29 TIGR00496 frr ribosome recycli  26.6   1E+02  0.0023   21.8   3.5   42   29-70    116-160 (176)
 30 PF10666 Phage_Gp14:  Phage pro  25.1 1.1E+02  0.0024   21.4   3.3   28   43-70     56-83  (140)
 31 PF07078 FYTT:  Forty-two-three  24.8      64  0.0014   25.5   2.3   20   44-64     27-46  (316)
 32 KOG0717|consensus               23.7 2.1E+02  0.0045   24.1   5.1   39    9-49    136-175 (508)
 33 cd04764 HTH_MlrA-like_sg1 Heli  23.6 1.1E+02  0.0023   17.4   2.7   18   38-57     48-65  (67)
 34 PF01452 Rota_NSP4:  Rotavirus   23.4   3E+02  0.0064   20.0   6.2   38    2-39     63-110 (173)
 35 PF14048 MBD_C:  C-terminal dom  23.0 1.2E+02  0.0027   19.6   3.1   20   46-65     70-89  (96)
 36 PF00505 HMG_box:  HMG (high mo  22.7 1.1E+02  0.0024   17.0   2.6   25   44-68     37-61  (69)
 37 PF10642 Tom5:  Mitochondrial i  22.3 1.7E+02  0.0038   16.9   3.4   21   49-69      9-29  (49)
 38 COG0233 Frr Ribosome recycling  21.8 1.3E+02  0.0029   22.0   3.3   23   48-70    149-171 (187)
 39 smart00760 Bac_DnaA_C Bacteria  21.5      80  0.0017   18.0   1.8   23   34-56     30-53  (60)
 40 cd03081 TRX_Fd_NuoE_FDH_gamma   20.0      70  0.0015   19.3   1.4   14   44-57     62-76  (80)

No 1  
>KOG3668|consensus
Probab=100.00  E-value=9.5e-40  Score=243.64  Aligned_cols=80  Identities=66%  Similarity=1.145  Sum_probs=78.4

Q ss_pred             CeeeeEeEEEeeccchhHHHHHHHHHHHHHHHHHHHHHHHHHhhcccCCCHHHHHHHHHHHHHHHHHHHhhcccccccCC
Q psy11575          1 MTCYKLVTAEFKWFGFQGRVENFIHKAERRLFTNFHRQVFCWIDRWHDLTMEDIRRIEEETKKELDRQRLEGEVRGMKAD   80 (80)
Q Consensus         1 M~~YKlv~v~f~~~Glq~~vE~~i~~~~r~i~~~~HRq~fcwiDeW~~lTmedIR~~E~et~~~l~~~~~~~~~~~~~~~   80 (80)
                      |||||||+|+|+|||+|++||+|||++.+++|+++|||||||+|+||||||+|||++|++||..|+++++.++++|+.++
T Consensus       189 McaYKlvtvefk~wGmQ~~VE~fIhk~~~rv~~~~HRqafcw~D~W~gltm~diRe~E~~t~~~l~~~~~~~~~~~~~~~  268 (269)
T KOG3668|consen  189 MCAYKLVTVEFKWWGMQTKVENFIHKVERRVFTRAHRQAFCWQDEWYGLTMEDIRELEDETQLELIKKRAKGEVRGMGAD  268 (269)
T ss_pred             EEEeeEEEEEEEeehHHHHHHHHHHHHHHHHHHHHHHHHheehhhhhCccHHHHHHHHHHHHHHHHHHhccCCcccccCC
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999998764


No 2  
>cd08888 SRPBCC_PITPNA-B_like Lipid-binding SRPBCC domain of mammalian PITPNA, -B, and related proteins (Class I PITPs). This subgroup includes the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain of mammalian Class 1 phosphatidylinositol transfer proteins (PITPs), PITPNA/PITPalpha and PITPNB/PITPbeta, Drosophila vibrator, and related proteins. These are single domain proteins belonging to the PITP family of lipid transfer proteins, and to the SRPBCC domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. In vitro, PITPs bind phosphatidylinositol (PtdIns), as well as phosphatidylcholine (PtdCho) but with a lower affinity. They transfer these lipids from one membrane compartment to another. The cellular roles of PITPs include inositol lipid signaling, PtdIns metabolism, and membrane trafficking. In addition, PITPNB transfers sphingomyelin in vitro, with a low affinity. PITPNA is found chiefly in the nucleus and cy
Probab=100.00  E-value=1.7e-39  Score=242.40  Aligned_cols=69  Identities=75%  Similarity=1.369  Sum_probs=67.9

Q ss_pred             CeeeeEeEEEeeccchhHHHHHHHHHHHHHHHHHHHHHHHHHhhcccCCCHHHHHHHHHHHHHHHHHHH
Q psy11575          1 MTCYKLVTAEFKWFGFQGRVENFIHKAERRLFTNFHRQVFCWIDRWHDLTMEDIRRIEEETKKELDRQR   69 (80)
Q Consensus         1 M~~YKlv~v~f~~~Glq~~vE~~i~~~~r~i~~~~HRq~fcwiDeW~~lTmedIR~~E~et~~~l~~~~   69 (80)
                      |||||||+|+|+|||||++||+|||+++|++|+++||||||||||||||||||||++|++||++|++.+
T Consensus       189 McaYKLv~v~f~~wG~q~rvE~fI~~~~r~~fl~~HRq~fcW~DeW~gltmedIR~~E~~t~~~l~~~~  257 (258)
T cd08888         189 MCAYKLVTVEFKWWGLQNKVENFIQKQERRLFTNFHRQVFCWLDKWHGLTMDDIRRMEDETKKELDEMR  257 (258)
T ss_pred             EEEeEEEEEEEeeecccHHHHHHHHHHHHHHHHHHHHHHhhhHHHHcCCCHHHHHHHHHHHHHHHHHhh
Confidence            899999999999999999999999999999999999999999999999999999999999999999875


No 3  
>cd08890 SRPBCC_PITPNC1_like Lipid-binding SRPBCC domain of mammalian PITPNC1,and related proteins (Class IIB PITPs). This subgroup includes the N-terminal SRPBCC (START/RHO_alpha_C /PITP /Bet_v1/CoxG/CalC) domain of mammalian Class IIB phosphatidylinositol transfer protein (PITP), PITPNC1/RdgBbeta, and related proteins. These are metazoan proteins belonging to the PITP family of lipid transfer proteins, and to the SRPBCC domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. In vitro, PITPs bind phosphatidylinositol (PtdIns), as well as phosphatidylcholine (PtdCho) but with a lower affinity. They transfer these lipids from one membrane compartment to another. The cellular roles of PITPs include inositol lipid signaling, PtdIns metabolism, and membrane trafficking. Mammalian PITPNC1 contains an amino-terminal SRPBCC PITP-like domain and a short carboxyl-terminal domain. It is a cytoplasmic protein, and is ubiquitously 
Probab=100.00  E-value=5.5e-39  Score=238.87  Aligned_cols=69  Identities=42%  Similarity=0.808  Sum_probs=67.4

Q ss_pred             CeeeeEeEEEeeccchhHHHHHHHHHHHHHHHHHHHHHHHHHhhcccCCCHHHHHHHHHHHHHHHHHHH
Q psy11575          1 MTCYKLVTAEFKWFGFQGRVENFIHKAERRLFTNFHRQVFCWIDRWHDLTMEDIRRIEEETKKELDRQR   69 (80)
Q Consensus         1 M~~YKlv~v~f~~~Glq~~vE~~i~~~~r~i~~~~HRq~fcwiDeW~~lTmedIR~~E~et~~~l~~~~   69 (80)
                      |||||||+|+|+|||||++||+||++++|++|+++||||||||||||||||||||++|++||++|++++
T Consensus       181 McaYKLv~v~f~~wG~q~rvE~~I~~~~r~~~l~~HRq~fcW~DeW~gltmedIR~~E~e~~~~l~~k~  249 (250)
T cd08890         181 MCSYKLVTVKFEVWGLQTRVEQFVHKVVRDILLLGHRQAFAWVDEWYDMTMDDVREYERTIQEKTNEKI  249 (250)
T ss_pred             EEEEEEEEEEEeeecccHHHHHHHHHHHHHHHHHHHHHHheeHHHHcCCCHHHHHHHHHHHHHHHHhhc
Confidence            899999999999999999999999999999999999999999999999999999999999999999853


No 4  
>cd07815 SRPBCC_PITP Lipid-binding SRPBCC domain of Class I and Class II Phosphatidylinositol Transfer Proteins. This family includes the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain of the phosphatidylinositol transfer protein (PITP) family of lipid transfer proteins. This family of proteins includes Class 1 PITPs (PITPNA/PITPalpha and PITPNB/PITPbeta, Drosophila vibrator and related proteins), Class IIA  PITPs (PITPNM1/PITPalphaI/Nir2,  PITPNM2/PITPalphaII/Nir3, Drosophila RdgB, and related proteins), and Class IIB  PITPs (PITPNC1/RdgBbeta and related proteins). The PITP family belongs to the SRPBCC domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. In vitro, PITPs bind phosphatidylinositol (PtdIns), as well as phosphatidylcholine (PtdCho) but with a lower affinity. They transfer these lipids from one membrane compartment to another. The cellular roles of PITPs include inositol lipid signaling, PtdIns 
Probab=100.00  E-value=9.2e-39  Score=237.76  Aligned_cols=69  Identities=64%  Similarity=1.157  Sum_probs=68.0

Q ss_pred             CeeeeEeEEEeeccchhHHHHHHHHHHHHHHHHHHHHHHHHHhhcccCCCHHHHHHHHHHHHHHHHHHH
Q psy11575          1 MTCYKLVTAEFKWFGFQGRVENFIHKAERRLFTNFHRQVFCWIDRWHDLTMEDIRRIEEETKKELDRQR   69 (80)
Q Consensus         1 M~~YKlv~v~f~~~Glq~~vE~~i~~~~r~i~~~~HRq~fcwiDeW~~lTmedIR~~E~et~~~l~~~~   69 (80)
                      |||||||+|+|+|||||++||+||++++|++|+++|||||||+||||||||||||++|++||++|++++
T Consensus       182 McaYKLv~v~f~~wG~q~rvE~~I~~~~r~~~l~~HRq~fcW~DeW~gltmedIR~~E~e~~~~L~~~~  250 (251)
T cd07815         182 MCAYKLVTVDFPYWGLQNKVENFIQKVERDVFLNYHRQAFCWIDEWFDLTMEDIREFEEETKELLDAKR  250 (251)
T ss_pred             EEEEEEEEEEeeeecccHHHHHHHHHHHHHHHHHHHHHHHhhHHHHcCCCHHHHHHHHHHHHHHHHHhh
Confidence            899999999999999999999999999999999999999999999999999999999999999999876


No 5  
>cd08889 SRPBCC_PITPNM1-2_like Lipid-binding SRPBCC domain of mammalian PITPNM1-2 and related proteins (Class IIA PITPs). This subgroup includes an N-terminal SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain of mammalian Class II phosphatidylinositol transfer protein (PITPs), PITPNM1/PITPalphaI/Nir2 (PYK2 N-terminal domain-interacting receptor2) and   PITPNM2/PITPalphaII/Nir3), Drosophila RdgB, and related proteins. These are membrane associated multidomain proteins belonging to the PITP family of lipid transfer proteins, and to the SRPBCC domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. In vitro, PITPs bind phosphatidylinositol (PtdIns), as well as phosphatidylcholine (PtdCho) but with a lower affinity. They transfer these lipids from one membrane compartment to another. The cellular roles of PITPs include inositol lipid signaling, PtdIns metabolism, and membrane trafficking. Ablation of the mouse gene en
Probab=100.00  E-value=1.5e-38  Score=237.61  Aligned_cols=69  Identities=46%  Similarity=0.938  Sum_probs=67.1

Q ss_pred             CeeeeEeEEEeeccchhHHHHHHHHHHH-HHHHHHHHHHHHHHhhcccCCCHHHHHHHHHHHHHHHHHHH
Q psy11575          1 MTCYKLVTAEFKWFGFQGRVENFIHKAE-RRLFTNFHRQVFCWIDRWHDLTMEDIRRIEEETKKELDRQR   69 (80)
Q Consensus         1 M~~YKlv~v~f~~~Glq~~vE~~i~~~~-r~i~~~~HRq~fcwiDeW~~lTmedIR~~E~et~~~l~~~~   69 (80)
                      |||||||+|+|+|||||++||+|||++. |++|+++|||||||+||||||||||||++|++||++|++.+
T Consensus       190 McaYKLv~v~f~~wG~q~rvE~fI~~~~lr~~~l~~HRq~fcW~DeW~gltmedIR~~E~etq~~L~~k~  259 (260)
T cd08889         190 MCAYKLCKVEFRYWGMQTKIERFIHDVALRKVMLRAHRQAWCWQDEWYGLTMEDIRKLEEETQLALAQKM  259 (260)
T ss_pred             EEEeEEEEEEEeeecchHHHHHHHHHhhhHHHHHHHHHHHheeHHHHcCCCHHHHHHHHHHHHHHHHhhc
Confidence            8999999999999999999999999997 99999999999999999999999999999999999999853


No 6  
>PF02121 IP_trans:  Phosphatidylinositol transfer protein;  InterPro: IPR001666 Phosphatidylinositol transfer protein (PITP) is a ubiquitous cytosolic protein, thought to be involved in transport of phospholipids from their site of synthesis in the endoplasmic reticulum and Golgi to other cell membranes []. More recently, PITP has been shown to be an essential component of the polyphosphoinositide synthesis machinery and is hence required for proper signalling by epidermal growth factor and f-Met-Leu-Phe, as well as for exocytosis. The role of PITP in polyphosphoinositide synthesis may also explain its involvement in intracellular vesicular traffic [].; GO: 0006810 transport, 0005622 intracellular; PDB: 1T27_A 1KCM_A 2A1L_A 1UW5_C.
Probab=100.00  E-value=5.7e-38  Score=233.52  Aligned_cols=65  Identities=72%  Similarity=1.329  Sum_probs=60.1

Q ss_pred             CeeeeEeEEEeeccchhHHHHHHHHHHH-HHHHHHHHHHHHHHhhcccCCCHHHHHHHHHHHHHHH
Q psy11575          1 MTCYKLVTAEFKWFGFQGRVENFIHKAE-RRLFTNFHRQVFCWIDRWHDLTMEDIRRIEEETKKEL   65 (80)
Q Consensus         1 M~~YKlv~v~f~~~Glq~~vE~~i~~~~-r~i~~~~HRq~fcwiDeW~~lTmedIR~~E~et~~~l   65 (80)
                      |||||||+|+|+|||||++||+||++++ |++|+++|||||||+||||||||||||++|++||++|
T Consensus       189 Mc~YKlv~v~f~~~GlQ~~vE~~I~~~~~r~i~~~~HRq~fcw~DeW~glTmedIR~~E~et~~~L  254 (254)
T PF02121_consen  189 MCCYKLVTVEFKWWGLQTKVENFIHKQILRRIFLNFHRQAFCWIDEWYGLTMEDIRELEEETQEEL  254 (254)
T ss_dssp             EEEEEEEEEEE--TTTHHHHHHHHHHHH-HHHHHHHHHHHHHTHHHHTT--HHHHHHHHHHHHHHH
T ss_pred             EEEEEEEEEEeeeechHHHHHHHHHHhhhhHHHHHHHHHHheehhhhcCCCHHHHHHHHHHHHhcC
Confidence            8999999999999999999999999998 9999999999999999999999999999999999987


No 7  
>PF10698 DUF2505:  Protein of unknown function (DUF2505);  InterPro: IPR019639  This entry represents proteins found Actinobacteria and Proteobacteria. The function is not known. 
Probab=87.92  E-value=1.6  Score=29.77  Aligned_cols=37  Identities=16%  Similarity=0.220  Sum_probs=32.1

Q ss_pred             eEEEeeccchhHHHHHHHHHHHHHHHHHHHHHHHHHh
Q psy11575          7 VTAEFKWFGFQGRVENFIHKAERRLFTNFHRQVFCWI   43 (80)
Q Consensus         7 v~v~f~~~Glq~~vE~~i~~~~r~i~~~~HRq~fcwi   43 (80)
                      .+|+++++.++.++|++|...+.+.+-.-++.+=.||
T Consensus       123 g~v~v~VPlvGgkiE~~v~~~~~~~~~~e~~~~~~wl  159 (159)
T PF10698_consen  123 GEVKVKVPLVGGKIEKAVAENLRKLLEAEQEFTAEWL  159 (159)
T ss_pred             EEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHhhC
Confidence            5788889999999999999999999988888776664


No 8  
>PF10544 T5orf172:  T5orf172 domain;  InterPro: IPR018306 This entry represents a DNA-binding domain found in bacteriophage T5, ORF172 []. The domain is related to the Bro-N and KilA-N domains that are widespread in large-DNA viruses infecting bacteria and eukaryotes []. 
Probab=63.28  E-value=12  Score=22.47  Aligned_cols=37  Identities=24%  Similarity=0.382  Sum_probs=25.2

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHH---HhhcccCCCHHHHHHH
Q psy11575         16 FQGRVENFIHKAERRLFTNFHRQVFC---WIDRWHDLTMEDIRRI   57 (80)
Q Consensus        16 lq~~vE~~i~~~~r~i~~~~HRq~fc---wiDeW~~lTmedIR~~   57 (80)
                      -...+|+.||+.+++     ||.-+-   =--|||.++.+++++.
T Consensus        56 ~~~~~E~~ih~~l~~-----~~~~~~~~~~~~E~F~~~~~~~~~~   95 (100)
T PF10544_consen   56 DARKVERLIHRELKD-----YRYRIPCPDGHTEWFKLDPEEVRAV   95 (100)
T ss_pred             CHHHHHHHHHHHHHH-----hCccccCCCCCCEEEECCHHHHHHH
Confidence            357899999987665     222210   0469999999988864


No 9  
>PF08671 SinI:  Anti-repressor SinI;  InterPro: IPR010981 The SinR repressor is part of a group of Sin (sporulation inhibition) proteins in Bacillus subtilis that regulate the commitment to sporulation in response to extreme adversity []. SinR is a tetrameric repressor protein that binds to the promoters of genes essential for entry into sporulation and prevents their transcription. This repression is overcome through the activity of SinI, which disrupts the SinR tetramer through the formation of a SinI-SinR heterodimer, thereby allowing sporulation to proceed. The SinR structure consists of two domains: a dimerisation domain stabilised by a hydrophobic core, and a DNA-binding domain that is identical to domains of the bacteriophage 434 CI and Cro proteins that regulate prophage induction. The dimerisation domain is a four-helical bundle formed from two helices from the C-terminal residues of SinR and two helices from the central residues of SinI. These regions in SinR and SinI are similar in both structure and sequence. The interaction of SinR monomers to form tetramers is weaker than between SinR and SinI, since SinI can effectively disrupt SinR tetramers. This entry represents the dimerisation domain in both SinI and SinR proteins.; GO: 0005488 binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1B0N_A 2YAL_A.
Probab=60.58  E-value=6  Score=20.92  Aligned_cols=11  Identities=36%  Similarity=0.619  Sum_probs=7.7

Q ss_pred             cCCCHHHHHHH
Q psy11575         47 HDLTMEDIRRI   57 (80)
Q Consensus        47 ~~lTmedIR~~   57 (80)
                      -|+|.||||++
T Consensus        15 ~Gls~eeir~F   25 (30)
T PF08671_consen   15 SGLSKEEIREF   25 (30)
T ss_dssp             TT--HHHHHHH
T ss_pred             cCCCHHHHHHH
Confidence            48999999986


No 10 
>cd03495 SQR_TypeC_SdhD_like Succinate:quinone oxidoreductase (SQR) Type C subfamily, Succinate dehydrogenase D (SdhD) subunit-like; composed of predominantly uncharacterized bacterial proteins with similarity to the E. coli SdhD subunit. One characterized protein is the respiratory Complex II SdhD subunit of the only eukaryotic member, Reclinomonas americana. SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol. It is also called succinate dehydrogenase or Complex II, and is part of the citric acid cycle and the aerobic respiratory chain. SQR is composed of a flavoprotein catalytic subunit, an iron-sulfur protein and one or two hydrophobic transmembrane subunits. E. coli SQR is classified as Type C SQRs because it contains two transmembrane subunits and one heme group. The SdhD and SdhC subunits are membrane anchor subunits containing heme and quinone binding sites. The two-electron oxidation of succinate in the flavoprotein active site is 
Probab=56.69  E-value=16  Score=23.39  Aligned_cols=31  Identities=23%  Similarity=0.377  Sum_probs=24.3

Q ss_pred             ccchhHHHHHHHHHHHHHHHHHHHHHHHHHh
Q psy11575         13 WFGFQGRVENFIHKAERRLFTNFHRQVFCWI   43 (80)
Q Consensus        13 ~~Glq~~vE~~i~~~~r~i~~~~HRq~fcwi   43 (80)
                      +-|+|..+|++||+..-|..+..=-..||+.
T Consensus        60 ~~Gm~~IieDYV~~~~~R~~l~~~~~~~~~~   90 (100)
T cd03495          60 RLGMQVVIEDYVHSEGLRLALIIAVKLFAIA   90 (100)
T ss_pred             HHHHHHHHHHHhCchHHHHHHHHHHHHHHHH
Confidence            4589999999999887677777666777763


No 11 
>PF09510 Rtt102p:  Rtt102p-like transcription regulator protein;  InterPro: IPR018304 Rtt102p (Regulator of Ty1 Transposition Protein 102) is a transcription regulator protein found in fungi that appears to be integrally associated with both the Swi-Snf and the RSC chromatin remodelling complexes, []. RSC is involved in transcription regulation and nucleosome positioning, and is responsible for the transfer of a histone octamer from a nucleosome core particle to naked DNA. The reaction requires ATP and involves an activated RSC-nucleosome intermediate. Remodelling reaction also involves DNA translocation, DNA twist and conformational change. As a reconfigurer of centromeric and flanking nucleosomes, RSC complex is required both for proper kinetochore function in chromosome segregation and, via a PKC1-dependent signalling pathway, for organisation of the cellular cytoskeleton. It is a probable component of the SWI/SNF complex, an ATP-dependent chromatin-remodelling complex, is required for the positive and negative regulation of gene expression of a large number of genes. It changes chromatin structure by altering DNA-histone contacts within a nucleosome, leading eventually to a change in nucleosome position, thus facilitating or repressing binding of gene-specific transcription factors.
Probab=53.24  E-value=6.8  Score=26.92  Aligned_cols=8  Identities=63%  Similarity=1.028  Sum_probs=7.3

Q ss_pred             CCCHHHHH
Q psy11575         48 DLTMEDIR   55 (80)
Q Consensus        48 ~lTmedIR   55 (80)
                      +|||+|||
T Consensus       110 ~LT~dDIR  117 (130)
T PF09510_consen  110 SLTVDDIR  117 (130)
T ss_pred             CCCHHHhh
Confidence            69999999


No 12 
>PF10471 APC_CDC26:  Anaphase-promoting complex APC subunit 1;  InterPro: IPR018860  The anaphase-promoting complex (APC) or cyclosome is a multi-subunit E3 protein ubiquitin ligase that regulates important events in mitosis such as the initiation of anaphase and exit from telophase. The APC, in conjunction with other enzymes, assembles multi-ubiquitin chains on a variety of regulatory proteins, thereby targeting them for proteolysis by the 26S proteasome. Anaphase is initiated when the APC triggers the destruction of securin, thereby allowing the protease, separase, to disrupt sister-chromatid cohesion. Securin ubiquitination by the APC is inhibited by cyclin-dependent kinase 1 (Cdk1)-dependent phosphorylation []. Forkhead Box M1 (FoxM1), which is a transcription factor that is over-expressed in many cancers, is degraded in late mitosis and early G1 phase by the APC/cyclosome (APC/C) E3 ubiquitin ligase []. The APC/C targets mitotic cyclins for destruction in mitosis and G1 phase and is then inactivated at S phase. It thereby generates alternating states of high and low cyclin-Cdk activity, which is required for the alternation of mitosis and DNA replication []. The APC/C is composed of at least 13 subunits that stay tightly associated throughout the cell cycle: APC1, APC2, APC4, APC5, APC9, APC11, CDC16, CDC23, CDC26, CDC27, DOC1, MND2 and SWM1[], []. In fission yeast the 13 subunits are known as: Apc1, Apc2, Nuc2, Apc4, Apc5, Cut9, Apc8, Apc10, Apc11, Hcn1, Apc13, Apc14 and Apc15 []. This entry represents subunit CDC26, whose exact function is not known [].; GO: 0030071 regulation of mitotic metaphase/anaphase transition, 0031145 anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process, 0005680 anaphase-promoting complex; PDB: 2XPI_E 3HYM_A.
Probab=51.21  E-value=3.8  Score=25.21  Aligned_cols=21  Identities=33%  Similarity=0.465  Sum_probs=11.9

Q ss_pred             cCCCHHHHHHHHHHHHHHHHH
Q psy11575         47 HDLTMEDIRRIEEETKKELDR   67 (80)
Q Consensus        47 ~~lTmedIR~~E~et~~~l~~   67 (80)
                      +-||.|||-+||+..++...+
T Consensus         9 I~Lt~eDi~eye~~~~~~~~~   29 (79)
T PF10471_consen    9 IELTLEDIAEYEDRRKEQKLQ   29 (79)
T ss_dssp             ----CHHHHHHCCCHHH----
T ss_pred             EEecHHHHHHHHHHHHHHHHH
Confidence            458999999999988777533


No 13 
>PF05914 RIB43A:  RIB43A;  InterPro: IPR008805 This family consists of several RIB43A-like eukaryotic proteins. Ciliary and flagellar microtubules contain a specialised set of protofilaments, termed ribbons, that are composed of tubulin and several associated proteins. RIB43A was first characterised in the unicellular biflagellate, Chlamydomonas reinhardtii although highly related sequences are present in several higher eukaryotes including humans. The function of this protein is unknown although the structure of RIB43A and its association with the specialised protofilament ribbons and with basal bodies is relevant to the proposed role of ribbons in forming and stabilising doublet and triplet microtubules and in organising their three-dimensional structure. Human RIB43A homologues could represent a structural requirement in centriole replication in dividing cells [].
Probab=38.73  E-value=43  Score=26.54  Aligned_cols=21  Identities=29%  Similarity=0.692  Sum_probs=16.0

Q ss_pred             hhcccCCCHHHHHHHHHHHHH
Q psy11575         43 IDRWHDLTMEDIRRIEEETKK   63 (80)
Q Consensus        43 iDeW~~lTmedIR~~E~et~~   63 (80)
                      -|.|.|||.+++..+-..-..
T Consensus       271 ~d~wKGMs~eQl~~i~~~Q~~  291 (379)
T PF05914_consen  271 PDRWKGMSPEQLEEIRKEQEQ  291 (379)
T ss_pred             CcccCCCCHHHHHHHHHHHHH
Confidence            489999999988877654433


No 14 
>PF04707 PRELI:  PRELI-like family;  InterPro: IPR006797 These proteins contain a conserved region found in the yeast YLR168C gene MSF1 product. The function of this protein is unknown, though it is thought to be involved in intra-mitochondrial protein sorting. GFP-tagged MSF1 localizes to mitochondria and is required for wild-type respiratory growth []. This region is also found in a number of other eukaryotic proteins. The PRELI/MSF1 domain is an eukaryotic protein module which occurs in stand-alone form in several proteins, including the human PRELI protein and the yeast MSF1 protein, and as an amino-terminal domain in an orthologous group of proteins typified by human SEC14L1, which is conserved in all animals. In this group of proteins, the PRELI/MSF1 domain co-occurs with the CRAL-TRIO (see PDOC50191 from PROSITEDOC) and the GOLD domains (see PDOC50866 from PROSITEDOC). The PRELI/MSF1 domain is approximately 170 residues long and is predicted to assume a globular alpha + beta fold with six beta strands and four alpha helices. It has been suggested that the PRELI/MSF1 domain may have a function associated with cellular membrane [].
Probab=37.01  E-value=1e+02  Score=21.02  Aligned_cols=39  Identities=23%  Similarity=0.370  Sum_probs=24.3

Q ss_pred             eeeE-eEEEe--eccchhHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy11575          3 CYKL-VTAEF--KWFGFQGRVENFIHKAERRLFTNFHRQVFCW   42 (80)
Q Consensus         3 ~YKl-v~v~f--~~~Glq~~vE~~i~~~~r~i~~~~HRq~fcw   42 (80)
                      .|+. .+|++  .++||++++|+++.+....-..++ |+++-|
T Consensus       108 ~~~q~a~i~~~~~~~~~~~~iE~~~~~~f~~na~kg-r~~~e~  149 (157)
T PF04707_consen  108 LFKQEATISIKGSFSGFSSRIEKFSVSRFKSNAKKG-REGMEW  149 (157)
T ss_pred             eEEEEEEEEEeCchhhHhHHHHHHHHHHHHHHHHHH-HHHHHH
Confidence            3444 44555  569999999999988765543333 344333


No 15 
>PF09278 MerR-DNA-bind:  MerR, DNA binding;  InterPro: IPR015358 This entry represents a family of DNA-binding domains that are predominantly found in the prokaryotic transcriptional regulator MerR. They adopt a structure consisting of a core of three alpha helices, with an architecture that is similar to that of the 'winged helix' fold []. ; PDB: 3QAO_A 1R8D_B 1JBG_A 2VZ4_A 2ZHH_A 2ZHG_A 1Q09_A 1Q08_B 1Q0A_B 1Q07_A ....
Probab=36.61  E-value=23  Score=20.13  Aligned_cols=12  Identities=25%  Similarity=0.553  Sum_probs=8.6

Q ss_pred             cCCCHHHHHHHH
Q psy11575         47 HDLTMEDIRRIE   58 (80)
Q Consensus        47 ~~lTmedIR~~E   58 (80)
                      .|+|.++||++=
T Consensus        13 lGfsL~eI~~~l   24 (65)
T PF09278_consen   13 LGFSLEEIRELL   24 (65)
T ss_dssp             TT--HHHHHHHH
T ss_pred             cCCCHHHHHHHH
Confidence            799999999874


No 16 
>cd01104 HTH_MlrA-CarA Helix-Turn-Helix DNA binding domain of the transcription regulators MlrA and CarA. Helix-turn-helix (HTH) transcription regulator MlrA (merR-like regulator A), N-terminal domain. The MlrA protein, also known as YehV, has been shown to control cell-cell aggregation by co-regulating the expression of curli and extracellular matrix production in Escherichia coli and Salmonella typhimurium.  Its close homolog, CarA from Myxococcus xanthus, is involved in activation of the carotenoid biosynthesis genes by light. These proteins belong to the MerR superfamily of transcription regulators that promote expression of several stress regulon genes by reconfiguring the spacer between the -35 and -10 promoter elements. Their conserved N-terminal domains contain predicted HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules. Many MlrA- and CarA-like proteins in this group appear to lack the long dimerization helix seen i
Probab=36.10  E-value=52  Score=18.53  Aligned_cols=18  Identities=0%  Similarity=0.065  Sum_probs=13.1

Q ss_pred             HHHHhhcccCCCHHHHHHHH
Q psy11575         39 VFCWIDRWHDLTMEDIRRIE   58 (80)
Q Consensus        39 ~fcwiDeW~~lTmedIR~~E   58 (80)
                      +.+..+  .|+|+++|+++.
T Consensus        50 i~~l~~--~g~~l~~i~~~~   67 (68)
T cd01104          50 IRRLTS--EGVRISQAAALA   67 (68)
T ss_pred             HHHHHH--CCCCHHHHHHHh
Confidence            344444  799999999874


No 17 
>PF15581 Imm35:  Immunity protein 35
Probab=32.36  E-value=27  Score=22.99  Aligned_cols=12  Identities=25%  Similarity=0.645  Sum_probs=9.9

Q ss_pred             hcccCCCHHHHH
Q psy11575         44 DRWHDLTMEDIR   55 (80)
Q Consensus        44 DeW~~lTmedIR   55 (80)
                      -||-||+|++|.
T Consensus        41 ~eWRGl~~~qV~   52 (93)
T PF15581_consen   41 HEWRGLPEEQVL   52 (93)
T ss_pred             HHHcCCCHHHHH
Confidence            379999988874


No 18 
>cd04763 HTH_MlrA-like Helix-Turn-Helix DNA binding domain of MlrA-like transcription regulators. Helix-turn-helix (HTH) transcription regulator MlrA (merR-like regulator A) and related proteins, N-terminal domain. The MlrA protein, also known as YehV, has been shown to control cell-cell aggregation by co-regulating the expression of curli and extracellular matrix production in Escherichia coli and Salmonella typhimurium. Its close homolog, CarA from Myxococcus xanthus, is involved in activation of the carotenoid biosynthesis genes by light. These proteins belong to the MerR superfamily of transcription regulators that promote expression of several stress regulon genes by reconfiguring the spacer between the -35 and -10 promoter elements. Their conserved N-terminal domains contain predicted HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules. Many MlrA-like proteins in this group appear to lack the long dimerization helix seen
Probab=32.35  E-value=61  Score=18.56  Aligned_cols=19  Identities=16%  Similarity=0.644  Sum_probs=14.1

Q ss_pred             HHHHHHhhcccCCCHHHHHHH
Q psy11575         37 RQVFCWIDRWHDLTMEDIRRI   57 (80)
Q Consensus        37 Rq~fcwiDeW~~lTmedIR~~   57 (80)
                      +++-|..|  .|+|+++|+++
T Consensus        48 ~~i~~l~~--~g~~l~~i~~~   66 (68)
T cd04763          48 LEIKRWID--NGVQVSKVKKL   66 (68)
T ss_pred             HHHHHHHH--cCCCHHHHHHH
Confidence            34556667  89999999874


No 19 
>cd01388 SOX-TCF_HMG-box SOX-TCF_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins. These proteins contain a single HMG box, and bind the minor groove of DNA in a highly sequence-specific manner. Members include SRY and its homologs in insects and vertebrates, and transcription factor-like proteins, TCF-1, -3, -4, and LEF-1. They appear to bind the minor groove of the A/T C A A A G/C-motif.
Probab=31.46  E-value=88  Score=18.22  Aligned_cols=28  Identities=32%  Similarity=0.394  Sum_probs=23.0

Q ss_pred             hcccCCCHHHHHHHHHHHHHHHHHHHhh
Q psy11575         44 DRWHDLTMEDIRRIEEETKKELDRQRLE   71 (80)
Q Consensus        44 DeW~~lTmedIR~~E~et~~~l~~~~~~   71 (80)
                      ..|-.||-++-..+.++..+..++-..+
T Consensus        38 ~~Wk~ls~~eK~~y~~~a~~~k~~y~~~   65 (72)
T cd01388          38 DRWKALSNEEKQPYYEEAKKLKELHMKL   65 (72)
T ss_pred             HHHHcCCHHHHHHHHHHHHHHHHHHHHH
Confidence            5799999999999999988877765543


No 20 
>PF14045 YIEGIA:  YIEGIA protein
Probab=29.57  E-value=43  Score=26.09  Aligned_cols=17  Identities=35%  Similarity=0.655  Sum_probs=14.7

Q ss_pred             HHHHHHHHHHHHHHHHH
Q psy11575         51 MEDIRRIEEETKKELDR   67 (80)
Q Consensus        51 medIR~~E~et~~~l~~   67 (80)
                      --|||++|++|-++|++
T Consensus        71 FRdVR~mER~tL~~le~   87 (285)
T PF14045_consen   71 FRDVRNMERETLTNLEE   87 (285)
T ss_pred             HHHHHHHHHHHHHhhhh
Confidence            36999999999999875


No 21 
>PF13455 MUG113:  Meiotically up-regulated gene 113
Probab=29.36  E-value=40  Score=21.09  Aligned_cols=38  Identities=24%  Similarity=0.275  Sum_probs=25.2

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHHHhh-----cccCCCHHHHHHH
Q psy11575         16 FQGRVENFIHKAERRLFTNFHRQVFCWID-----RWHDLTMEDIRRI   57 (80)
Q Consensus        16 lq~~vE~~i~~~~r~i~~~~HRq~fcwiD-----eW~~lTmedIR~~   57 (80)
                      ...++|+.||..+.+.-...    -+=-|     |||.++.+++.+.
T Consensus        37 ~~~rvErliH~eL~~~r~~~----~~c~~C~~~HEwF~v~~~~~~~v   79 (83)
T PF13455_consen   37 HVHRVERLIHLELADKRLRG----GECDDCGKRHEWFEVEAEDVKEV   79 (83)
T ss_pred             cHHHHHHHHHHHHHhcccCc----ccCCCCCceeeEEeeCHHHHHHH
Confidence            56889999998887722211    11112     9999998887754


No 22 
>PF06868 DUF1257:  Protein of unknown function (DUF1257);  InterPro: IPR009666 This family represents Ycf35, which is encoded in algal chloroplast and in cyanobacteria. The function of these proteins are unknown. As the family is exclusively found in phototrophic organisms it may play a role in photosynthesis.
Probab=28.38  E-value=51  Score=21.52  Aligned_cols=24  Identities=29%  Similarity=0.595  Sum_probs=20.4

Q ss_pred             eeeEeEEEeeccchhHHHHHHHHHH
Q psy11575          3 CYKLVTAEFKWFGFQGRVENFIHKA   27 (80)
Q Consensus         3 ~YKlv~v~f~~~Glq~~vE~~i~~~   27 (80)
                      +|-||. +.-+|+-...+|.|+.+.
T Consensus        48 sYeLVa-Dl~~W~q~~~~e~fl~kl   71 (105)
T PF06868_consen   48 SYELVA-DLQFWQQPYSVERFLNKL   71 (105)
T ss_pred             cEEEEe-ehhhhcccCCHHHHHHHH
Confidence            588887 888999778899999875


No 23 
>PF09346 SMI1_KNR4:  SMI1 / KNR4 family (SUKH-1);  InterPro: IPR018958  Proteins in this family are involved in the regulation of 1,3-beta-glucan synthase activity and cell-wall formation [, ].  Yeast members of this family are involved in the regulation of cell wall assembly. Saccharomyces cerevisiae (Baker's yeast) protein KNR4 (SMI1) has a regulatory role in chitin deposition and in cell wall assembly []. It was originally identified as a regulator of chitin synthase expression (acting as a repressor) [] and of 1,3-beta-glucan synthase levels []. It was shown to localise in patches at presumptive bud sites in unbudded cells and at the incipient bud site during bud emergence []. KNR4 is believed to connect the PKC1-SLT2 MAPK pathway with cell proliferation. It has been shown to interact with BCK2, a gene involved in cell cycle progression in S. cerevisiae (forming a complex) to allow PKC1 to coordinate the cell cycle (cell proliferation) with cell wall integrity [, ]. PKC1 plays an essential role in cell wall integrity and cell proliferation through a bifurcated PKC1/mitogen-activated protein (MAP) kinase pathway. KNR4 also interacts with the tyrosine-tRNA synthetase protein encoded by TYS1 and is involved in sporulation process [].  Note: previously reported evidence that KNR4 may interact with nuclear matrix-association region [] may be due to an artefact [].; PDB: 3D5P_A 2ICG_A.
Probab=27.94  E-value=45  Score=20.08  Aligned_cols=18  Identities=33%  Similarity=0.414  Sum_probs=11.9

Q ss_pred             CCCHHHHHHHHHHHHHHH
Q psy11575         48 DLTMEDIRRIEEETKKEL   65 (80)
Q Consensus        48 ~lTmedIR~~E~et~~~l   65 (80)
                      ++|-++|+++|++..-.|
T Consensus         1 p~t~~~I~~~E~~lg~~L   18 (130)
T PF09346_consen    1 PATEEEIQELEEKLGVRL   18 (130)
T ss_dssp             ---HHHHHHHHHHHTS--
T ss_pred             CCCHHHHHHHHHHhCCCC
Confidence            468899999999987665


No 24 
>cd01389 MATA_HMG-box MATA_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins. These proteins contain a single HMG box, and bind the minor groove of DNA in a highly sequence-specific manner. Members include the fungal mating type gene products MC, MATA1 and Ste11.
Probab=27.74  E-value=1.2e+02  Score=17.86  Aligned_cols=27  Identities=19%  Similarity=0.217  Sum_probs=22.1

Q ss_pred             hcccCCCHHHHHHHHHHHHHHHHHHHh
Q psy11575         44 DRWHDLTMEDIRRIEEETKKELDRQRL   70 (80)
Q Consensus        44 DeW~~lTmedIR~~E~et~~~l~~~~~   70 (80)
                      +.|..||-++=..+++...++.++..+
T Consensus        38 ~~Wk~ls~eeK~~y~~~A~~~k~~~~~   64 (77)
T cd01389          38 RMWRSESPEVKAYYKELAEEEKERHAR   64 (77)
T ss_pred             HHHhhCCHHHHHHHHHHHHHHHHHHHH
Confidence            679999999999999988777665544


No 25 
>PF11460 DUF3007:  Protein of unknown function (DUF3007);  InterPro: IPR021562  This is a family of uncharacterised proteins found in bacteria and eukaryotes. 
Probab=27.42  E-value=1.1e+02  Score=20.46  Aligned_cols=23  Identities=26%  Similarity=0.420  Sum_probs=15.2

Q ss_pred             CCC-HHHHHHHHHHH----HHHHHHHHh
Q psy11575         48 DLT-MEDIRRIEEET----KKELDRQRL   70 (80)
Q Consensus        48 ~lT-medIR~~E~et----~~~l~~~~~   70 (80)
                      +|| |++.|.||+..    ++++++.+.
T Consensus        61 ~MTy~~Q~k~Ye~a~~~~~~~~lqkRle   88 (104)
T PF11460_consen   61 KMTYMQQRKDYEEAVDQLTNEELQKRLE   88 (104)
T ss_pred             CCcHHHHHHHHHHHHHHHhHHHHHHHHH
Confidence            577 78888888876    444544443


No 26 
>PF01486 K-box:  K-box region;  InterPro: IPR002487 MADS genes in plants encode key developmental regulators of vegetative and reproductive development. The majority of the plant MADS proteins share a stereotypical MIKC structure. It comprises (from N- to C-terminal) an N-terminal domain, which is, however, present only in a minority of proteins; a MADS domain (see PDOC00302 from PROSITEDOC, IPR002100 from INTERPRO), which is the major determinant of DNA-binding but which also performs dimerisation and accessory factor binding functions; a weakly conserved intervening (I) domain, which constitutes a key molecular determinant for the selective formation of DNA-binding dimers; a keratin-like (K-box) domain, which promotes protein dimerisation; and a C-terminal (C) domain, which is involved in transcriptional activation or in the formation of ternary or quaternary protein complexes. The 80-amino acid K-box domain was originally identified as a region with low but significant similarity to a region of keratin, which is part of the coiled-coil sequence constituting the central rod-shaped domain of keratin [, , ]. The K-box protein-protein interaction domain which mediates heterodimerization of MIKC-type MADS proteins contains several heptad repeats in which the first and the fourth positions are occupied by hydrophobic amino acids suggesting that the K-box domain forms three amphipathic alpha-helices referred to as K1, K2, and K3 [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=27.18  E-value=83  Score=19.73  Aligned_cols=39  Identities=15%  Similarity=0.350  Sum_probs=26.8

Q ss_pred             HHHHHHHHHHHHhhcccCCCHHHHHHHHHHHHHHHHHHHhh
Q psy11575         31 LFTNFHRQVFCWIDRWHDLTMEDIRRIEEETKKELDRQRLE   71 (80)
Q Consensus        31 i~~~~HRq~fcwiDeW~~lTmedIR~~E~et~~~l~~~~~~   71 (80)
                      .+-..+|++-  =+.=-+||++|+-.+|......|.+.+..
T Consensus        30 ~L~~~~R~~~--GedL~~Ls~~eL~~LE~~Le~aL~~VR~r   68 (100)
T PF01486_consen   30 SLQKELRHLM--GEDLESLSLKELQQLEQQLESALKRVRSR   68 (100)
T ss_pred             HHHHHHhccc--cccccccchHHHHHHHHhhhhhHHHHHHH
Confidence            3344445442  13345599999999999999888777653


No 27 
>PF09011 HMG_box_2:  HMG-box domain;  InterPro: IPR015101 This domain is predominantly found in Maelstrom homologue proteins. It has no known function. ; GO: 0005634 nucleus; PDB: 2EQZ_A 1V64_A 2CTO_A 1H5P_A 3TQ6_A 3FGH_A 3TMM_A 1J3X_A 2YRQ_A 1AAB_A ....
Probab=26.94  E-value=86  Score=18.31  Aligned_cols=25  Identities=32%  Similarity=0.641  Sum_probs=19.7

Q ss_pred             hhcccCCCHHHHHHHHHHHHHHHHH
Q psy11575         43 IDRWHDLTMEDIRRIEEETKKELDR   67 (80)
Q Consensus        43 iDeW~~lTmedIR~~E~et~~~l~~   67 (80)
                      -++|-.||-++=..|++..++.-++
T Consensus        40 ~~~Wk~Ls~~EK~~Y~~~A~~~k~~   64 (73)
T PF09011_consen   40 SERWKSLSEEEKEPYEERAKEDKER   64 (73)
T ss_dssp             HHHHHHS-HHHHHHHHHHHHHHHHH
T ss_pred             HHHHHhcCHHHHHHHHHHHHHHHHH
Confidence            4789999999999999987766443


No 28 
>PTZ00285 glucosamine-6-phosphate isomerase; Provisional
Probab=26.91  E-value=24  Score=25.65  Aligned_cols=32  Identities=16%  Similarity=0.180  Sum_probs=24.9

Q ss_pred             HHHHHHHHHhhcccCCCHHHHHHHHHHHHHHH
Q psy11575         34 NFHRQVFCWIDRWHDLTMEDIRRIEEETKKEL   65 (80)
Q Consensus        34 ~~HRq~fcwiDeW~~lTmedIR~~E~et~~~l   65 (80)
                      .+.|=-|.|+|||+|+..++-.....-.++.|
T Consensus        62 ~w~~v~if~~DEr~~Vp~~~~~Sn~~~~~~~l   93 (253)
T PTZ00285         62 SFSNVVTFNMDEYVGLPRDHPQSYHYFMKENF   93 (253)
T ss_pred             chhHeEEECCcEEecCCCCchHHHHHHHHHHH
Confidence            44555678899999999998887777777665


No 29 
>TIGR00496 frr ribosome recycling factor. This model finds only eubacterial proteins. Mitochondrial and/or chloroplast forms might be expected but are not currently known. This protein was previously called ribosome releasing factor. By releasing ribosomes from mRNA at the end of protein biosynthesis, it prevents inappropriate translation from 3-prime regions of the mRNA and frees the ribosome for new rounds of translation. EGAD|53116|YHR038W is part of the frr superfamily.
Probab=26.59  E-value=1e+02  Score=21.75  Aligned_cols=42  Identities=19%  Similarity=0.269  Sum_probs=30.3

Q ss_pred             HHHHHHHHHHHHHHhhcc---cCCCHHHHHHHHHHHHHHHHHHHh
Q psy11575         29 RRLFTNFHRQVFCWIDRW---HDLTMEDIRRIEEETKKELDRQRL   70 (80)
Q Consensus        29 r~i~~~~HRq~fcwiDeW---~~lTmedIR~~E~et~~~l~~~~~   70 (80)
                      +--+.+..|.+.--+...   .++|-||++.+|.+.|+..++..+
T Consensus       116 Kv~iRniRr~~~~~iKk~~k~~~iseD~~k~~~~~iQkltd~~i~  160 (176)
T TIGR00496       116 KVAVRNVRRDANDKVKKLEKDKEISEDEERRLQEEIQKLTDEYIK  160 (176)
T ss_pred             HHHHHHHHHHHHHHHHHHhhcCCCChhHHHHHHHHHHHHHHHHHH
Confidence            344556666666666655   469999999999999988766554


No 30 
>PF10666 Phage_Gp14:  Phage protein Gp14;  InterPro: IPR018923  This Listeria phage Gp14 protein family is of unknown function but is expressed from within a cluster of tail- and base plate genes []. 
Probab=25.15  E-value=1.1e+02  Score=21.45  Aligned_cols=28  Identities=25%  Similarity=0.374  Sum_probs=22.7

Q ss_pred             hhcccCCCHHHHHHHHHHHHHHHHHHHh
Q psy11575         43 IDRWHDLTMEDIRRIEEETKKELDRQRL   70 (80)
Q Consensus        43 iDeW~~lTmedIR~~E~et~~~l~~~~~   70 (80)
                      ||.=-.||.+|.+.+|.+..+.|...+.
T Consensus        56 id~~~EmS~e~~~aLe~~~re~L~ea~~   83 (140)
T PF10666_consen   56 IDFDREMSSEEYRALEEQQREALKEAIE   83 (140)
T ss_pred             ccchhhcCHHHHHHHHHHHHHHHHHHHH
Confidence            4555679999999999999998877653


No 31 
>PF07078 FYTT:  Forty-two-three protein;  InterPro: IPR009782 This family consists of several hypothetical mammalian proteins of around 320 residues in length. The function of this family is unknown although several of the family members are annotated as putative 40-2-3 proteins.
Probab=24.79  E-value=64  Score=25.49  Aligned_cols=20  Identities=25%  Similarity=0.677  Sum_probs=15.2

Q ss_pred             hcccCCCHHHHHHHHHHHHHH
Q psy11575         44 DRWHDLTMEDIRRIEEETKKE   64 (80)
Q Consensus        44 DeW~~lTmedIR~~E~et~~~   64 (80)
                      |+ +|||+|||-+|-.+-+.+
T Consensus        27 DK-IDMSLDDIIKLNKKE~kk   46 (316)
T PF07078_consen   27 DK-IDMSLDDIIKLNKKEQKK   46 (316)
T ss_pred             cc-ccccHHHHHHhhhhhhhh
Confidence            44 899999999887665443


No 32 
>KOG0717|consensus
Probab=23.68  E-value=2.1e+02  Score=24.11  Aligned_cols=39  Identities=18%  Similarity=0.390  Sum_probs=27.9

Q ss_pred             EEeeccch-hHHHHHHHHHHHHHHHHHHHHHHHHHhhcccCC
Q psy11575          9 AEFKWFGF-QGRVENFIHKAERRLFTNFHRQVFCWIDRWHDL   49 (80)
Q Consensus         9 v~f~~~Gl-q~~vE~~i~~~~r~i~~~~HRq~fcwiDeW~~l   49 (80)
                      .-.++||. -+..+.++ -....=....-+.-|||.|+ |+.
T Consensus       136 ~~ap~fg~~~t~ye~~~-~fY~~W~afsT~Ksf~W~d~-Ydv  175 (508)
T KOG0717|consen  136 LLYPLFGYSTTDYEQVV-PFYQFWLAFSTKKSFEWLDE-YDV  175 (508)
T ss_pred             cccccccCCCCcHHHHH-HHHHHHHhhhhhhhHHhhhh-hhh
Confidence            45688997 46688877 55555556667888999999 444


No 33 
>cd04764 HTH_MlrA-like_sg1 Helix-Turn-Helix DNA binding domain of putative MlrA-like transcription regulators. Putative helix-turn-helix (HTH) MlrA-like transcription regulators (subgroup 1). The MlrA protein, also known as YehV, has been shown to control cell-cell aggregation by co-regulating the expression of curli and extracellular matrix production in Escherichia coli and Salmonella typhimurium. These proteins belong to the MerR superfamily of transcription regulators that promote expression of several stress regulon genes by reconfiguring the spacer between the -35 and -10 promoter elements. Their conserved N-terminal domains contain predicted HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules. Many MlrA-like proteins in this group appear to lack the long dimerization helix seen in the N-terminal domains of typical MerR-like proteins.
Probab=23.63  E-value=1.1e+02  Score=17.36  Aligned_cols=18  Identities=17%  Similarity=0.543  Sum_probs=12.3

Q ss_pred             HHHHHhhcccCCCHHHHHHH
Q psy11575         38 QVFCWIDRWHDLTMEDIRRI   57 (80)
Q Consensus        38 q~fcwiDeW~~lTmedIR~~   57 (80)
                      .+-+..+  .|+|+++|+++
T Consensus        48 ~i~~l~~--~g~~l~~i~~~   65 (67)
T cd04764          48 KIKTLLE--KGLSIKEIKEI   65 (67)
T ss_pred             HHHHHHH--CCCCHHHHHHH
Confidence            3444555  78899998864


No 34 
>PF01452 Rota_NSP4:  Rotavirus non structural protein;  InterPro: IPR002107 This entry contains rotaviral non-structural protein 4 (NSP4) as well as related proteins: NSP5, NS28, and NCVP5. The final steps in the assembly of rotavirus occur in the lumen of the endoplasmic reticulum (ER). Targeting of the immature inner capsid particle (ICP) to this compartment is mediated by the cytoplasmic tail of NSP4, located in the ER membrane [, ].; PDB: 2O1J_D 1G1J_B 1G1I_B 2O1K_B 3MIW_A.
Probab=23.40  E-value=3e+02  Score=20.00  Aligned_cols=38  Identities=26%  Similarity=0.414  Sum_probs=13.6

Q ss_pred             eeeeEeEE--------Eeeccch--hHHHHHHHHHHHHHHHHHHHHHH
Q psy11575          2 TCYKLVTA--------EFKWFGF--QGRVENFIHKAERRLFTNFHRQV   39 (80)
Q Consensus         2 ~~YKlv~v--------~f~~~Gl--q~~vE~~i~~~~r~i~~~~HRq~   39 (80)
                      |+||++.+        -.+.+|.  |-.-++-|.+++-++.-..-||+
T Consensus        63 csYKViky~ivTI~N~llklaGykeqittkDeie~qmdrivkemrrQl  110 (173)
T PF01452_consen   63 CSYKVIKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRIVKEMRRQL  110 (173)
T ss_dssp             --------------------------------HHHHHHHHHHHHHHHH
T ss_pred             ccceEEEEEEEeehhhHHHHhcccccCCcHHHHHHHHHHHHHHHHHHH
Confidence            78988654        4567787  55567778888888888888886


No 35 
>PF14048 MBD_C:  C-terminal domain of methyl-CpG binding protein 2 and 3; PDB: 2L2L_B.
Probab=23.00  E-value=1.2e+02  Score=19.63  Aligned_cols=20  Identities=45%  Similarity=0.418  Sum_probs=13.0

Q ss_pred             ccCCCHHHHHHHHHHHHHHH
Q psy11575         46 WHDLTMEDIRRIEEETKKEL   65 (80)
Q Consensus        46 W~~lTmedIR~~E~et~~~l   65 (80)
                      .+-.|-+|||+=|+++++.=
T Consensus        70 ~~~VT~eDIr~QE~rVk~aR   89 (96)
T PF14048_consen   70 QFVVTEEDIRRQERRVKKAR   89 (96)
T ss_dssp             -----HHHHHHHHHHHHHHH
T ss_pred             CCccCHHHHHHHHHHHHHHH
Confidence            45578999999999988763


No 36 
>PF00505 HMG_box:  HMG (high mobility group) box;  InterPro: IPR000910 High mobility group (HMG or HMGB) proteins are a family of relatively low molecular weight non-histone components in chromatin. HMG1 (also called HMG-T in fish) and HMG2 are two highly related proteins that bind single-stranded DNA preferentially and unwind double-stranded DNA. Although they have no sequence specificity, they have a high affinity for bent or distorted DNA, and bend linear DNA. HMG1 and HMG2 contain two DNA-binding HMG-box domains (A and B) that show structural and functional differences, and have a long acidic C-terminal domain rich in aspartic and glutamic acid residues. The acidic tail modulates the affinity of the tandem HMG boxes in HMG1 and 2 for a variety of DNA targets. HMG1 and 2 appear to play important architectural roles in the assembly of nucleoprotein complexes in a variety of biological processes, for example V(D)J recombination, the initiation of transcription, and DNA repair []. The profile in this entry describing the HMG-domains is much more general than the signature. In addition to the HMG1 and HMG2 proteins, HMG-domains occur in single or multiple copies in the following protein classes; the SOX family of transcription factors; SRY sex determining region Y protein and related proteins []; LEF1 lymphoid enhancer binding factor 1 []; SSRP recombination signal recognition protein; MTF1 mitochondrial transcription factor 1; UBF1/2 nucleolar transcription factors; Abf2 yeast ARS-binding factor []; and Saccharomyces cerevisiae transcription factors Ixr1, Rox1, Nhp6a, Nhp6b and Spp41.; GO: 0003677 DNA binding; PDB: 1I11_A 1J3C_A 1J3D_A 1WZ6_A 1WGF_A 2D7L_A 1GT0_D 3U2B_C 2CRJ_A 2CS1_A ....
Probab=22.72  E-value=1.1e+02  Score=17.00  Aligned_cols=25  Identities=28%  Similarity=0.538  Sum_probs=20.0

Q ss_pred             hcccCCCHHHHHHHHHHHHHHHHHH
Q psy11575         44 DRWHDLTMEDIRRIEEETKKELDRQ   68 (80)
Q Consensus        44 DeW~~lTmedIR~~E~et~~~l~~~   68 (80)
                      ..|.+||-++-..+.++..+...+-
T Consensus        37 ~~W~~l~~~eK~~y~~~a~~~~~~y   61 (69)
T PF00505_consen   37 QMWKNLSEEEKAPYKEEAEEEKERY   61 (69)
T ss_dssp             HHHHCSHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHhcCCHHHHHHHHHHHHHHHHHH
Confidence            4699999999999988877766543


No 37 
>PF10642 Tom5:  Mitochondrial import receptor subunit or translocase;  InterPro: IPR019603  This entry represents a short family of yeast proteins. Tom5 is one of three very small translocases of the mitochondrial outer membrane. Tom5 links mitochondrial preprotein receptors to the general import pore []. Although Tom5 has allegedly been identified in vertebrates this could not be confirmed. 
Probab=22.27  E-value=1.7e+02  Score=16.91  Aligned_cols=21  Identities=14%  Similarity=0.222  Sum_probs=17.6

Q ss_pred             CCHHHHHHHHHHHHHHHHHHH
Q psy11575         49 LTMEDIRRIEEETKKELDRQR   69 (80)
Q Consensus        49 lTmedIR~~E~et~~~l~~~~   69 (80)
                      .|-|+|+..|.++...++...
T Consensus         9 pS~eE~k~~e~~A~~Tvk~a~   29 (49)
T PF10642_consen    9 PSEEEIKAAEAQANFTVKNAA   29 (49)
T ss_pred             CCHHHHHHHHHHHHHHHHHHH
Confidence            588999999999988876654


No 38 
>COG0233 Frr Ribosome recycling factor [Translation, ribosomal structure and biogenesis]
Probab=21.82  E-value=1.3e+02  Score=21.97  Aligned_cols=23  Identities=22%  Similarity=0.404  Sum_probs=19.2

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHh
Q psy11575         48 DLTMEDIRRIEEETKKELDRQRL   70 (80)
Q Consensus        48 ~lTmedIR~~E~et~~~l~~~~~   70 (80)
                      ..|.||.|..|++.|...++..+
T Consensus       149 ~isEDe~k~~e~~iQKlTd~yi~  171 (187)
T COG0233         149 EISEDEVKKAEEEIQKLTDEYIK  171 (187)
T ss_pred             CcchHHHHHHHHHHHHHHHHHHH
Confidence            37999999999999988766554


No 39 
>smart00760 Bac_DnaA_C Bacterial dnaA protein helix-turn-helix domain. Could be involved in DNA-binding.
Probab=21.49  E-value=80  Score=17.96  Aligned_cols=23  Identities=26%  Similarity=0.492  Sum_probs=17.9

Q ss_pred             HHHHHHHHHhhcc-cCCCHHHHHH
Q psy11575         34 NFHRQVFCWIDRW-HDLTMEDIRR   56 (80)
Q Consensus        34 ~~HRq~fcwiDeW-~~lTmedIR~   56 (80)
                      ..=||+.+|+-.. .|+|+.+|=+
T Consensus        30 ~~aR~iamyla~~~~~~sl~~Ig~   53 (60)
T smart00760       30 VLARQIAMYLARELTDLSLPEIGK   53 (60)
T ss_pred             hHHHHHHHHHHHHHHCCCHHHHHH
Confidence            4468888888877 8899888853


No 40 
>cd03081 TRX_Fd_NuoE_FDH_gamma TRX-like [2Fe-2S] Ferredoxin (Fd) family, NADH:ubiquinone oxidoreductase (Nuo) subunit E subfamily, NAD-dependent formate dehydrogenase (FDH) gamma subunit; composed of proteins similar to the gamma subunit of NAD-linked FDH of Ralstonia eutropha, a soluble enzyme that catalyzes the irreversible oxidation of formate to carbon dioxide accompanied by the reduction of NAD+ to NADH. FDH is a heteromeric enzyme composed of four nonidentical subunits (alpha, beta, gamma and delta). The FDH gamma subunit is closely related to NuoE, which is part of a multisubunit complex (Nuo) catalyzing the electron transfer of NADH to quinone coupled with the transfer of protons across the membrane. Electrons are transferred from NADH to quinone through a chain of iron-sulfur clusters in Nuo, including the [2Fe-2S] cluster present in NuoE. Similarly, the FDH gamma subunit is hypothesized to be involved in an electron transport chain involving other FDH subunits, upon the oxidat
Probab=20.02  E-value=70  Score=19.29  Aligned_cols=14  Identities=14%  Similarity=0.240  Sum_probs=10.0

Q ss_pred             hccc-CCCHHHHHHH
Q psy11575         44 DRWH-DLTMEDIRRI   57 (80)
Q Consensus        44 DeW~-~lTmedIR~~   57 (80)
                      |+|| ++|.++|+++
T Consensus        62 ~~~~~~~~~e~i~~i   76 (80)
T cd03081          62 GEVHGRVDPEKFDAL   76 (80)
T ss_pred             CEEECCCCHHHHHHH
Confidence            4577 6788888764


Done!