Diaphorina citri psyllid: psy11577


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------9
MKYDKWEKRKKSDEEEEKKKEEEEEEGAGEFGPEELPGFGLVHDLPADKLKVREVVHIDIGNDPVSAGDYKETEDPAKFKSEKTGRGVD
cccHHHHHHccccHHHHHHHHHHHccccccccccccccccccccccHHHHcccEEEEEEccccccccccccccccccccCCcccccccc
******************************FGPEELPGFGLVHDLPADKLKVREVVHIDIGNDPVSAGDYKETEDPAK***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKxxxxxxxxxxxxxxxxxxxxxxxEGAGEFGPEELPGFGLVHDLPADKLKVREVVHIDIGNDPVSAGDYKETEDPAKFKSEKTGRGVD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phosphatidylinositol transfer protein alpha isoform Catalyzes the transfer of PtdIns and phosphatidylcholine between membranes.confidentP48738
Phosphatidylinositol transfer protein 3 Catalyzes the transfer of PtdIns and phosphatidylcholine between membranes.confidentQ54VC7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0032154 [CC]cleavage furrowprobableGO:0005575, GO:0044464, GO:0032153, GO:0032155, GO:0005623
GO:0070732 [CC]spindle envelopeprobableGO:0005575, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0005623, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0015914 [BP]phospholipid transportprobableGO:0006810, GO:0051234, GO:0006869, GO:0006811, GO:0015748, GO:0015711, GO:0044765, GO:0006820, GO:0008150, GO:0071702, GO:0033036, GO:0010876, GO:0051179, GO:0044699
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0035091 [MF]phosphatidylinositol bindingprobableGO:0043168, GO:0005543, GO:0008289, GO:0043167, GO:0003674, GO:0005488
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0031965 [CC]nuclear membraneprobableGO:0005575, GO:0005635, GO:0031090, GO:0005634, GO:0016020, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0070540 [MF]stearic acid bindingprobableGO:0043168, GO:0031406, GO:0008289, GO:0043167, GO:0003674, GO:0005488, GO:0005504, GO:0033293, GO:0036041
GO:0008525 [MF]phosphatidylcholine transporter activityprobableGO:0005548, GO:0005319, GO:0022891, GO:0022892, GO:0015651, GO:0008514, GO:0005215, GO:0008509, GO:0008324, GO:0022857, GO:1901677, GO:0015075, GO:1901618, GO:0015101, GO:0003674, GO:0015665
GO:0000062 [MF]fatty-acyl-CoA bindingprobableGO:0043168, GO:0050662, GO:0043167, GO:0003674, GO:0005488, GO:0048037
GO:0008526 [MF]phosphatidylinositol transporter activityprobableGO:0005548, GO:0005319, GO:0022892, GO:0003674, GO:0005215
GO:0016006 [CC]NebenkernprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005739, GO:0005622, GO:0005575, GO:0044444, GO:0005623, GO:0044424, GO:0043227, GO:0043226
GO:0048666 [BP]neuron developmentprobableGO:0032502, GO:0048699, GO:0048856, GO:0007399, GO:0030182, GO:0009987, GO:0048869, GO:0030154, GO:0048468, GO:0044767, GO:0032501, GO:0044763, GO:0048731, GO:0008150, GO:0022008, GO:0007275, GO:0044699, GO:0044707
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0005802 [CC]trans-Golgi networkprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1KCM, chain A
Confidence level:very confident
Coverage over the Query: 28-88
View the alignment between query and template
View the model in PyMOL