Query         psy11589
Match_columns 262
No_of_seqs    336 out of 2153
Neff          10.7
Searched_HMMs 46136
Date          Fri Aug 16 22:33:10 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy11589.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/11589hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus              100.0 6.3E-32 1.4E-36  203.4   5.6  135  121-257   128-265 (279)
  2 KOG1074|consensus              100.0 1.6E-31 3.5E-36  226.6   3.3   78  124-202   606-691 (958)
  3 KOG3608|consensus              100.0 2.4E-28 5.3E-33  188.9  10.5  232    8-260   133-377 (467)
  4 KOG2462|consensus               99.9   9E-29 1.9E-33  186.4   4.9  133   93-229   129-265 (279)
  5 KOG1074|consensus               99.9 5.2E-28 1.1E-32  205.5   4.0  166   94-261   605-933 (958)
  6 KOG3623|consensus               99.9 2.4E-27 5.2E-32  198.6   5.7   77  179-256   895-971 (1007)
  7 KOG3608|consensus               99.9   1E-25 2.2E-30  174.5  11.8  190   67-259   135-345 (467)
  8 KOG3623|consensus               99.9   2E-22 4.4E-27  169.3   6.1  106   67-173   211-331 (1007)
  9 KOG3576|consensus               99.8 3.4E-19 7.4E-24  128.3   3.0  111  149-260   115-237 (267)
 10 KOG3576|consensus               99.7 1.5E-18 3.3E-23  125.0   2.3   83   93-176   116-198 (267)
 11 PLN03086 PRLI-interacting fact  99.4 1.1E-12 2.3E-17  111.6   8.5  144   94-257   407-562 (567)
 12 PHA00733 hypothetical protein   99.4   7E-13 1.5E-17   92.4   5.6   82  177-260    39-124 (128)
 13 PLN03086 PRLI-interacting fact  99.3 2.4E-11 5.2E-16  103.5   9.3  146   10-203   408-565 (567)
 14 PHA00733 hypothetical protein   99.2 8.5E-12 1.8E-16   87.0   4.3   81  149-232    38-124 (128)
 15 PHA02768 hypothetical protein;  99.2 9.8E-12 2.1E-16   71.3   2.3   44  207-252     5-48  (55)
 16 KOG3993|consensus               99.0 2.4E-11 5.3E-16   97.4  -0.6  163   94-257   267-480 (500)
 17 KOG3993|consensus               99.0 2.7E-11   6E-16   97.1  -0.4  162   66-229   267-480 (500)
 18 PF13465 zf-H2C2_2:  Zinc-finge  99.0   3E-10 6.6E-15   55.9   2.0   26  222-247     1-26  (26)
 19 PHA02768 hypothetical protein;  98.9 5.2E-10 1.1E-14   64.3   1.6   42  179-223     6-47  (55)
 20 PHA00616 hypothetical protein   98.8 2.4E-09 5.2E-14   58.5   1.6   34  207-240     1-34  (44)
 21 PHA00732 hypothetical protein   98.7 1.3E-08 2.8E-13   64.3   2.8   48  178-231     1-48  (79)
 22 PF13465 zf-H2C2_2:  Zinc-finge  98.6 1.6E-08 3.5E-13   49.7   1.9   26  193-219     1-26  (26)
 23 PF05605 zf-Di19:  Drought indu  98.5 1.2E-07 2.7E-12   55.7   3.8   49  208-259     3-53  (54)
 24 PHA00616 hypothetical protein   98.5   6E-08 1.3E-12   53.0   1.6   28  235-262     1-28  (44)
 25 PHA00732 hypothetical protein   98.5 9.1E-08   2E-12   60.5   2.4   45  207-257     1-46  (79)
 26 PF05605 zf-Di19:  Drought indu  98.4 6.7E-07 1.5E-11   52.6   4.5   52  178-232     2-54  (54)
 27 PF00096 zf-C2H2:  Zinc finger,  98.3 3.3E-07 7.2E-12   43.7   1.7   23  236-258     1-23  (23)
 28 PF12756 zf-C2H2_2:  C2H2 type   98.2 6.8E-07 1.5E-11   60.1   2.3   71  154-229     2-72  (100)
 29 PF00096 zf-C2H2:  Zinc finger,  98.2 1.3E-06 2.8E-11   41.6   1.8   23  208-230     1-23  (23)
 30 PF13894 zf-C2H2_4:  C2H2-type   98.1   3E-06 6.4E-11   40.7   2.1   23  236-258     1-23  (24)
 31 PF13912 zf-C2H2_6:  C2H2-type   98.0 2.1E-06 4.6E-11   42.6   1.1   25  235-259     1-25  (27)
 32 PF12756 zf-C2H2_2:  C2H2 type   97.9 7.5E-06 1.6E-10   55.0   2.4   71   11-88      1-72  (100)
 33 PF13894 zf-C2H2_4:  C2H2-type   97.9   1E-05 2.2E-10   38.8   2.0   23  208-230     1-23  (24)
 34 PF13912 zf-C2H2_6:  C2H2-type   97.8 1.3E-05 2.8E-10   39.7   1.7   26  207-232     1-26  (27)
 35 PF09237 GAGA:  GAGA factor;  I  97.7 3.4E-05 7.5E-10   43.1   2.2   34  202-235    19-52  (54)
 36 COG5189 SFP1 Putative transcri  97.6 1.4E-05 3.1E-10   62.5   0.5   70  176-255   347-418 (423)
 37 smart00355 ZnF_C2H2 zinc finge  97.6 6.8E-05 1.5E-09   36.4   2.6   24  236-259     1-24  (26)
 38 PF13909 zf-H2C2_5:  C2H2-type   97.6   5E-05 1.1E-09   36.4   1.9   24  236-260     1-24  (24)
 39 PF09237 GAGA:  GAGA factor;  I  97.4 0.00014   3E-09   40.8   2.6   38  225-262    13-51  (54)
 40 smart00355 ZnF_C2H2 zinc finge  97.4 0.00019 4.2E-09   34.7   2.5   24  208-231     1-24  (26)
 41 PRK04860 hypothetical protein;  97.2 0.00015 3.2E-09   52.6   1.4   40  206-249   118-157 (160)
 42 COG5189 SFP1 Putative transcri  97.2 0.00018 3.9E-09   56.6   1.6   69    6-86    346-418 (423)
 43 PF12874 zf-met:  Zinc-finger o  97.2 0.00019 4.1E-09   34.7   1.1   23  236-258     1-23  (25)
 44 KOG1146|consensus               97.0 8.3E-05 1.8E-09   68.9  -1.7  100   97-199   439-539 (1406)
 45 PF13909 zf-H2C2_5:  C2H2-type   97.0 0.00067 1.4E-08   32.3   2.2   24   10-38      1-24  (24)
 46 KOG2231|consensus               97.0  0.0022 4.7E-08   56.5   6.6  100   96-202   117-236 (669)
 47 PF12874 zf-met:  Zinc-finger o  97.0 0.00049 1.1E-08   33.2   1.5   23  208-230     1-23  (25)
 48 COG5236 Uncharacterized conser  96.7  0.0027 5.9E-08   50.8   4.7  118    9-147   151-305 (493)
 49 PF12171 zf-C2H2_jaz:  Zinc-fin  96.6 0.00046 9.9E-09   34.0  -0.0   22  236-257     2-23  (27)
 50 KOG2231|consensus               96.5  0.0062 1.4E-07   53.7   6.0   47   96-147   184-236 (669)
 51 PF12171 zf-C2H2_jaz:  Zinc-fin  96.3  0.0027 5.7E-08   31.2   1.5   22   67-88      2-23  (27)
 52 KOG1146|consensus               96.2  0.0019 4.1E-08   60.4   1.2   77  181-257   439-540 (1406)
 53 KOG2482|consensus               96.2  0.0087 1.9E-07   47.9   4.7   52   94-145   144-217 (423)
 54 KOG2785|consensus               96.2   0.014   3E-07   47.6   5.7   51  207-257   166-242 (390)
 55 KOG2482|consensus               95.9  0.0044 9.6E-08   49.5   1.9   68    8-88    143-217 (423)
 56 KOG2785|consensus               95.9   0.018 3.8E-07   47.0   5.3   52  178-229   166-242 (390)
 57 PRK04860 hypothetical protein;  95.9  0.0043 9.3E-08   45.1   1.6   36   94-134   119-154 (160)
 58 PF13913 zf-C2HC_2:  zinc-finge  95.8  0.0087 1.9E-07   28.8   2.1   19  237-256     4-22  (25)
 59 COG5236 Uncharacterized conser  95.6   0.022 4.8E-07   45.7   4.7  128   95-230   152-304 (493)
 60 PF13913 zf-C2HC_2:  zinc-finge  95.4   0.015 3.2E-07   27.9   1.9   19  209-228     4-22  (25)
 61 smart00451 ZnF_U1 U1-like zinc  95.1   0.015 3.3E-07   30.4   1.7   22  235-256     3-24  (35)
 62 KOG4173|consensus               95.1   0.013 2.8E-07   43.5   1.7   75  152-228    80-167 (253)
 63 KOG2893|consensus               95.0  0.0066 1.4E-07   46.0   0.1   41  181-226    13-53  (341)
 64 KOG2893|consensus               94.7    0.01 2.2E-07   45.0   0.3   48   68-119    12-59  (341)
 65 TIGR00622 ssl1 transcription f  94.4    0.11 2.4E-06   35.1   4.7   48  181-231    58-105 (112)
 66 cd00350 rubredoxin_like Rubred  94.2   0.027 5.8E-07   29.1   1.2   10  234-243    16-25  (33)
 67 COG5048 FOG: Zn-finger [Genera  94.0   0.013 2.8E-07   50.2  -0.4  148   94-242   289-453 (467)
 68 TIGR00622 ssl1 transcription f  93.9     0.1 2.2E-06   35.3   3.7   49  209-259    57-105 (112)
 69 COG5048 FOG: Zn-finger [Genera  93.6    0.03 6.4E-07   47.9   1.0  149   65-215   288-454 (467)
 70 PF12013 DUF3505:  Protein of u  93.4    0.29 6.4E-06   33.2   5.6   26    8-38     10-35  (109)
 71 smart00451 ZnF_U1 U1-like zinc  93.2   0.078 1.7E-06   27.6   1.9   24    8-35      2-25  (35)
 72 KOG4173|consensus               93.1   0.054 1.2E-06   40.3   1.6   84  122-208    78-176 (253)
 73 PF12013 DUF3505:  Protein of u  93.1    0.15 3.2E-06   34.7   3.7   25  236-260    81-109 (109)
 74 COG4049 Uncharacterized protei  91.2    0.17 3.8E-06   29.0   1.8   27   62-88     13-39  (65)
 75 cd00729 rubredoxin_SM Rubredox  90.3    0.15 3.3E-06   26.4   1.0   10  208-217     3-12  (34)
 76 COG4049 Uncharacterized protei  89.5     0.2 4.3E-06   28.8   1.1   32   88-119    11-42  (65)
 77 COG1592 Rubrerythrin [Energy p  89.1     0.2 4.3E-06   36.6   1.2   23  178-214   134-156 (166)
 78 PF10571 UPF0547:  Uncharacteri  88.4    0.35 7.5E-06   23.4   1.4   10  237-246    16-25  (26)
 79 PF09986 DUF2225:  Uncharacteri  87.9   0.092   2E-06   40.4  -1.3   13  208-220    49-61  (214)
 80 PF09986 DUF2225:  Uncharacteri  87.2    0.14 3.1E-06   39.4  -0.6   14  178-191    48-61  (214)
 81 smart00659 RPOLCX RNA polymera  87.2    0.36 7.8E-06   26.7   1.2   26  208-244     3-28  (44)
 82 TIGR02098 MJ0042_CXXC MJ0042 f  85.8    0.42 9.2E-06   25.4   1.0    9  236-244    26-34  (38)
 83 PF06524 NOA36:  NOA36 protein;  85.7    0.31 6.8E-06   37.8   0.6   26  233-258   207-232 (314)
 84 PHA00626 hypothetical protein   85.2     0.2 4.4E-06   28.8  -0.5   12  207-218    23-34  (59)
 85 COG1996 RPC10 DNA-directed RNA  84.6    0.49 1.1E-05   26.7   0.9   28  207-244     6-33  (49)
 86 smart00614 ZnF_BED BED zinc fi  84.6     0.8 1.7E-05   26.1   1.8   21  236-256    19-44  (50)
 87 PF13719 zinc_ribbon_5:  zinc-r  84.0    0.83 1.8E-05   24.2   1.6   10   68-77      4-13  (37)
 88 TIGR00373 conserved hypothetic  83.8     1.1 2.5E-05   32.6   2.8   33  204-245   106-138 (158)
 89 PF09538 FYDLN_acid:  Protein o  83.4    0.88 1.9E-05   30.8   1.9   12  207-218    26-37  (108)
 90 PF13717 zinc_ribbon_4:  zinc-r  83.3    0.97 2.1E-05   23.8   1.7    9   69-77      5-13  (36)
 91 smart00834 CxxC_CXXC_SSSS Puta  83.3    0.36 7.8E-06   26.1  -0.0   10  152-161     6-15  (41)
 92 PRK14890 putative Zn-ribbon RN  82.0     0.7 1.5E-05   27.1   0.9    7  152-158    26-32  (59)
 93 PF06524 NOA36:  NOA36 protein;  82.0     1.4 3.1E-05   34.3   2.7   39  120-159   139-179 (314)
 94 PF02892 zf-BED:  BED zinc fing  81.8     1.2 2.5E-05   24.6   1.7   23  233-255    14-40  (45)
 95 PF09538 FYDLN_acid:  Protein o  81.5     0.9 1.9E-05   30.7   1.4   12  151-162    26-37  (108)
 96 KOG2186|consensus               81.1       1 2.3E-05   34.9   1.8   45  152-198     4-48  (276)
 97 TIGR02605 CxxC_CxxC_SSSS putat  79.9    0.62 1.3E-05   26.7   0.2   12   67-78      6-17  (52)
 98 COG1198 PriA Primosomal protei  79.9     1.3 2.9E-05   40.5   2.3   29  201-244   456-484 (730)
 99 PRK06266 transcription initiat  79.6     1.7 3.8E-05   32.4   2.5   31  206-245   116-146 (178)
100 PRK00398 rpoP DNA-directed RNA  79.0    0.87 1.9E-05   25.4   0.6   30   66-105     3-32  (46)
101 COG1592 Rubrerythrin [Energy p  78.9     1.3 2.9E-05   32.4   1.6   25  207-244   134-158 (166)
102 smart00734 ZnF_Rad18 Rad18-lik  78.6     2.2 4.9E-05   20.5   1.9   19  237-256     3-21  (26)
103 PF15269 zf-C2H2_7:  Zinc-finge  78.2     1.9 4.1E-05   23.6   1.7   23    9-35     20-42  (54)
104 PF09723 Zn-ribbon_8:  Zinc rib  77.5    0.64 1.4E-05   25.4  -0.2    7  154-160     8-14  (42)
105 smart00531 TFIIE Transcription  77.5     2.3   5E-05   30.6   2.6   36   93-133    98-133 (147)
106 KOG2186|consensus               76.4     1.8 3.8E-05   33.7   1.7   46   95-144     4-49  (276)
107 TIGR00373 conserved hypothetic  76.3       2 4.4E-05   31.3   2.0   17  123-139   109-125 (158)
108 KOG2807|consensus               76.0     4.3 9.3E-05   32.9   3.8   21  177-197   289-309 (378)
109 PF12907 zf-met2:  Zinc-binding  75.7       2 4.4E-05   23.2   1.4   13  192-204    18-30  (40)
110 PF03604 DNA_RNApol_7kD:  DNA d  74.4     1.5 3.3E-05   22.3   0.7    6  180-185    19-24  (32)
111 PF15269 zf-C2H2_7:  Zinc-finge  74.0     2.5 5.3E-05   23.1   1.4   21  236-256    21-41  (54)
112 PF08274 PhnA_Zn_Ribbon:  PhnA   73.1    0.95 2.1E-05   22.7  -0.2    8  178-185    19-26  (30)
113 KOG2071|consensus               72.7     3.5 7.6E-05   36.3   2.8   25  177-202   417-441 (579)
114 smart00531 TFIIE Transcription  71.8     5.3 0.00012   28.7   3.2   36  122-161    98-133 (147)
115 COG1198 PriA Primosomal protei  71.7     2.3 4.9E-05   39.1   1.6   28  118-160   457-484 (730)
116 PF05290 Baculo_IE-1:  Baculovi  71.6     3.1 6.6E-05   29.0   1.8   15   64-78     78-92  (140)
117 PF09845 DUF2072:  Zn-ribbon co  70.3     2.5 5.5E-05   29.4   1.2   15  207-221     1-15  (131)
118 PRK04023 DNA polymerase II lar  70.2     4.3 9.4E-05   38.2   3.0   10  236-245   664-673 (1121)
119 TIGR02300 FYDLN_acid conserved  69.7     3.6 7.9E-05   28.4   1.9   11  178-188    26-36  (129)
120 PF02176 zf-TRAF:  TRAF-type zi  69.5     1.8 3.9E-05   25.6   0.3   21  220-240    23-43  (60)
121 PF14353 CpXC:  CpXC protein     68.8     1.2 2.7E-05   31.1  -0.5   10  125-134     3-12  (128)
122 PRK00464 nrdR transcriptional   68.3     1.2 2.6E-05   32.3  -0.7   17  152-168    29-45  (154)
123 PRK06266 transcription initiat  68.2     3.6 7.8E-05   30.7   1.8   32   93-134   116-147 (178)
124 PF04959 ARS2:  Arsenite-resist  66.7     4.9 0.00011   30.9   2.2   28   92-119    75-102 (214)
125 PF07754 DUF1610:  Domain of un  66.6     2.8   6E-05   19.8   0.6    8  207-214    16-23  (24)
126 PF00301 Rubredoxin:  Rubredoxi  65.0     2.6 5.7E-05   23.7   0.4   14    9-26      1-14  (47)
127 PF04959 ARS2:  Arsenite-resist  64.9     2.7 5.9E-05   32.2   0.6   23  207-229    77-99  (214)
128 COG1997 RPL43A Ribosomal prote  63.2     6.3 0.00014   25.3   1.9   30   66-105    35-64  (89)
129 KOG2807|consensus               62.0      16 0.00035   29.8   4.3   22  178-199   345-366 (378)
130 COG5188 PRP9 Splicing factor 3  61.0      13 0.00027   30.7   3.6   26  202-227   369-395 (470)
131 KOG2071|consensus               60.9     9.2  0.0002   33.8   3.1   28    6-37    415-442 (579)
132 PF05443 ROS_MUCR:  ROS/MUCR tr  60.1     5.5 0.00012   28.0   1.3   22  236-260    73-94  (132)
133 PRK04023 DNA polymerase II lar  59.9     7.9 0.00017   36.6   2.6    9  124-132   627-635 (1121)
134 COG5151 SSL1 RNA polymerase II  59.5      12 0.00026   30.2   3.2   22  178-199   388-409 (421)
135 PRK00432 30S ribosomal protein  58.6     4.3 9.3E-05   23.2   0.5   11  235-245    37-47  (50)
136 COG3364 Zn-ribbon containing p  57.4     7.3 0.00016   25.7   1.5   14  207-220     2-15  (112)
137 COG3091 SprT Zn-dependent meta  56.7     4.6 9.9E-05   28.9   0.5   34  206-244   116-149 (156)
138 COG5151 SSL1 RNA polymerase II  56.6     8.9 0.00019   30.9   2.1   25  206-230   387-411 (421)
139 PF08271 TF_Zn_Ribbon:  TFIIB z  56.1     8.7 0.00019   20.9   1.5   11   67-77     20-30  (43)
140 PRK09678 DNA-binding transcrip  56.1     3.9 8.4E-05   25.4   0.1   15  122-136    26-42  (72)
141 KOG4167|consensus               54.7     2.5 5.5E-05   38.0  -1.2   25  235-259   792-816 (907)
142 PF05191 ADK_lid:  Adenylate ki  54.6     5.2 0.00011   21.0   0.4    8  126-133     4-11  (36)
143 PF14446 Prok-RING_1:  Prokaryo  54.6     8.2 0.00018   22.4   1.2   26  124-161     6-31  (54)
144 COG3357 Predicted transcriptio  54.6     7.8 0.00017   25.0   1.2   10  152-161    59-68  (97)
145 KOG2593|consensus               53.7      12 0.00027   31.7   2.6   35  177-215   127-161 (436)
146 KOG0696|consensus               51.9     8.6 0.00019   32.8   1.4   45  170-214    84-128 (683)
147 PF04780 DUF629:  Protein of un  51.6     8.6 0.00019   33.3   1.4   28  178-205    57-84  (466)
148 smart00154 ZnF_AN1 AN1-like Zi  51.3     7.9 0.00017   20.7   0.8   13  235-247    12-24  (39)
149 KOG1280|consensus               50.1      14  0.0003   30.4   2.3   37   94-130    79-116 (381)
150 PRK03824 hypA hydrogenase nick  49.8       8 0.00017   27.4   0.8   15   65-79     69-83  (135)
151 KOG2272|consensus               48.8      17 0.00036   28.5   2.5   15  235-249   280-294 (332)
152 TIGR01206 lysW lysine biosynth  48.5      18 0.00039   21.0   2.0   10   67-76     23-32  (54)
153 PF09416 UPF1_Zn_bind:  RNA hel  48.3      20 0.00043   25.9   2.6   55    4-75      9-69  (152)
154 KOG2593|consensus               48.2      16 0.00034   31.1   2.4   37   92-132   126-162 (436)
155 TIGR00686 phnA alkylphosphonat  48.2     9.1  0.0002   25.7   0.9   29  153-191     4-32  (109)
156 KOG4167|consensus               47.5     5.3 0.00011   36.2  -0.4   26   65-90    791-816 (907)
157 KOG1280|consensus               47.5      15 0.00033   30.2   2.1   24  151-174    79-102 (381)
158 PRK14714 DNA polymerase II lar  45.5      19  0.0004   35.3   2.7    8  124-131   668-675 (1337)
159 COG4640 Predicted membrane pro  45.2      15 0.00032   30.9   1.7   24  202-225    10-33  (465)
160 smart00661 RPOL9 RNA polymeras  45.1      24 0.00052   19.9   2.3   11   67-77     21-31  (52)
161 KOG3408|consensus               44.8      15 0.00032   25.2   1.4   23  206-228    56-78  (129)
162 TIGR00595 priA primosomal prot  44.6      17 0.00038   32.1   2.3   15  202-216   235-249 (505)
163 PF07282 OrfB_Zn_ribbon:  Putat  44.5      14  0.0003   22.5   1.2   10  207-216    46-55  (69)
164 PF13451 zf-trcl:  Probable zin  44.0      21 0.00045   20.3   1.7   10   67-76      5-14  (49)
165 PF07975 C1_4:  TFIIH C1-like d  43.9     7.9 0.00017   22.2   0.1   20   94-113    21-40  (51)
166 cd00065 FYVE FYVE domain; Zinc  43.9      18 0.00039   20.8   1.6   14  206-219    17-30  (57)
167 PF15135 UPF0515:  Uncharacteri  43.7      11 0.00024   29.4   0.8   73  136-222    92-170 (278)
168 COG4957 Predicted transcriptio  43.7      16 0.00035   25.6   1.5   20  209-231    78-97  (148)
169 PF13824 zf-Mss51:  Zinc-finger  43.5      21 0.00046   20.8   1.8   15  204-218    11-25  (55)
170 KOG3408|consensus               43.4      13 0.00029   25.4   1.1   24  234-257    56-79  (129)
171 PF04780 DUF629:  Protein of un  43.4      18  0.0004   31.4   2.1   26   95-120    58-83  (466)
172 PRK12380 hydrogenase nickel in  42.8      11 0.00023   25.8   0.6   10  179-188    71-80  (113)
173 PF03833 PolC_DP2:  DNA polymer  42.5     8.2 0.00018   35.8   0.0   10  208-217   681-690 (900)
174 TIGR00100 hypA hydrogenase nic  41.9      10 0.00022   26.0   0.4   11  179-189    71-81  (115)
175 PRK10220 hypothetical protein;  41.8      15 0.00033   24.7   1.1   15  177-191    19-33  (111)
176 PF05495 zf-CHY:  CHY zinc fing  41.3     3.8 8.1E-05   25.4  -1.7    9  152-160    42-50  (71)
177 KOG4377|consensus               41.1      13 0.00027   31.4   0.8   19  213-231   409-427 (480)
178 PF01780 Ribosomal_L37ae:  Ribo  40.2     6.7 0.00015   25.5  -0.7   10  179-188    54-63  (90)
179 PF05129 Elf1:  Transcription e  40.2      18 0.00038   23.1   1.2   13   94-106    46-58  (81)
180 PF08790 zf-LYAR:  LYAR-type C2  40.0      12 0.00026   18.4   0.4   18   67-85      1-18  (28)
181 PF01927 Mut7-C:  Mut7-C RNAse   39.6      23  0.0005   25.4   1.9   11   66-76    124-134 (147)
182 PF01363 FYVE:  FYVE zinc finge  39.3      13 0.00029   22.5   0.6    9  180-188    11-19  (69)
183 PF14311 DUF4379:  Domain of un  39.3      20 0.00043   20.7   1.3   11  208-218    29-39  (55)
184 KOG4124|consensus               39.0     5.1 0.00011   32.8  -1.6   26  177-202   348-375 (442)
185 COG1655 Uncharacterized protei  38.8     7.7 0.00017   29.9  -0.6    9  179-187    63-71  (267)
186 KOG1842|consensus               38.7      18 0.00038   30.9   1.4   29  177-205    14-42  (505)
187 PTZ00255 60S ribosomal protein  38.0      10 0.00022   24.6  -0.1   10  179-188    55-64  (90)
188 PF10013 DUF2256:  Uncharacteri  37.9      20 0.00044   19.5   1.1   16  209-224    10-25  (42)
189 COG0068 HypF Hydrogenase matur  37.5     7.9 0.00017   35.2  -0.9   13  181-193   154-166 (750)
190 PF13453 zf-TFIIB:  Transcripti  37.3      39 0.00085   18.1   2.2   16   67-82     20-35  (41)
191 PRK00564 hypA hydrogenase nick  37.2      14  0.0003   25.5   0.4   10  208-217    72-81  (117)
192 PF01428 zf-AN1:  AN1-like Zinc  37.1      10 0.00022   20.7  -0.2   12  235-246    13-24  (43)
193 COG4530 Uncharacterized protei  36.4      31 0.00067   23.2   1.9   12  206-217    25-36  (129)
194 smart00064 FYVE Protein presen  36.2      21 0.00046   21.5   1.2   27  180-219    12-38  (68)
195 PF06220 zf-U1:  U1 zinc finger  36.0      30 0.00066   18.3   1.6   21  235-255     3-25  (38)
196 PF07800 DUF1644:  Protein of u  35.6 1.2E+02  0.0026   22.1   4.9   17  191-207   121-137 (162)
197 PF13878 zf-C2H2_3:  zinc-finge  35.6      47   0.001   17.9   2.3   24    9-36     13-38  (41)
198 KOG1842|consensus               35.4      23 0.00051   30.2   1.6   26   66-91     15-40  (505)
199 TIGR00280 L37a ribosomal prote  35.3      10 0.00022   24.6  -0.4   11  178-188    53-63  (91)
200 COG1571 Predicted DNA-binding   34.9      24 0.00052   30.1   1.6   14  207-220   367-380 (421)
201 COG4888 Uncharacterized Zn rib  34.4      12 0.00025   24.8  -0.3    8  124-131    23-30  (104)
202 PRK14873 primosome assembly pr  33.9      27 0.00059   32.1   1.9   14  202-215   405-418 (665)
203 smart00440 ZnF_C2C2 C2C2 Zinc   33.8      12 0.00025   20.2  -0.3    9   95-103    29-37  (40)
204 PF01155 HypA:  Hydrogenase exp  33.4      15 0.00031   25.1   0.1   12  208-219    71-82  (113)
205 PF09963 DUF2197:  Uncharacteri  33.1      18 0.00038   21.2   0.4    9   68-76      4-12  (56)
206 KOG0717|consensus               33.0      24 0.00051   30.4   1.2   22  236-257   293-314 (508)
207 KOG2907|consensus               32.5      32 0.00069   23.3   1.5   11   95-105   103-113 (116)
208 PRK05580 primosome assembly pr  31.9      35 0.00075   31.6   2.2   11  205-215   406-416 (679)
209 COG0068 HypF Hydrogenase matur  31.7      15 0.00032   33.5  -0.2   13   97-109   154-166 (750)
210 PF04423 Rad50_zn_hook:  Rad50   31.5      17 0.00037   20.9   0.1   12  237-248    22-33  (54)
211 PRK03681 hypA hydrogenase nick  31.4      14 0.00031   25.3  -0.2    9  179-187    71-79  (114)
212 PF01096 TFIIS_C:  Transcriptio  31.3     6.1 0.00013   21.1  -1.6    8   95-102    29-36  (39)
213 KOG0717|consensus               31.2      21 0.00047   30.7   0.7   22  152-173   293-314 (508)
214 COG4896 Uncharacterized protei  30.6      29 0.00063   20.6   1.0   41  179-220     3-44  (68)
215 PF07649 C1_3:  C1-like domain;  29.4      22 0.00048   17.5   0.3    6  208-213    16-21  (30)
216 PRK03976 rpl37ae 50S ribosomal  29.2      14 0.00031   24.0  -0.5   11  178-188    54-64  (90)
217 PRK05978 hypothetical protein;  28.6      20 0.00044   25.8   0.2   10  209-218    54-63  (148)
218 PRK04351 hypothetical protein;  28.2      24 0.00052   25.5   0.4   11  234-244   131-141 (149)
219 PF10263 SprT-like:  SprT-like   27.9      15 0.00033   26.5  -0.6   10  179-188   124-133 (157)
220 PF04216 FdhE:  Protein involve  27.8     6.5 0.00014   31.9  -2.8   55  148-217   194-248 (290)
221 COG5112 UFD2 U1-like Zn-finger  27.6      29 0.00062   23.1   0.7   23  206-228    54-76  (126)
222 COG1773 Rubredoxin [Energy pro  25.9      39 0.00086   19.7   1.0   13    8-24      2-14  (55)
223 KOG2636|consensus               25.8      47   0.001   28.5   1.8   28  201-228   395-423 (497)
224 KOG3507|consensus               25.4      53  0.0011   19.4   1.4   33   64-107    18-50  (62)
225 PLN02294 cytochrome c oxidase   25.3      35 0.00076   25.1   0.9   13  234-246   140-152 (174)
226 PF03145 Sina:  Seven in absent  25.3      58  0.0013   24.6   2.1   46  157-204    24-73  (198)
227 cd00924 Cyt_c_Oxidase_Vb Cytoc  25.2      35 0.00075   22.6   0.8   13  234-246    78-90  (97)
228 PF08209 Sgf11:  Sgf11 (transcr  25.1      68  0.0015   16.5   1.7   21  236-257     5-25  (33)
229 COG1675 TFA1 Transcription ini  24.5   1E+02  0.0022   23.0   3.2   13  206-218   112-124 (176)
230 PTZ00448 hypothetical protein;  24.3      57  0.0012   27.4   2.0   23  235-257   314-336 (373)
231 PF06397 Desulfoferrod_N:  Desu  23.9      32  0.0007   18.1   0.3   10  235-244     6-15  (36)
232 COG4338 Uncharacterized protei  23.8      32 0.00069   19.3   0.3   17  209-225    14-30  (54)
233 PF14369 zf-RING_3:  zinc-finge  23.7      98  0.0021   16.0   2.2    8   97-104    24-31  (35)
234 TIGR03826 YvyF flagellar opero  23.6      45 0.00098   23.7   1.1   12  207-218    81-92  (137)
235 PRK03564 formate dehydrogenase  23.4      31 0.00067   28.3   0.3   13  147-159   208-220 (309)
236 KOG2636|consensus               23.4      60  0.0013   27.9   2.0   28  228-255   394-422 (497)
237 PF14803 Nudix_N_2:  Nudix N-te  23.4      52  0.0011   17.0   1.1    9   67-75     23-31  (34)
238 PRK14892 putative transcriptio  23.3      22 0.00047   23.7  -0.5   11  208-218    43-53  (99)
239 COG1998 RPS31 Ribosomal protei  23.3      30 0.00065   19.6   0.2    9  236-244    38-46  (51)
240 PF03811 Zn_Tnp_IS1:  InsA N-te  22.6      14 0.00031   19.4  -1.2   11  203-213    25-35  (36)
241 PTZ00448 hypothetical protein;  21.1      71  0.0015   26.8   1.9   23  207-229   314-336 (373)
242 PRK00762 hypA hydrogenase nick  21.0      34 0.00073   23.8   0.1   10  179-189    71-80  (124)
243 PF10083 DUF2321:  Uncharacteri  21.0      25 0.00054   25.4  -0.5   18  149-166    66-83  (158)
244 PF02591 DUF164:  Putative zinc  20.5      80  0.0017   18.2   1.6   31  209-243    24-54  (56)
245 smart00731 SprT SprT homologue  20.5      38 0.00082   24.3   0.3   11  178-188   112-122 (146)
246 TIGR01384 TFS_arch transcripti  20.1      45 0.00098   22.2   0.6   13  207-219    16-28  (104)

No 1  
>KOG2462|consensus
Probab=99.97  E-value=6.3e-32  Score=203.36  Aligned_cols=135  Identities=30%  Similarity=0.653  Sum_probs=127.7

Q ss_pred             CCcccCccccccccCchhHHhHHhhhCC---CCccccCcccccccCcchHHHHHhhcCCCcccCCcchhcCCCChHHHHH
Q psy11589        121 VREHQCSVCGKAFADITNMKVHMRIHTG---EKKYVCETCGASFALWGSLNVHSYSHTNTQFVCSYCGNTYKNPKALTSH  197 (262)
Q Consensus       121 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~---~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~f~~~~~l~~H  197 (262)
                      ...|+|+.|++.+.+..+|.+|..+|..   .+.+.|+.|++.|.+...|..|+++|+ .+.+|.+||+.|.....|..|
T Consensus       128 ~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~-l~c~C~iCGKaFSRPWLLQGH  206 (279)
T KOG2462|consen  128 HPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT-LPCECGICGKAFSRPWLLQGH  206 (279)
T ss_pred             CCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC-CCcccccccccccchHHhhcc
Confidence            3458999999999999999999999864   567999999999999999999999998 689999999999999999999


Q ss_pred             HHhhcCCCCcccccccccccCChHHHHHHHHhhCCCCCccCCCCCcccCChHHHHHHHHh
Q psy11589        198 IRNSHTIHQKSICDVCGKEFRMKRQLKEHMAVHTTDRPFVCNMCPSTFKLKKHLRQHYKV  257 (262)
Q Consensus       198 ~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~  257 (262)
                      +| .|+||+||.|+.|++.|..+++|+.||++|.+.|+|+|..|+|+|...+-|.+|...
T Consensus       207 iR-THTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  207 IR-THTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             cc-cccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhhh
Confidence            99 899999999999999999999999999999999999999999999999999999864


No 2  
>KOG1074|consensus
Probab=99.97  E-value=1.6e-31  Score=226.62  Aligned_cols=78  Identities=35%  Similarity=0.774  Sum_probs=72.2

Q ss_pred             ccCccccccccCchhHHhHHhhhCCCCccccCcccccccCcchHHHHHhhcCC-----CcccCC---cchhcCCCChHHH
Q psy11589        124 HQCSVCGKAFADITNMKVHMRIHTGEKKYVCETCGASFALWGSLNVHSYSHTN-----TQFVCS---YCGNTYKNPKALT  195 (262)
Q Consensus       124 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~-----~~~~C~---~C~~~f~~~~~l~  195 (262)
                      -+|-+|.++..-...|+.|.++|.|++||+|.+||+.|.++.+|+.|+-.|..     .++.|+   +|.+.|...-.|.
T Consensus       606 NqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn~V~lp  685 (958)
T KOG1074|consen  606 NQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTNAVTLP  685 (958)
T ss_pred             cceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhccccccccccc
Confidence            48999999999999999999999999999999999999999999999999876     358899   9999999999999


Q ss_pred             HHHHhhc
Q psy11589        196 SHIRNSH  202 (262)
Q Consensus       196 ~H~~~~H  202 (262)
                      .|++ +|
T Consensus       686 QhIr-iH  691 (958)
T KOG1074|consen  686 QHIR-IH  691 (958)
T ss_pred             ceEE-ee
Confidence            9988 66


No 3  
>KOG3608|consensus
Probab=99.95  E-value=2.4e-28  Score=188.94  Aligned_cols=232  Identities=22%  Similarity=0.389  Sum_probs=195.4

Q ss_pred             Cceecc--cCCCCCceeeehHHHHHHHhhhccCCccCccccccccccccccccccCCCcc---ceecCCCcccccchhHH
Q psy11589          8 SDFVCN--LCPPGSKVVVKYVHYLERHVRKHHTMFLRLPKVHSHFRKKNAIHVNNINKKV---SYKCPDCSVIVVSYSGF   82 (262)
Q Consensus         8 ~~~~C~--~C~~~~~~~~~~~~~l~~H~~~~~~~~~~~~~l~~~~~~~~~~h~~~~~~~~---~~~C~~C~~~f~~~~~l   82 (262)
                      ..|.|.  .|+.    .|.+...|..|+..|.. |. ..+.           ..+..+++   +..+..|-+.+.++..|
T Consensus       133 ~~f~C~WedCe~----~F~s~~ef~dHV~~H~l-~c-eyd~-----------~~~~~D~~pv~~C~W~~Ct~~~~~k~~L  195 (467)
T KOG3608|consen  133 QNFRCGWEDCER----EFVSIVEFQDHVVKHAL-FC-EYDI-----------QKTPEDERPVTMCNWAMCTKHMGNKYRL  195 (467)
T ss_pred             hhhccChhhcCC----cccCHHHHHHHHHHhhh-hh-hhhh-----------hhCCCCCCceeeccchhhhhhhccHHHH
Confidence            346675  5999    99999999999987753 11 0000           11111222   34457899999999999


Q ss_pred             HhhhhhcCCCCeeecCcchhhccChhHHHHHHHHhh-cCCCcccCccccccccCchhHHhHHhhhCCCCccccCcccccc
Q psy11589         83 KSHLDIHNVEKEYCCHICKKVFLRNRNLVCHIKAVH-ENVREHQCSVCGKAFADITNMKVHMRIHTGEKKYVCETCGASF  161 (262)
Q Consensus        83 ~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h-~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f  161 (262)
                      ++|++.|.+++...|+.|+..|.++..|..|+++.- ....+|.|..|.+.|.++..|..|+..|-.  -|+|+.|+-+.
T Consensus       196 reH~r~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn--~ykCplCdmtc  273 (467)
T KOG3608|consen  196 REHIRTHSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHVN--CYKCPLCDMTC  273 (467)
T ss_pred             HHHHHhcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhhh--cccccccccCC
Confidence            999999999999999999999999999999976543 345689999999999999999999999864  59999999999


Q ss_pred             cCcchHHHHHhhcCC--CcccCCcchhcCCCChHHHHHHHhhcCCCCcccccc--cccccCChHHHHHHHHhhC-C--CC
Q psy11589        162 ALWGSLNVHSYSHTN--TQFVCSYCGNTYKNPKALTSHIRNSHTIHQKSICDV--CGKEFRMKRQLKEHMAVHT-T--DR  234 (262)
Q Consensus       162 ~~~~~l~~H~~~h~~--~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~C~~--C~~~f~~~~~l~~H~~~h~-~--~~  234 (262)
                      ...++|..|++.-+.  +||+|+.|++.|.+.+.|.+|+. +|+ +..|+|..  |.++|.+..+|.+|++.++ |  +-
T Consensus       274 ~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~-~HS-~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np~  351 (467)
T KOG3608|consen  274 SSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQ-VHS-KTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNPI  351 (467)
T ss_pred             CChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHH-hcc-ccceecCCCCCcHHHHHHHHHHHHHHHhccCCCCC
Confidence            999999999987554  89999999999999999999999 898 67899988  9999999999999998655 4  45


Q ss_pred             CccCCCCCcccCChHHHHHHHHhhcc
Q psy11589        235 PFVCNMCPSTFKLKKHLRQHYKVHLK  260 (262)
Q Consensus       235 ~~~C~~C~~~f~~~~~L~~H~~~H~~  260 (262)
                      +|.|..|++.|++-.+|.+|+...++
T Consensus       352 ~Y~CH~Cdr~ft~G~~L~~HL~kkH~  377 (467)
T KOG3608|consen  352 LYACHCCDRFFTSGKSLSAHLMKKHG  377 (467)
T ss_pred             ceeeecchhhhccchhHHHHHHHhhc
Confidence            69999999999999999999865443


No 4  
>KOG2462|consensus
Probab=99.95  E-value=9e-29  Score=186.40  Aligned_cols=133  Identities=32%  Similarity=0.662  Sum_probs=121.1

Q ss_pred             CeeecCcchhhccChhHHHHHHHHhhc---CCCcccCccccccccCchhHHhHHhhhCCCCccccCcccccccCcchHHH
Q psy11589         93 KEYCCHICKKVFLRNRNLVCHIKAVHE---NVREHQCSVCGKAFADITNMKVHMRIHTGEKKYVCETCGASFALWGSLNV  169 (262)
Q Consensus        93 ~~~~C~~C~~~f~~~~~l~~H~~~~h~---~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~  169 (262)
                      ..|+|+.|++.+.+..+|.+| +..|-   ..+.+.|++|++++.+...|..|+++|.  -+.+|.+|||.|...+.|..
T Consensus       129 ~r~~c~eCgk~ysT~snLsrH-kQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQG  205 (279)
T KOG2462|consen  129 PRYKCPECGKSYSTSSNLSRH-KQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQG  205 (279)
T ss_pred             Cceeccccccccccccccchh-hcccccccccccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhc
Confidence            458999999999999999999 55663   3567999999999999999999999997  57999999999999999999


Q ss_pred             HHhhcCC-CcccCCcchhcCCCChHHHHHHHhhcCCCCcccccccccccCChHHHHHHHHh
Q psy11589        170 HSYSHTN-TQFVCSYCGNTYKNPKALTSHIRNSHTIHQKSICDVCGKEFRMKRQLKEHMAV  229 (262)
Q Consensus       170 H~~~h~~-~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~  229 (262)
                      |+++|+| +||.|+.|++.|.++++|+.||+ .|.+.++|+|+.|++.|..++.|..|...
T Consensus       206 HiRTHTGEKPF~C~hC~kAFADRSNLRAHmQ-THS~~K~~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  206 HIRTHTGEKPFSCPHCGKAFADRSNLRAHMQ-THSDVKKHQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             ccccccCCCCccCCcccchhcchHHHHHHHH-hhcCCccccCcchhhHHHHHHHHHHhhhh
Confidence            9999999 89999999999999999999999 79999999999999999999999999754


No 5  
>KOG1074|consensus
Probab=99.94  E-value=5.2e-28  Score=205.47  Aligned_cols=166  Identities=29%  Similarity=0.631  Sum_probs=146.0

Q ss_pred             eeecCcchhhccChhHHHHHHHHhhcCCCcccCccccccccCchhHHhHHhhhCCCC----ccccC---cccccccCcch
Q psy11589         94 EYCCHICKKVFLRNRNLVCHIKAVHENVREHQCSVCGKAFADITNMKVHMRIHTGEK----KYVCE---TCGASFALWGS  166 (262)
Q Consensus        94 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~----~~~C~---~C~~~f~~~~~  166 (262)
                      |-.|-+|-++...++.|+.| .+.|+||+||+|.+|++.|.++.+|+.|+.+|....    ++.|+   +|.+.|...-.
T Consensus       605 PNqCiiC~rVlSC~saLqmH-yrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn~V~  683 (958)
T KOG1074|consen  605 PNQCIICLRVLSCPSALQMH-YRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTNAVT  683 (958)
T ss_pred             ccceeeeeecccchhhhhhh-hhcccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhccccccccc
Confidence            47899999999999999999 568999999999999999999999999999987553    48899   99999999999


Q ss_pred             HHHHHhhcCCC--------------cccCCcchhcCCCChHHHHHHHhhcCCC---------------------------
Q psy11589        167 LNVHSYSHTNT--------------QFVCSYCGNTYKNPKALTSHIRNSHTIH---------------------------  205 (262)
Q Consensus       167 l~~H~~~h~~~--------------~~~C~~C~~~f~~~~~l~~H~~~~H~~~---------------------------  205 (262)
                      |..|+++|.+.              .-.|..|.+.|.....+..++. .|.+.                           
T Consensus       684 lpQhIriH~~~~~s~g~~a~e~~~~adq~~~~qk~~~~a~~f~~~~s-e~~~~~s~~~~~~~~~t~t~~~~~tp~~~e~~  762 (958)
T KOG1074|consen  684 LPQHIRIHLGGQISNGGTAAEGILAADQCSSCQKTFSDARSFSQQIS-EQPSPESEPDEQMDERTETEELDVTPPPPENS  762 (958)
T ss_pred             ccceEEeecCCCCCCCcccccccchhcccchhhhcccccccchhhhh-ccCCcccCCcccccccccccccccCCCccccc
Confidence            99999999741              1468999999988888877765 23000                           


Q ss_pred             --------------------------------------------------------------------------------
Q psy11589        206 --------------------------------------------------------------------------------  205 (262)
Q Consensus       206 --------------------------------------------------------------------------------  205 (262)
                                                                                                      
T Consensus       763 ~~~~~~~e~~i~~~g~te~asa~~~~vg~~s~~~~~~~~~~T~~k~~~~~~~~~~~~~~~v~~~pvl~~~~~~~l~eg~~  842 (958)
T KOG1074|consen  763 CGRELEGEMAISVRGSTEEASANLDEVGTVSAAGEAGEEDDTSEKPTQASSFPGEILAPSVNMDPVLWNQETSMLNEGLA  842 (958)
T ss_pred             cccccCcccccccccchhhhhcChhhhcCccccchhhhhcccCCCCcccccCCCcCCccccccCchhhcccccccccccc
Confidence                                                                                            


Q ss_pred             -----------------------------------CcccccccccccCChHHHHHHHHhhCCCCCccCCCCCcccCChHH
Q psy11589        206 -----------------------------------QKSICDVCGKEFRMKRQLKEHMAVHTTDRPFVCNMCPSTFKLKKH  250 (262)
Q Consensus       206 -----------------------------------~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~  250 (262)
                                                         ....|.+||+.|.+.+.|..|+++|+++|||.|..|++.|..+.+
T Consensus       843 t~~n~~t~~~~~~sv~qs~~~p~l~p~l~~~~pvnn~h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgn  922 (958)
T KOG1074|consen  843 TKTNEITPEGPADSVIQSGGVPTLEPSLGRPGPVNNAHVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGN  922 (958)
T ss_pred             cccccccCCCcchhhhhhccccccCCCCCCCCcccchhhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhh
Confidence                                               016799999999999999999999999999999999999999999


Q ss_pred             HHHHHHhhccC
Q psy11589        251 LRQHYKVHLKM  261 (262)
Q Consensus       251 L~~H~~~H~~~  261 (262)
                      |+.||.+|+..
T Consensus       923 LKvHMgtH~w~  933 (958)
T KOG1074|consen  923 LKVHMGTHMWV  933 (958)
T ss_pred             hhhhhcccccc
Confidence            99999999854


No 6  
>KOG3623|consensus
Probab=99.94  E-value=2.4e-27  Score=198.58  Aligned_cols=77  Identities=27%  Similarity=0.674  Sum_probs=75.0

Q ss_pred             ccCCcchhcCCCChHHHHHHHhhcCCCCcccccccccccCChHHHHHHHHhhCCCCCccCCCCCcccCChHHHHHHHH
Q psy11589        179 FVCSYCGNTYKNPKALTSHIRNSHTIHQKSICDVCGKEFRMKRQLKEHMAVHTTDRPFVCNMCPSTFKLKKHLRQHYK  256 (262)
Q Consensus       179 ~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~  256 (262)
                      |.|+.|++.|...+.|.+|.- .|+|.+||+|.+|.+.|..+..|..|+|.|.|||||+|+.|++.|+...+...||-
T Consensus       895 yaCDqCDK~FqKqSSLaRHKY-EHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRFSHSGSYSQHMN  971 (1007)
T KOG3623|consen  895 YACDQCDKAFQKQSSLARHKY-EHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSHSGSYSQHMN  971 (1007)
T ss_pred             chHHHHHHHHHhhHHHHHhhh-hhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhcccccchHhhhc
Confidence            899999999999999999988 89999999999999999999999999999999999999999999999999999983


No 7  
>KOG3608|consensus
Probab=99.93  E-value=1e-25  Score=174.53  Aligned_cols=190  Identities=26%  Similarity=0.515  Sum_probs=171.7

Q ss_pred             eec--CCCcccccchhHHHhhhhhcCC------------C-CeeecCc--chhhccChhHHHHHHHHhhcCCCcccCccc
Q psy11589         67 YKC--PDCSVIVVSYSGFKSHLDIHNV------------E-KEYCCHI--CKKVFLRNRNLVCHIKAVHENVREHQCSVC  129 (262)
Q Consensus        67 ~~C--~~C~~~f~~~~~l~~H~~~h~~------------~-~~~~C~~--C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C  129 (262)
                      |.|  ..|+..|.+...|..|+..|..            + ..+.|.+  |...+.++..|+.| .+.|++++...|+.|
T Consensus       135 f~C~WedCe~~F~s~~ef~dHV~~H~l~ceyd~~~~~~D~~pv~~C~W~~Ct~~~~~k~~LreH-~r~Hs~eKvvACp~C  213 (467)
T KOG3608|consen  135 FRCGWEDCEREFVSIVEFQDHVVKHALFCEYDIQKTPEDERPVTMCNWAMCTKHMGNKYRLREH-IRTHSNEKVVACPHC  213 (467)
T ss_pred             hccChhhcCCcccCHHHHHHHHHHhhhhhhhhhhhCCCCCCceeeccchhhhhhhccHHHHHHH-HHhcCCCeEEecchH
Confidence            555  7899999999999999877742            2 1256765  99999999999999 568999999999999


Q ss_pred             cccccCchhHHhHHhhh--CCCCccccCcccccccCcchHHHHHhhcCCCcccCCcchhcCCCChHHHHHHHhhcCCCCc
Q psy11589        130 GKAFADITNMKVHMRIH--TGEKKYVCETCGASFALWGSLNVHSYSHTNTQFVCSYCGNTYKNPKALTSHIRNSHTIHQK  207 (262)
Q Consensus       130 ~~~f~~~~~l~~H~~~h--~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~  207 (262)
                      +..|.+...|-.|++..  ....+|.|..|.+.|.+...|..|+..|. .-|+|+.|+.+...+++|..|++..|..++|
T Consensus       214 g~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHv-n~ykCplCdmtc~~~ssL~~H~r~rHs~dkp  292 (467)
T KOG3608|consen  214 GELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHV-NCYKCPLCDMTCSSASSLTTHIRYRHSKDKP  292 (467)
T ss_pred             HHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhh-hcccccccccCCCChHHHHHHHHhhhccCCC
Confidence            99999999999997654  35678999999999999999999999987 4799999999999999999999999999999


Q ss_pred             ccccccccccCChHHHHHHHHhhCCCCCccCCC--CCcccCChHHHHHHHHhhc
Q psy11589        208 SICDVCGKEFRMKRQLKEHMAVHTTDRPFVCNM--CPSTFKLKKHLRQHYKVHL  259 (262)
Q Consensus       208 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~--C~~~f~~~~~L~~H~~~H~  259 (262)
                      |+|+.|++.|.+.++|..|..+|+ +-.|.|..  |.+++.+...|++|++-++
T Consensus       293 fKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~~q~~~H~~evh  345 (467)
T KOG3608|consen  293 FKCDECDTRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTYTQMRRHFLEVH  345 (467)
T ss_pred             ccccchhhhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHHHHHHHHHHHHhc
Confidence            999999999999999999999998 77799988  9999999999999998765


No 8  
>KOG3623|consensus
Probab=99.86  E-value=2e-22  Score=169.31  Aligned_cols=106  Identities=32%  Similarity=0.681  Sum_probs=93.5

Q ss_pred             eecCCCcccccchhHHHhhhhhcC--CCCeeecCcchhhccChhHHHHHHHHhhcC-------------CCcccCccccc
Q psy11589         67 YKCPDCSVIVVSYSGFKSHLDIHN--VEKEYCCHICKKVFLRNRNLVCHIKAVHEN-------------VREHQCSVCGK  131 (262)
Q Consensus        67 ~~C~~C~~~f~~~~~l~~H~~~h~--~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~-------------~~~~~C~~C~~  131 (262)
                      ..|+.|+..+....+|..|++.-+  .+..|.|.+|.++|..+..|.+||. .|..             .+.|+|..|++
T Consensus       211 ltcpycdrgykrltslkeHikyrhekne~nfsC~lCsytFAyRtQLErhm~-~hkpg~dqa~sltqsa~lRKFKCtECgK  289 (1007)
T KOG3623|consen  211 LTCPYCDRGYKRLTSLKEHIKYRHEKNEPNFSCMLCSYTFAYRTQLERHMQ-LHKPGGDQAISLTQSALLRKFKCTECGK  289 (1007)
T ss_pred             hcchhHHHHHHHHHHHHHHHHHHHhhCCCCCcchhhhhhhhhHHHHHHHHH-hhcCCCcccccccchhhhccccccccch
Confidence            689999999999999999987533  3445999999999999999999965 4532             25699999999


Q ss_pred             cccCchhHHhHHhhhCCCCccccCcccccccCcchHHHHHhh
Q psy11589        132 AFADITNMKVHMRIHTGEKKYVCETCGASFALWGSLNVHSYS  173 (262)
Q Consensus       132 ~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~  173 (262)
                      .|+.+-.|+.|+++|.|++||.|+.|+|.|....++..|+..
T Consensus       290 AFKfKHHLKEHlRIHSGEKPfeCpnCkKRFSHSGSySSHmSS  331 (1007)
T KOG3623|consen  290 AFKFKHHLKEHLRIHSGEKPFECPNCKKRFSHSGSYSSHMSS  331 (1007)
T ss_pred             hhhhHHHHHhhheeecCCCCcCCcccccccccCCcccccccc
Confidence            999999999999999999999999999999999999999653


No 9  
>KOG3576|consensus
Probab=99.75  E-value=3.4e-19  Score=128.33  Aligned_cols=111  Identities=27%  Similarity=0.590  Sum_probs=86.5

Q ss_pred             CCccccCcccccccCcchHHHHHhhcCC-CcccCCcchhcCCCChHHHHHHHhhcCCCCcccccccccccCChHHHHHHH
Q psy11589        149 EKKYVCETCGASFALWGSLNVHSYSHTN-TQFVCSYCGNTYKNPKALTSHIRNSHTIHQKSICDVCGKEFRMKRQLKEHM  227 (262)
Q Consensus       149 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~-~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~  227 (262)
                      ...|.|.+|++.|.....|.+|++-|.+ +.+-|..||+.|.+.-.|++|++ .|++.+||+|..|+++|.++-.|..|+
T Consensus       115 ~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~r-thtgvrpykc~~c~kaftqrcsleshl  193 (267)
T KOG3576|consen  115 QDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTR-THTGVRPYKCSLCEKAFTQRCSLESHL  193 (267)
T ss_pred             CCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhc-cccCccccchhhhhHHHHhhccHHHHH
Confidence            4457788888888888888888888777 67788888888888888888888 688888888888888888888888886


Q ss_pred             HhhCC-----------CCCccCCCCCcccCChHHHHHHHHhhcc
Q psy11589        228 AVHTT-----------DRPFVCNMCPSTFKLKKHLRQHYKVHLK  260 (262)
Q Consensus       228 ~~h~~-----------~~~~~C~~C~~~f~~~~~L~~H~~~H~~  260 (262)
                      +.-+|           +|.|.|..||++-.....+..|++.|+.
T Consensus       194 ~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp  237 (267)
T KOG3576|consen  194 KKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHP  237 (267)
T ss_pred             HHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCC
Confidence            54332           3678888888888888888888877754


No 10 
>KOG3576|consensus
Probab=99.72  E-value=1.5e-18  Score=125.01  Aligned_cols=83  Identities=35%  Similarity=0.680  Sum_probs=50.5

Q ss_pred             CeeecCcchhhccChhHHHHHHHHhhcCCCcccCccccccccCchhHHhHHhhhCCCCccccCcccccccCcchHHHHHh
Q psy11589         93 KEYCCHICKKVFLRNRNLVCHIKAVHENVREHQCSVCGKAFADITNMKVHMRIHTGEKKYVCETCGASFALWGSLNVHSY  172 (262)
Q Consensus        93 ~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~  172 (262)
                      ..|.|.+|++.|.....|.+| ..-|...+.+.|..||+.|.....|.+|+++|+|.+||+|..|++.|+.+-+|..|++
T Consensus       116 d~ftCrvCgK~F~lQRmlnrh-~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl~  194 (267)
T KOG3576|consen  116 DSFTCRVCGKKFGLQRMLNRH-LKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHLK  194 (267)
T ss_pred             CeeeeehhhhhhhHHHHHHHH-hhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHHH
Confidence            346666666666666666666 3355555566666666666666666666666666666666666666666666666655


Q ss_pred             hcCC
Q psy11589        173 SHTN  176 (262)
Q Consensus       173 ~h~~  176 (262)
                      ..++
T Consensus       195 kvhg  198 (267)
T KOG3576|consen  195 KVHG  198 (267)
T ss_pred             HHcC
Confidence            4443


No 11 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.39  E-value=1.1e-12  Score=111.58  Aligned_cols=144  Identities=24%  Similarity=0.490  Sum_probs=111.1

Q ss_pred             eeecCcchhhccChhHHHHHHHHhhcCCCcccCcc--ccccccCchhHHhHHhhhCCCCccccCcccccccCcchHHHHH
Q psy11589         94 EYCCHICKKVFLRNRNLVCHIKAVHENVREHQCSV--CGKAFADITNMKVHMRIHTGEKKYVCETCGASFALWGSLNVHS  171 (262)
Q Consensus        94 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~  171 (262)
                      .-.|+.|..... ...|..|. . +-.-....|+.  |+..|. ...+..|         +.|+.|++.|. ...|..|+
T Consensus       407 ~V~C~NC~~~i~-l~~l~lHe-~-~C~r~~V~Cp~~~Cg~v~~-r~el~~H---------~~C~~Cgk~f~-~s~LekH~  472 (567)
T PLN03086        407 TVECRNCKHYIP-SRSIALHE-A-YCSRHNVVCPHDGCGIVLR-VEEAKNH---------VHCEKCGQAFQ-QGEMEKHM  472 (567)
T ss_pred             eEECCCCCCccc-hhHHHHHH-h-hCCCcceeCCcccccceee-ccccccC---------ccCCCCCCccc-hHHHHHHH
Confidence            357999887655 44566773 2 22223457874  999884 3334444         58999999996 67899999


Q ss_pred             hhcCCCcccCCcchhcCCCChHHHHHHHhhcCCCCcccccccccccC----------ChHHHHHHHHhhCCCCCccCCCC
Q psy11589        172 YSHTNTQFVCSYCGNTYKNPKALTSHIRNSHTIHQKSICDVCGKEFR----------MKRQLKEHMAVHTTDRPFVCNMC  241 (262)
Q Consensus       172 ~~h~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~C~~C~~~f~----------~~~~l~~H~~~h~~~~~~~C~~C  241 (262)
                      ..++ .++.|+ |++.+ ....|..|+. .|.+.+++.|+.|++.|.          ..+.|..|..+. |.+++.|..|
T Consensus       473 ~~~H-kpv~Cp-Cg~~~-~R~~L~~H~~-thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G~rt~~C~~C  547 (567)
T PLN03086        473 KVFH-EPLQCP-CGVVL-EKEQMVQHQA-STCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC-GSRTAPCDSC  547 (567)
T ss_pred             HhcC-CCccCC-CCCCc-chhHHHhhhh-ccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHhc-CCcceEcccc
Confidence            9986 899999 99755 6789999988 799999999999999995          245899999885 9999999999


Q ss_pred             CcccCChHHHHHHHHh
Q psy11589        242 PSTFKLKKHLRQHYKV  257 (262)
Q Consensus       242 ~~~f~~~~~L~~H~~~  257 (262)
                      |+.+.. ..|..|+..
T Consensus       548 gk~Vrl-rdm~~H~~~  562 (567)
T PLN03086        548 GRSVML-KEMDIHQIA  562 (567)
T ss_pred             CCeeee-hhHHHHHHH
Confidence            988765 567788754


No 12 
>PHA00733 hypothetical protein
Probab=99.38  E-value=7e-13  Score=92.40  Aligned_cols=82  Identities=17%  Similarity=0.327  Sum_probs=62.2

Q ss_pred             CcccCCcchhcCCCChHHHHH--HH--hhcCCCCcccccccccccCChHHHHHHHHhhCCCCCccCCCCCcccCChHHHH
Q psy11589        177 TQFVCSYCGNTYKNPKALTSH--IR--NSHTIHQKSICDVCGKEFRMKRQLKEHMAVHTTDRPFVCNMCPSTFKLKKHLR  252 (262)
Q Consensus       177 ~~~~C~~C~~~f~~~~~l~~H--~~--~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~  252 (262)
                      +++.|.+|...|.....|..+  +.  ..+.+.+||.|+.||+.|.+...|..|++.|  +.+|.|+.|++.|.....|.
T Consensus        39 ~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~~sL~  116 (128)
T PHA00733         39 KRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNTDSTL  116 (128)
T ss_pred             hhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCHHHHH
Confidence            566777777666666555544  11  1234578899999999999999999998876  45789999999999999999


Q ss_pred             HHHHhhcc
Q psy11589        253 QHYKVHLK  260 (262)
Q Consensus       253 ~H~~~H~~  260 (262)
                      .|++..++
T Consensus       117 ~H~~~~h~  124 (128)
T PHA00733        117 DHVCKKHN  124 (128)
T ss_pred             HHHHHhcC
Confidence            99877665


No 13 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.26  E-value=2.4e-11  Score=103.48  Aligned_cols=146  Identities=20%  Similarity=0.403  Sum_probs=107.0

Q ss_pred             eecccCCCCCceeeehHHHHHHHhhhccCCccCccccccccccccccccccCCCccceecC--CCcccccchhHHHhhhh
Q psy11589         10 FVCNLCPPGSKVVVKYVHYLERHVRKHHTMFLRLPKVHSHFRKKNAIHVNNINKKVSYKCP--DCSVIVVSYSGFKSHLD   87 (262)
Q Consensus        10 ~~C~~C~~~~~~~~~~~~~l~~H~~~~~~~~~~~~~l~~~~~~~~~~h~~~~~~~~~~~C~--~C~~~f~~~~~l~~H~~   87 (262)
                      -.|+.|..     ......|..|.....                          -..-.|+  .|+..|. +..+..|  
T Consensus       408 V~C~NC~~-----~i~l~~l~lHe~~C~--------------------------r~~V~Cp~~~Cg~v~~-r~el~~H--  453 (567)
T PLN03086        408 VECRNCKH-----YIPSRSIALHEAYCS--------------------------RHNVVCPHDGCGIVLR-VEEAKNH--  453 (567)
T ss_pred             EECCCCCC-----ccchhHHHHHHhhCC--------------------------CcceeCCcccccceee-ccccccC--
Confidence            46999987     344566778865431                          0113577  4888883 3333444  


Q ss_pred             hcCCCCeeecCcchhhccChhHHHHHHHHhhcCCCcccCccccccccCchhHHhHHhhhCCCCccccCcccccccC----
Q psy11589         88 IHNVEKEYCCHICKKVFLRNRNLVCHIKAVHENVREHQCSVCGKAFADITNMKVHMRIHTGEKKYVCETCGASFAL----  163 (262)
Q Consensus        88 ~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~----  163 (262)
                             +.|+.|++.|. ...|..|+...|   .++.|+ |++.+ ....|..|+.+|.+++++.|+.|++.+..    
T Consensus       454 -------~~C~~Cgk~f~-~s~LekH~~~~H---kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~  520 (567)
T PLN03086        454 -------VHCEKCGQAFQ-QGEMEKHMKVFH---EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSA  520 (567)
T ss_pred             -------ccCCCCCCccc-hHHHHHHHHhcC---CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccc
Confidence                   58999999885 678999966543   778999 99755 56889999999999999999999998852    


Q ss_pred             ------cchHHHHHhhcCCCcccCCcchhcCCCChHHHHHHHhhcC
Q psy11589        164 ------WGSLNVHSYSHTNTQFVCSYCGNTYKNPKALTSHIRNSHT  203 (262)
Q Consensus       164 ------~~~l~~H~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~~H~  203 (262)
                            ...|..|......+++.|..||+.+... .|..|+...|.
T Consensus       521 ~d~~d~~s~Lt~HE~~CG~rt~~C~~Cgk~Vrlr-dm~~H~~~~h~  565 (567)
T PLN03086        521 MDVRDRLRGMSEHESICGSRTAPCDSCGRSVMLK-EMDIHQIAVHQ  565 (567)
T ss_pred             cchhhhhhhHHHHHHhcCCcceEccccCCeeeeh-hHHHHHHHhhc
Confidence                  3478899988866899999999888765 57778766664


No 14 
>PHA00733 hypothetical protein
Probab=99.24  E-value=8.5e-12  Score=86.98  Aligned_cols=81  Identities=23%  Similarity=0.423  Sum_probs=55.0

Q ss_pred             CCccccCcccccccCcchHHH------HHhhcCCCcccCCcchhcCCCChHHHHHHHhhcCCCCcccccccccccCChHH
Q psy11589        149 EKKYVCETCGASFALWGSLNV------HSYSHTNTQFVCSYCGNTYKNPKALTSHIRNSHTIHQKSICDVCGKEFRMKRQ  222 (262)
Q Consensus       149 ~~~~~C~~C~~~f~~~~~l~~------H~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~C~~C~~~f~~~~~  222 (262)
                      .+++.|.+|...|.....|..      |+..+..+||.|+.|++.|.+...|..|++ .|  +.+|.|++|++.|.....
T Consensus        38 ~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r-~h--~~~~~C~~CgK~F~~~~s  114 (128)
T PHA00733         38 QKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIR-YT--EHSKVCPVCGKEFRNTDS  114 (128)
T ss_pred             hhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHh-cC--CcCccCCCCCCccCCHHH
Confidence            344555555555544444333      334444578888888888888888888887 44  356888888888888888


Q ss_pred             HHHHHHhhCC
Q psy11589        223 LKEHMAVHTT  232 (262)
Q Consensus       223 l~~H~~~h~~  232 (262)
                      |..|+...++
T Consensus       115 L~~H~~~~h~  124 (128)
T PHA00733        115 TLDHVCKKHN  124 (128)
T ss_pred             HHHHHHHhcC
Confidence            8888876554


No 15 
>PHA02768 hypothetical protein; Provisional
Probab=99.19  E-value=9.8e-12  Score=71.34  Aligned_cols=44  Identities=14%  Similarity=0.317  Sum_probs=37.6

Q ss_pred             cccccccccccCChHHHHHHHHhhCCCCCccCCCCCcccCChHHHH
Q psy11589        207 KSICDVCGKEFRMKRQLKEHMAVHTTDRPFVCNMCPSTFKLKKHLR  252 (262)
Q Consensus       207 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~  252 (262)
                      .|.|+.||+.|...+.|..|+++|+  +||+|..|++.|.+.+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceecccceeE
Confidence            4789999999999999999999988  6889999999988877663


No 16 
>KOG3993|consensus
Probab=99.04  E-value=2.4e-11  Score=97.39  Aligned_cols=163  Identities=19%  Similarity=0.336  Sum_probs=95.4

Q ss_pred             eeecCcchhhccChhHHHHHHHHhhcCCCcccCccccccccCchhHHhHHhhhCCCCccc---cCcccccccCcchHHHH
Q psy11589         94 EYCCHICKKVFLRNRNLVCHIKAVHENVREHQCSVCGKAFADITNMKVHMRIHTGEKKYV---CETCGASFALWGSLNVH  170 (262)
Q Consensus        94 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~---C~~C~~~f~~~~~l~~H  170 (262)
                      .|.|.+|...|.+.-.|.+| +---.-...|.|+.|+++|.-..+|..|.+.|.....-.   -+-=.+...+....+.-
T Consensus       267 dyiCqLCK~kYeD~F~LAQH-rC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea  345 (500)
T KOG3993|consen  267 DYICQLCKEKYEDAFALAQH-RCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEA  345 (500)
T ss_pred             HHHHHHHHHhhhhHHHHhhc-cCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhc
Confidence            48899999999999999988 432223345899999999999999999988874321000   00000000000000000


Q ss_pred             Hhh---cCCCcccCCcchhcCCCChHHHHHHHhhcCC-------------------------------------------
Q psy11589        171 SYS---HTNTQFVCSYCGNTYKNPKALTSHIRNSHTI-------------------------------------------  204 (262)
Q Consensus       171 ~~~---h~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~-------------------------------------------  204 (262)
                      .+.   .....|.|..|++.|.....|+.|+.+.|..                                           
T Consensus       346 ~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~~~k~~a~~f~~s~~~~l~~~~~~~a~h~~a~~~~g~~vl~~a  425 (500)
T KOG3993|consen  346 ERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAPLAKEKAPKFLLSRVIPLMHFNQAVATHSSASDSHGDEVLYVA  425 (500)
T ss_pred             cccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccccchhcccCcchhhcccccccccccccccccccccccceeeee
Confidence            000   0012455666666666666666664422211                                           


Q ss_pred             --CCcccccccccccCChHHHHHHHHhhCCCCCccCCCCCcccCChHHHHHHHHh
Q psy11589        205 --HQKSICDVCGKEFRMKRQLKEHMAVHTTDRPFVCNMCPSTFKLKKHLRQHYKV  257 (262)
Q Consensus       205 --~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~  257 (262)
                        .....|+.|+-.+.++..-..+.+.-..+..|.|.+|.-.|.+..+|.+|+..
T Consensus       426 ~sael~~pp~~~~ppsss~~sgg~~rlg~~~q~f~~ky~~atfyss~~ltrhin~  480 (500)
T KOG3993|consen  426 GSAELELPPYDGSPPSSSGSSGGYGRLGIAEQGFTCKYCPATFYSSPGLTRHINK  480 (500)
T ss_pred             ccccccCCCCCCCCcccCCCCCccccccchhhccccccchHhhhcCcchHhHhhh
Confidence              01134666666666665544554444445669999999999999999999853


No 17 
>KOG3993|consensus
Probab=99.04  E-value=2.7e-11  Score=97.11  Aligned_cols=162  Identities=20%  Similarity=0.255  Sum_probs=107.9

Q ss_pred             ceecCCCcccccchhHHHhhhhhcCCCCeeecCcchhhccChhHHHHHHHHhhcC-------------------------
Q psy11589         66 SYKCPDCSVIVVSYSGFKSHLDIHNVEKEYCCHICKKVFLRNRNLVCHIKAVHEN-------------------------  120 (262)
Q Consensus        66 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~-------------------------  120 (262)
                      .|.|..|...|.+...|..|.-.-.....|+|+.|++.|....+|..| +++|..                         
T Consensus       267 dyiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASH-RRWHKPR~eaa~a~~~P~k~~~~~rae~~ea  345 (500)
T KOG3993|consen  267 DYICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASH-RRWHKPRPEAAKAGSPPPKQAVETRAEVQEA  345 (500)
T ss_pred             HHHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhh-hcccCCchhhhhcCCCChhhhhhhhhhhhhc
Confidence            489999999999999999997654444679999999999999999999 888842                         


Q ss_pred             --------CCcccCccccccccCchhHHhHHhhhCCCCc-----------------cccCcccccccCcchHHHHHhhcC
Q psy11589        121 --------VREHQCSVCGKAFADITNMKVHMRIHTGEKK-----------------YVCETCGASFALWGSLNVHSYSHT  175 (262)
Q Consensus       121 --------~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~-----------------~~C~~C~~~f~~~~~l~~H~~~h~  175 (262)
                              +..|.|.+|++.|.....|+.|+.+|+....                 +.|..+.-.+.....-..+...+.
T Consensus       346 ~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~~~k~~a~~f~~s~~~~l~~~~~~~a~h~~a~~~~g~~vl~~a  425 (500)
T KOG3993|consen  346 ERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAPLAKEKAPKFLLSRVIPLMHFNQAVATHSSASDSHGDEVLYVA  425 (500)
T ss_pred             cccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccccchhcccCcchhhcccccccccccccccccccccccceeeee
Confidence                    1137777787777777777777766653211                 223333333332222112222222


Q ss_pred             C--CcccCCcchhcCCCChHHHHHHHhhcCCCCcccccccccccCChHHHHHHHHh
Q psy11589        176 N--TQFVCSYCGNTYKNPKALTSHIRNSHTIHQKSICDVCGKEFRMKRQLKEHMAV  229 (262)
Q Consensus       176 ~--~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~  229 (262)
                      +  ....|++|+-.+.++..--.+.+ .-..+.-|.|.+|.-.|.+...|.+|+..
T Consensus       426 ~sael~~pp~~~~ppsss~~sgg~~r-lg~~~q~f~~ky~~atfyss~~ltrhin~  480 (500)
T KOG3993|consen  426 GSAELELPPYDGSPPSSSGSSGGYGR-LGIAEQGFTCKYCPATFYSSPGLTRHINK  480 (500)
T ss_pred             ccccccCCCCCCCCcccCCCCCcccc-ccchhhccccccchHhhhcCcchHhHhhh
Confidence            1  12457777766666654433433 22334568899999999999999998764


No 18 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.98  E-value=3e-10  Score=55.86  Aligned_cols=26  Identities=35%  Similarity=0.862  Sum_probs=20.5

Q ss_pred             HHHHHHHhhCCCCCccCCCCCcccCC
Q psy11589        222 QLKEHMAVHTTDRPFVCNMCPSTFKL  247 (262)
Q Consensus       222 ~l~~H~~~h~~~~~~~C~~C~~~f~~  247 (262)
                      +|.+|+++|+|++||+|++|++.|.+
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeCc
Confidence            47788888888888888888888763


No 19 
>PHA02768 hypothetical protein; Provisional
Probab=98.91  E-value=5.2e-10  Score=64.28  Aligned_cols=42  Identities=21%  Similarity=0.512  Sum_probs=28.3

Q ss_pred             ccCCcchhcCCCChHHHHHHHhhcCCCCcccccccccccCChHHH
Q psy11589        179 FVCSYCGNTYKNPKALTSHIRNSHTIHQKSICDVCGKEFRMKRQL  223 (262)
Q Consensus       179 ~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~C~~C~~~f~~~~~l  223 (262)
                      |.|+.||+.|...+.|..|++ .|+  ++|+|..|++.|...+.|
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r-~H~--k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLR-KHN--TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHH-hcC--CcccCCcccceeccccee
Confidence            567777777777777777776 465  566777777777665554


No 20 
>PHA00616 hypothetical protein
Probab=98.79  E-value=2.4e-09  Score=58.48  Aligned_cols=34  Identities=24%  Similarity=0.413  Sum_probs=29.0

Q ss_pred             cccccccccccCChHHHHHHHHhhCCCCCccCCC
Q psy11589        207 KSICDVCGKEFRMKRQLKEHMAVHTTDRPFVCNM  240 (262)
Q Consensus       207 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~  240 (262)
                      ||+|+.||+.|..+++|..|++.|+|++|+.|++
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccceeE
Confidence            5888888888888888888888888888888764


No 21 
>PHA00732 hypothetical protein
Probab=98.69  E-value=1.3e-08  Score=64.34  Aligned_cols=48  Identities=38%  Similarity=0.687  Sum_probs=27.8

Q ss_pred             cccCCcchhcCCCChHHHHHHHhhcCCCCcccccccccccCChHHHHHHHHhhC
Q psy11589        178 QFVCSYCGNTYKNPKALTSHIRNSHTIHQKSICDVCGKEFRMKRQLKEHMAVHT  231 (262)
Q Consensus       178 ~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~h~  231 (262)
                      ||.|+.|++.|.+.+.|..|++..|.   ++.|+.||+.|.   .|..|+....
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~---~l~~H~~~~~   48 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYR---RLNQHFYSQY   48 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeC---ChhhhhcccC
Confidence            35666666666666666666652243   245666666665   3555655443


No 22 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.65  E-value=1.6e-08  Score=49.67  Aligned_cols=26  Identities=38%  Similarity=0.706  Sum_probs=23.0

Q ss_pred             HHHHHHHhhcCCCCcccccccccccCC
Q psy11589        193 ALTSHIRNSHTIHQKSICDVCGKEFRM  219 (262)
Q Consensus       193 ~l~~H~~~~H~~~~~~~C~~C~~~f~~  219 (262)
                      +|.+|++ .|++++||.|++|++.|.+
T Consensus         1 ~l~~H~~-~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMR-THTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHH-HHSSSSSEEESSSSEEESS
T ss_pred             CHHHHhh-hcCCCCCCCCCCCcCeeCc
Confidence            4889999 7999999999999999864


No 23 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.53  E-value=1.2e-07  Score=55.69  Aligned_cols=49  Identities=29%  Similarity=0.541  Sum_probs=23.0

Q ss_pred             ccccccccccCChHHHHHHHHh-hCCC-CCccCCCCCcccCChHHHHHHHHhhc
Q psy11589        208 SICDVCGKEFRMKRQLKEHMAV-HTTD-RPFVCNMCPSTFKLKKHLRQHYKVHL  259 (262)
Q Consensus       208 ~~C~~C~~~f~~~~~l~~H~~~-h~~~-~~~~C~~C~~~f~~~~~L~~H~~~H~  259 (262)
                      |.||.|++ -.+...|..|... |.++ +.+.||+|...+.  .+|..||..++
T Consensus         3 f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    3 FTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             cCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            45555555 2334455555432 3322 3455555554433  35555555443


No 24 
>PHA00616 hypothetical protein
Probab=98.49  E-value=6e-08  Score=53.02  Aligned_cols=28  Identities=25%  Similarity=0.421  Sum_probs=26.6

Q ss_pred             CccCCCCCcccCChHHHHHHHHhhccCC
Q psy11589        235 PFVCNMCPSTFKLKKHLRQHYKVHLKME  262 (262)
Q Consensus       235 ~~~C~~C~~~f~~~~~L~~H~~~H~~~~  262 (262)
                      ||+|+.||+.|.++++|..|++.|+|++
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~   28 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQN   28 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCC
Confidence            7999999999999999999999999974


No 25 
>PHA00732 hypothetical protein
Probab=98.48  E-value=9.1e-08  Score=60.52  Aligned_cols=45  Identities=29%  Similarity=0.546  Sum_probs=24.7

Q ss_pred             cccccccccccCChHHHHHHHHh-hCCCCCccCCCCCcccCChHHHHHHHHh
Q psy11589        207 KSICDVCGKEFRMKRQLKEHMAV-HTTDRPFVCNMCPSTFKLKKHLRQHYKV  257 (262)
Q Consensus       207 ~~~C~~C~~~f~~~~~l~~H~~~-h~~~~~~~C~~C~~~f~~~~~L~~H~~~  257 (262)
                      ||.|+.||+.|.+.+.|..|++. |.   ++.|+.||+.|.   .|..|+++
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~---~l~~H~~~   46 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYR---RLNQHFYS   46 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeC---Chhhhhcc
Confidence            35566666666666666666553 33   235666666665   35555543


No 26 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.39  E-value=6.7e-07  Score=52.56  Aligned_cols=52  Identities=23%  Similarity=0.628  Sum_probs=43.4

Q ss_pred             cccCCcchhcCCCChHHHHHHHhhcCCC-CcccccccccccCChHHHHHHHHhhCC
Q psy11589        178 QFVCSYCGNTYKNPKALTSHIRNSHTIH-QKSICDVCGKEFRMKRQLKEHMAVHTT  232 (262)
Q Consensus       178 ~~~C~~C~~~f~~~~~l~~H~~~~H~~~-~~~~C~~C~~~f~~~~~l~~H~~~h~~  232 (262)
                      .|.||+|++ ..+...|..|+...|..+ +.+.||+|...+.  .+|..|+.++++
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H~   54 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQHR   54 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhcC
Confidence            489999999 566789999999889875 5799999998755  489999987653


No 27 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.32  E-value=3.3e-07  Score=43.69  Aligned_cols=23  Identities=30%  Similarity=0.843  Sum_probs=14.4

Q ss_pred             ccCCCCCcccCChHHHHHHHHhh
Q psy11589        236 FVCNMCPSTFKLKKHLRQHYKVH  258 (262)
Q Consensus       236 ~~C~~C~~~f~~~~~L~~H~~~H  258 (262)
                      |.|+.|++.|.+...|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            45666666666666666666554


No 28 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=98.23  E-value=6.8e-07  Score=60.08  Aligned_cols=71  Identities=25%  Similarity=0.440  Sum_probs=13.3

Q ss_pred             cCcccccccCcchHHHHHhhcCCCcccCCcchhcCCCChHHHHHHHhhcCCCCcccccccccccCChHHHHHHHHh
Q psy11589        154 CETCGASFALWGSLNVHSYSHTNTQFVCSYCGNTYKNPKALTSHIRNSHTIHQKSICDVCGKEFRMKRQLKEHMAV  229 (262)
Q Consensus       154 C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~  229 (262)
                      |..|+..|.+...|..|+...++....   ....+.....+..+++  ......+.|..|++.|.+...|..||+.
T Consensus         2 C~~C~~~f~~~~~l~~H~~~~H~~~~~---~~~~l~~~~~~~~~~~--~~~~~~~~C~~C~~~f~s~~~l~~Hm~~   72 (100)
T PF12756_consen    2 CLFCDESFSSVDDLLQHMKKKHGFDIP---DQKYLVDPNRLLNYLR--KKVKESFRCPYCNKTFRSREALQEHMRS   72 (100)
T ss_dssp             ----------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHH
T ss_pred             ccccccccccccccccccccccccccc---cccccccccccccccc--cccCCCCCCCccCCCCcCHHHHHHHHcC
Confidence            555555555555555555544431111   1111223333333332  1111245566666666666666666554


No 29 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.16  E-value=1.3e-06  Score=41.58  Aligned_cols=23  Identities=48%  Similarity=0.895  Sum_probs=16.7

Q ss_pred             ccccccccccCChHHHHHHHHhh
Q psy11589        208 SICDVCGKEFRMKRQLKEHMAVH  230 (262)
Q Consensus       208 ~~C~~C~~~f~~~~~l~~H~~~h  230 (262)
                      |.|++|++.|.++..|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            56777777777777777777654


No 30 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.07  E-value=3e-06  Score=40.70  Aligned_cols=23  Identities=43%  Similarity=0.974  Sum_probs=13.6

Q ss_pred             ccCCCCCcccCChHHHHHHHHhh
Q psy11589        236 FVCNMCPSTFKLKKHLRQHYKVH  258 (262)
Q Consensus       236 ~~C~~C~~~f~~~~~L~~H~~~H  258 (262)
                      |.|++|++.|.+...|..|+++|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            45666666666666666666655


No 31 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.02  E-value=2.1e-06  Score=42.61  Aligned_cols=25  Identities=40%  Similarity=0.794  Sum_probs=15.8

Q ss_pred             CccCCCCCcccCChHHHHHHHHhhc
Q psy11589        235 PFVCNMCPSTFKLKKHLRQHYKVHL  259 (262)
Q Consensus       235 ~~~C~~C~~~f~~~~~L~~H~~~H~  259 (262)
                      ||+|+.|++.|.+...|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            4566666666666666666666554


No 32 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.90  E-value=7.5e-06  Score=54.96  Aligned_cols=71  Identities=21%  Similarity=0.336  Sum_probs=14.8

Q ss_pred             ecccCCCCCceeeehHHHHHHHhhhccCCc-cCccccccccccccccccccCCCccceecCCCcccccchhHHHhhhhh
Q psy11589         11 VCNLCPPGSKVVVKYVHYLERHVRKHHTMF-LRLPKVHSHFRKKNAIHVNNINKKVSYKCPDCSVIVVSYSGFKSHLDI   88 (262)
Q Consensus        11 ~C~~C~~~~~~~~~~~~~l~~H~~~~~~~~-~~~~~l~~~~~~~~~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~   88 (262)
                      +|..|+.    .|.+...|..||...|+.. .....+....+ . ...... .-...+.|..|++.|.+...|..||+.
T Consensus         1 ~C~~C~~----~f~~~~~l~~H~~~~H~~~~~~~~~l~~~~~-~-~~~~~~-~~~~~~~C~~C~~~f~s~~~l~~Hm~~   72 (100)
T PF12756_consen    1 QCLFCDE----SFSSVDDLLQHMKKKHGFDIPDQKYLVDPNR-L-LNYLRK-KVKESFRCPYCNKTFRSREALQEHMRS   72 (100)
T ss_dssp             -------------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHH
T ss_pred             Ccccccc----ccccccccccccccccccccccccccccccc-c-cccccc-ccCCCCCCCccCCCCcCHHHHHHHHcC
Confidence            5999999    9999999999998877521 11111100000 0 011110 011146666666666666666666664


No 33 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.88  E-value=1e-05  Score=38.77  Aligned_cols=23  Identities=48%  Similarity=1.011  Sum_probs=15.5

Q ss_pred             ccccccccccCChHHHHHHHHhh
Q psy11589        208 SICDVCGKEFRMKRQLKEHMAVH  230 (262)
Q Consensus       208 ~~C~~C~~~f~~~~~l~~H~~~h  230 (262)
                      |.|++|++.|.+...|..|+..|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            56777777777777777777765


No 34 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.80  E-value=1.3e-05  Score=39.72  Aligned_cols=26  Identities=38%  Similarity=0.675  Sum_probs=20.1

Q ss_pred             cccccccccccCChHHHHHHHHhhCC
Q psy11589        207 KSICDVCGKEFRMKRQLKEHMAVHTT  232 (262)
Q Consensus       207 ~~~C~~C~~~f~~~~~l~~H~~~h~~  232 (262)
                      ||.|..|++.|.+...|..|++.|.+
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhcC
Confidence            57788888888888888888877643


No 35 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.67  E-value=3.4e-05  Score=43.13  Aligned_cols=34  Identities=26%  Similarity=0.675  Sum_probs=17.1

Q ss_pred             cCCCCcccccccccccCChHHHHHHHHhhCCCCC
Q psy11589        202 HTIHQKSICDVCGKEFRMKRQLKEHMAVHTTDRP  235 (262)
Q Consensus       202 H~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~  235 (262)
                      ...+.|-.|++|+..+.+..+|.+|+.+.++.||
T Consensus        19 ~~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   19 SQSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             CTTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             hccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            3445566666666666666666666666555554


No 36 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.63  E-value=1.4e-05  Score=62.54  Aligned_cols=70  Identities=21%  Similarity=0.491  Sum_probs=44.6

Q ss_pred             CCcccCCc--chhcCCCChHHHHHHHhhcCCCCcccccccccccCChHHHHHHHHhhCCCCCccCCCCCcccCChHHHHH
Q psy11589        176 NTQFVCSY--CGNTYKNPKALTSHIRNSHTIHQKSICDVCGKEFRMKRQLKEHMAVHTTDRPFVCNMCPSTFKLKKHLRQ  253 (262)
Q Consensus       176 ~~~~~C~~--C~~~f~~~~~l~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~  253 (262)
                      ++||+|++  |.+.+.....|+.|+...|...+-..=+       ..   ..|.---...|||.|++|++.|.+...|+-
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p-------~p---~~~~~F~~~~KPYrCevC~KRYKNlNGLKY  416 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENP-------SP---EKMNIFSAKDKPYRCEVCDKRYKNLNGLKY  416 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCC-------Cc---cccccccccCCceeccccchhhccCcccee
Confidence            47899987  9999999999999987445322211111       00   001111234578888888888888888877


Q ss_pred             HH
Q psy11589        254 HY  255 (262)
Q Consensus       254 H~  255 (262)
                      |.
T Consensus       417 Hr  418 (423)
T COG5189         417 HR  418 (423)
T ss_pred             cc
Confidence            73


No 37 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.60  E-value=6.8e-05  Score=36.43  Aligned_cols=24  Identities=33%  Similarity=0.761  Sum_probs=14.7

Q ss_pred             ccCCCCCcccCChHHHHHHHHhhc
Q psy11589        236 FVCNMCPSTFKLKKHLRQHYKVHL  259 (262)
Q Consensus       236 ~~C~~C~~~f~~~~~L~~H~~~H~  259 (262)
                      |+|+.|++.|.+...|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            456666666666666666666553


No 38 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.59  E-value=5e-05  Score=36.37  Aligned_cols=24  Identities=29%  Similarity=0.632  Sum_probs=15.8

Q ss_pred             ccCCCCCcccCChHHHHHHHHhhcc
Q psy11589        236 FVCNMCPSTFKLKKHLRQHYKVHLK  260 (262)
Q Consensus       236 ~~C~~C~~~f~~~~~L~~H~~~H~~  260 (262)
                      |+|+.|++... ...|..|++.|++
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhCc
Confidence            56777777776 7777777777653


No 39 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.44  E-value=0.00014  Score=40.78  Aligned_cols=38  Identities=16%  Similarity=0.481  Sum_probs=24.6

Q ss_pred             HHHHh-hCCCCCccCCCCCcccCChHHHHHHHHhhccCC
Q psy11589        225 EHMAV-HTTDRPFVCNMCPSTFKLKKHLRQHYKVHLKME  262 (262)
Q Consensus       225 ~H~~~-h~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~  262 (262)
                      .+.+. ...+.|-.|++|+..+.+..+|++|++++++.+
T Consensus        13 ~~~k~~~~S~~PatCP~C~a~~~~srnLrRHle~~H~~k   51 (54)
T PF09237_consen   13 KKPKSKSQSEQPATCPICGAVIRQSRNLRRHLEIRHFKK   51 (54)
T ss_dssp             ---CCCCTTS--EE-TTT--EESSHHHHHHHHHHHTTTS
T ss_pred             hHHHHhhccCCCCCCCcchhhccchhhHHHHHHHHhccc
Confidence            34433 345789999999999999999999998877754


No 40 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.37  E-value=0.00019  Score=34.74  Aligned_cols=24  Identities=50%  Similarity=0.805  Sum_probs=16.4

Q ss_pred             ccccccccccCChHHHHHHHHhhC
Q psy11589        208 SICDVCGKEFRMKRQLKEHMAVHT  231 (262)
Q Consensus       208 ~~C~~C~~~f~~~~~l~~H~~~h~  231 (262)
                      |.|+.|++.|.+...|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            457777777777777777776553


No 41 
>PRK04860 hypothetical protein; Provisional
Probab=97.21  E-value=0.00015  Score=52.63  Aligned_cols=40  Identities=20%  Similarity=0.442  Sum_probs=30.8

Q ss_pred             CcccccccccccCChHHHHHHHHhhCCCCCccCCCCCcccCChH
Q psy11589        206 QKSICDVCGKEFRMKRQLKEHMAVHTTDRPFVCNMCPSTFKLKK  249 (262)
Q Consensus       206 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~  249 (262)
                      -+|.|. |+.   ....+.+|.++|+++++|.|..|+..|....
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~~  157 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFKG  157 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEec
Confidence            368887 886   5566778888888888888888888876543


No 42 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.17  E-value=0.00018  Score=56.60  Aligned_cols=69  Identities=20%  Similarity=0.321  Sum_probs=40.8

Q ss_pred             CCCceeccc--CCCCCceeeehHHHHHHHhhhccCC--ccCccccccccccccccccccCCCccceecCCCcccccchhH
Q psy11589          6 ENSDFVCNL--CPPGSKVVVKYVHYLERHVRKHHTM--FLRLPKVHSHFRKKNAIHVNNINKKVSYKCPDCSVIVVSYSG   81 (262)
Q Consensus         6 ~~~~~~C~~--C~~~~~~~~~~~~~l~~H~~~~~~~--~~~~~~l~~~~~~~~~~h~~~~~~~~~~~C~~C~~~f~~~~~   81 (262)
                      +++||+|++  |++    .+.+...|..|+.--|..  ....+.-        ..+.-.....+||.|++|++.+++...
T Consensus       346 d~KpykCpV~gC~K----~YknqnGLKYH~lhGH~~~~~~~~p~p--------~~~~~F~~~~KPYrCevC~KRYKNlNG  413 (423)
T COG5189         346 DGKPYKCPVEGCNK----KYKNQNGLKYHMLHGHQNQKLHENPSP--------EKMNIFSAKDKPYRCEVCDKRYKNLNG  413 (423)
T ss_pred             cCceecCCCCCchh----hhccccchhhhhhccccCcccCCCCCc--------cccccccccCCceeccccchhhccCcc
Confidence            359999997  999    999999999998743310  0000000        111111223456666666666666666


Q ss_pred             HHhhh
Q psy11589         82 FKSHL   86 (262)
Q Consensus        82 l~~H~   86 (262)
                      |.-|.
T Consensus       414 LKYHr  418 (423)
T COG5189         414 LKYHR  418 (423)
T ss_pred             ceecc
Confidence            66554


No 43 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.16  E-value=0.00019  Score=34.65  Aligned_cols=23  Identities=35%  Similarity=0.881  Sum_probs=14.1

Q ss_pred             ccCCCCCcccCChHHHHHHHHhh
Q psy11589        236 FVCNMCPSTFKLKKHLRQHYKVH  258 (262)
Q Consensus       236 ~~C~~C~~~f~~~~~L~~H~~~H  258 (262)
                      |.|++|++.|.+...|..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            45666666666666666666543


No 44 
>KOG1146|consensus
Probab=97.02  E-value=8.3e-05  Score=68.91  Aligned_cols=100  Identities=18%  Similarity=0.307  Sum_probs=55.0

Q ss_pred             cCcchhhccChhHHHHHHHHhhcCCCcccCccccccccCchhHHhHHhhhCCCCccccCcccccccCcchHHH-HHhhcC
Q psy11589         97 CHICKKVFLRNRNLVCHIKAVHENVREHQCSVCGKAFADITNMKVHMRIHTGEKKYVCETCGASFALWGSLNV-HSYSHT  175 (262)
Q Consensus        97 C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~-H~~~h~  175 (262)
                      |.-|+..+.....+..++...+...+.++|+.|+..++....|..|++.-+.+-.-  ..|.. +.....+.+ -.....
T Consensus       439 ~~~~e~~~~s~r~~~~~t~~L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~--~~c~~-gq~~~~~arg~~~~~~  515 (1406)
T KOG1146|consen  439 LTKAEPLLESKRSLEGQTVVLHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQS--AYCKA-GQNHPRLARGEVYRCP  515 (1406)
T ss_pred             ccchhhhhhhhcccccceeeeecccccccCCccchhhhhHHHhhhcccccccccch--hHhHh-ccccccccccccccCC
Confidence            44556666666666666666666667788888888888888888887763322110  11110 000000000 111122


Q ss_pred             CCcccCCcchhcCCCChHHHHHHH
Q psy11589        176 NTQFVCSYCGNTYKNPKALTSHIR  199 (262)
Q Consensus       176 ~~~~~C~~C~~~f~~~~~l~~H~~  199 (262)
                      +++|.|..|...+.....|.+|+.
T Consensus       516 ~~p~~C~~C~~stttng~Lsihlq  539 (1406)
T KOG1146|consen  516 GKPYPCRACNYSTTTNGNLSIHLQ  539 (1406)
T ss_pred             CCcccceeeeeeeecchHHHHHHH
Confidence            256666666666666666666654


No 45 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.01  E-value=0.00067  Score=32.34  Aligned_cols=24  Identities=29%  Similarity=0.721  Sum_probs=19.0

Q ss_pred             eecccCCCCCceeeehHHHHHHHhhhccC
Q psy11589         10 FVCNLCPPGSKVVVKYVHYLERHVRKHHT   38 (262)
Q Consensus        10 ~~C~~C~~~~~~~~~~~~~l~~H~~~~~~   38 (262)
                      |+|+.|++    ... ...|..|++.+|+
T Consensus         1 y~C~~C~y----~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSY----STS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-----EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCC----cCC-HHHHHHHHHhhCc
Confidence            78999999    777 8899999998763


No 46 
>KOG2231|consensus
Probab=96.99  E-value=0.0022  Score=56.52  Aligned_cols=100  Identities=24%  Similarity=0.508  Sum_probs=58.1

Q ss_pred             ecCcchhhccChhHHHHHHHHhhcCCCcccCccccc---------cccCchhHHhHHhhhCC-CC----ccccCcccccc
Q psy11589         96 CCHICKKVFLRNRNLVCHIKAVHENVREHQCSVCGK---------AFADITNMKVHMRIHTG-EK----KYVCETCGASF  161 (262)
Q Consensus        96 ~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~---------~f~~~~~l~~H~~~h~~-~~----~~~C~~C~~~f  161 (262)
                      .|..| ..|.+...|..|+...|..   +.|.+|-.         ...+...|..|++.--. +.    --.|..|...|
T Consensus       117 ~~~~c-~~~~s~~~Lk~H~~~~H~~---~~c~lC~~~~kif~~e~k~Yt~~el~~h~~~gd~d~~s~rGhp~C~~C~~~f  192 (669)
T KOG2231|consen  117 ECLHC-TEFKSVENLKNHMRDQHKL---HLCSLCLQNLKIFINERKLYTRAELNLHLMFGDPDDESCRGHPLCKFCHERF  192 (669)
T ss_pred             CCccc-cchhHHHHHHHHHHHhhhh---hccccccccceeeeeeeehehHHHHHHHHhcCCCccccccCCccchhhhhhh
Confidence            46666 5566778888887777743   44444422         22344566666654222 11    13477777777


Q ss_pred             cCcchHHHHHhhcCCCcccCCcc------hhcCCCChHHHHHHHhhc
Q psy11589        162 ALWGSLNVHSYSHTNTQFVCSYC------GNTYKNPKALTSHIRNSH  202 (262)
Q Consensus       162 ~~~~~l~~H~~~h~~~~~~C~~C------~~~f~~~~~l~~H~~~~H  202 (262)
                      .....|..|++..+.   .|..|      +..|..-..|..|.+..|
T Consensus       193 ld~~el~rH~~~~h~---~chfC~~~~~~neyy~~~~dLe~HfR~~H  236 (669)
T KOG2231|consen  193 LDDDELYRHLRFDHE---FCHFCDYKTGQNEYYNDYDDLEEHFRKGH  236 (669)
T ss_pred             ccHHHHHHhhcccee---heeecCcccccchhcccchHHHHHhhhcC
Confidence            777777777776553   33333      345666677777766433


No 47 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.96  E-value=0.00049  Score=33.15  Aligned_cols=23  Identities=30%  Similarity=0.788  Sum_probs=17.1

Q ss_pred             ccccccccccCChHHHHHHHHhh
Q psy11589        208 SICDVCGKEFRMKRQLKEHMAVH  230 (262)
Q Consensus       208 ~~C~~C~~~f~~~~~l~~H~~~h  230 (262)
                      |.|++|++.|.+...|..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            56778888888888888887643


No 48 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=96.72  E-value=0.0027  Score=50.77  Aligned_cols=118  Identities=22%  Similarity=0.459  Sum_probs=70.4

Q ss_pred             ceeccc--CCCCCceeeehHHHHHHHhhhccCC------------cc------CccccccccccccccccccCCCccce-
Q psy11589          9 DFVCNL--CPPGSKVVVKYVHYLERHVRKHHTM------------FL------RLPKVHSHFRKKNAIHVNNINKKVSY-   67 (262)
Q Consensus         9 ~~~C~~--C~~~~~~~~~~~~~l~~H~~~~~~~------------~~------~~~~l~~~~~~~~~~h~~~~~~~~~~-   67 (262)
                      .|.|+.  |..    +...+..|..|.+..|+.            |.      +...|        ..|...-..+..| 
T Consensus       151 ~F~CP~skc~~----~C~~~k~lk~H~K~~H~~~~C~~C~~nKk~F~~E~~lF~~~~L--------r~H~~~G~~e~GFK  218 (493)
T COG5236         151 SFKCPKSKCHR----RCGSLKELKKHYKAQHGFVLCSECIGNKKDFWNEIRLFRSSTL--------RDHKNGGLEEEGFK  218 (493)
T ss_pred             HhcCCchhhhh----hhhhHHHHHHHHHhhcCcEEhHhhhcCcccCccceeeeecccc--------cccccCCccccCcC
Confidence            367774  666    677788899999887761            21      22222        2233222222223 


Q ss_pred             ---ecCCCcccccchhHHHhhhhhcCCCCeeecCcchh-------hccChhHHHHHHHHhhcCCCcccCcc--cc----c
Q psy11589         68 ---KCPDCSVIVVSYSGFKSHLDIHNVEKEYCCHICKK-------VFLRNRNLVCHIKAVHENVREHQCSV--CG----K  131 (262)
Q Consensus        68 ---~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~-------~f~~~~~l~~H~~~~h~~~~~~~C~~--C~----~  131 (262)
                         .|.+|...|.+...|..|++..+.    .|-+|+.       -|.+..+|..|.+..|     |.|..  |.    .
T Consensus       219 GHP~C~FC~~~FYdDDEL~~HcR~~HE----~ChICD~v~p~~~QYFK~Y~~Le~HF~~~h-----y~ct~qtc~~~k~~  289 (493)
T COG5236         219 GHPLCIFCKIYFYDDDELRRHCRLRHE----ACHICDMVGPIRYQYFKSYEDLEAHFRNAH-----YCCTFQTCRVGKCY  289 (493)
T ss_pred             CCchhhhccceecChHHHHHHHHhhhh----hhhhhhccCccchhhhhCHHHHHHHhhcCc-----eEEEEEEEecCcEE
Confidence               478888888888888888776543    3555553       3566677777766544     55532  32    3


Q ss_pred             cccCchhHHhHHhhhC
Q psy11589        132 AFADITNMKVHMRIHT  147 (262)
Q Consensus       132 ~f~~~~~l~~H~~~h~  147 (262)
                      +|+....|..|+..-+
T Consensus       290 vf~~~~el~~h~~~~h  305 (493)
T COG5236         290 VFPYHTELLEHLTRFH  305 (493)
T ss_pred             EeccHHHHHHHHHHHh
Confidence            5777777777765433


No 49 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.64  E-value=0.00046  Score=34.01  Aligned_cols=22  Identities=36%  Similarity=0.810  Sum_probs=13.7

Q ss_pred             ccCCCCCcccCChHHHHHHHHh
Q psy11589        236 FVCNMCPSTFKLKKHLRQHYKV  257 (262)
Q Consensus       236 ~~C~~C~~~f~~~~~L~~H~~~  257 (262)
                      |.|..|++.|.+...|..|+++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            4566666666666666666544


No 50 
>KOG2231|consensus
Probab=96.51  E-value=0.0062  Score=53.74  Aligned_cols=47  Identities=26%  Similarity=0.644  Sum_probs=22.8

Q ss_pred             ecCcchhhccChhHHHHHHHHhhcCCCcccCcccc------ccccCchhHHhHHhhhC
Q psy11589         96 CCHICKKVFLRNRNLVCHIKAVHENVREHQCSVCG------KAFADITNMKVHMRIHT  147 (262)
Q Consensus        96 ~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~------~~f~~~~~l~~H~~~h~  147 (262)
                      .|..|...|.....|..|+...|     |.|..|+      .-|.....|..|.+..|
T Consensus       184 ~C~~C~~~fld~~el~rH~~~~h-----~~chfC~~~~~~neyy~~~~dLe~HfR~~H  236 (669)
T KOG2231|consen  184 LCKFCHERFLDDDELYRHLRFDH-----EFCHFCDYKTGQNEYYNDYDDLEEHFRKGH  236 (669)
T ss_pred             cchhhhhhhccHHHHHHhhccce-----eheeecCcccccchhcccchHHHHHhhhcC
Confidence            35555555555555555544333     3344332      23444455555555443


No 51 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.29  E-value=0.0027  Score=31.22  Aligned_cols=22  Identities=23%  Similarity=0.523  Sum_probs=18.7

Q ss_pred             eecCCCcccccchhHHHhhhhh
Q psy11589         67 YKCPDCSVIVVSYSGFKSHLDI   88 (262)
Q Consensus        67 ~~C~~C~~~f~~~~~l~~H~~~   88 (262)
                      |.|..|++.|.+...|..|++.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            6788999999999999888875


No 52 
>KOG1146|consensus
Probab=96.21  E-value=0.0019  Score=60.39  Aligned_cols=77  Identities=16%  Similarity=0.372  Sum_probs=61.9

Q ss_pred             CCcchhcCCCChHHHHHHHhhcCCCCcccccccccccCChHHHHHHHHhhC-------------------------CCCC
Q psy11589        181 CSYCGNTYKNPKALTSHIRNSHTIHQKSICDVCGKEFRMKRQLKEHMAVHT-------------------------TDRP  235 (262)
Q Consensus       181 C~~C~~~f~~~~~l~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~h~-------------------------~~~~  235 (262)
                      |..|+..+.....+..|+...+...+-|.|+.|+..|.....|..||+.-+                         +.+|
T Consensus       439 ~~~~e~~~~s~r~~~~~t~~L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p  518 (1406)
T KOG1146|consen  439 LTKAEPLLESKRSLEGQTVVLHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKP  518 (1406)
T ss_pred             ccchhhhhhhhcccccceeeeecccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCc
Confidence            344555566666666776667777788999999999999999999998722                         2268


Q ss_pred             ccCCCCCcccCChHHHHHHHHh
Q psy11589        236 FVCNMCPSTFKLKKHLRQHYKV  257 (262)
Q Consensus       236 ~~C~~C~~~f~~~~~L~~H~~~  257 (262)
                      |.|..|.++++.+.+|.+|+..
T Consensus       519 ~~C~~C~~stttng~LsihlqS  540 (1406)
T KOG1146|consen  519 YPCRACNYSTTTNGNLSIHLQS  540 (1406)
T ss_pred             ccceeeeeeeecchHHHHHHHH
Confidence            9999999999999999999864


No 53 
>KOG2482|consensus
Probab=96.21  E-value=0.0087  Score=47.88  Aligned_cols=52  Identities=29%  Similarity=0.528  Sum_probs=37.8

Q ss_pred             eeecCcchhhcc-ChhHHHHHHHHhhcC---------------------CCcccCccccccccCchhHHhHHhh
Q psy11589         94 EYCCHICKKVFL-RNRNLVCHIKAVHEN---------------------VREHQCSVCGKAFADITNMKVHMRI  145 (262)
Q Consensus        94 ~~~C~~C~~~f~-~~~~l~~H~~~~h~~---------------------~~~~~C~~C~~~f~~~~~l~~H~~~  145 (262)
                      ...|-.|...+. +++....|+-.+|.-                     -..+.|-.|.+.|..+..|+.||+.
T Consensus       144 slqClFCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLehLkekL~r~~CLyCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  144 SLQCLFCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEHLKEKLERLRCLYCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             eeEEEEecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHHHHHHHhhheeeeeccccCCcHHHHHHHHh
Confidence            467999987754 667777887666631                     1236888888888888888888864


No 54 
>KOG2785|consensus
Probab=96.16  E-value=0.014  Score=47.61  Aligned_cols=51  Identities=22%  Similarity=0.380  Sum_probs=41.9

Q ss_pred             cccccccccccCChHHHHHHHHhhCCC-----------------------CCccCCCCC---cccCChHHHHHHHHh
Q psy11589        207 KSICDVCGKEFRMKRQLKEHMAVHTTD-----------------------RPFVCNMCP---STFKLKKHLRQHYKV  257 (262)
Q Consensus       207 ~~~C~~C~~~f~~~~~l~~H~~~h~~~-----------------------~~~~C~~C~---~~f~~~~~L~~H~~~  257 (262)
                      |-.|-.|++.+.+...-..||..++|-                       .-|.|-.|+   +.|.+-...+.||+.
T Consensus       166 Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  166 PTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             CcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            567888999888888888898877763                       237888888   999999999999964


No 55 
>KOG2482|consensus
Probab=95.94  E-value=0.0044  Score=49.50  Aligned_cols=68  Identities=16%  Similarity=0.299  Sum_probs=41.9

Q ss_pred             CceecccCCCCCceeeehHHHHHHHhhhccCC-------ccCccccccccccccccccccCCCccceecCCCcccccchh
Q psy11589          8 SDFVCNLCPPGSKVVVKYVHYLERHVRKHHTM-------FLRLPKVHSHFRKKNAIHVNNINKKVSYKCPDCSVIVVSYS   80 (262)
Q Consensus         8 ~~~~C~~C~~~~~~~~~~~~~l~~H~~~~~~~-------~~~~~~l~~~~~~~~~~h~~~~~~~~~~~C~~C~~~f~~~~   80 (262)
                      ...+|-.|+..   .-.+++....|+-..|+-       ......+        ..|...  .-..+.|-.|.++|+++.
T Consensus       143 fslqClFCn~e---~lgnRs~~l~Hlf~~H~lniGlpDniVyvnel--------LehLke--kL~r~~CLyCekifrdkn  209 (423)
T KOG2482|consen  143 FSLQCLFCNNE---GLGNRSEILEHLFHVHGLNIGLPDNIVYVNEL--------LEHLKE--KLERLRCLYCEKIFRDKN  209 (423)
T ss_pred             eeeEEEEecch---hcccHHHHHHHHHHHhhhccCCCcceeeHHHH--------HHHHHH--HHhhheeeeeccccCCcH
Confidence            34679999872   336677788888655540       0111111        011110  012378999999999999


Q ss_pred             HHHhhhhh
Q psy11589         81 GFKSHLDI   88 (262)
Q Consensus        81 ~l~~H~~~   88 (262)
                      .|..||+.
T Consensus       210 tLkeHMrk  217 (423)
T KOG2482|consen  210 TLKEHMRK  217 (423)
T ss_pred             HHHHHHHh
Confidence            99999975


No 56 
>KOG2785|consensus
Probab=95.92  E-value=0.018  Score=47.02  Aligned_cols=52  Identities=21%  Similarity=0.420  Sum_probs=39.3

Q ss_pred             cccCCcchhcCCCChHHHHHHHhhcCCCC----------------------cccccccc---cccCChHHHHHHHHh
Q psy11589        178 QFVCSYCGNTYKNPKALTSHIRNSHTIHQ----------------------KSICDVCG---KEFRMKRQLKEHMAV  229 (262)
Q Consensus       178 ~~~C~~C~~~f~~~~~l~~H~~~~H~~~~----------------------~~~C~~C~---~~f~~~~~l~~H~~~  229 (262)
                      |-.|..|+..+.+...-..||...|.---                      .+.|-.|.   +.|.+....+.||..
T Consensus       166 Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  166 PTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             CcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            46788888888888888888875554222                      37788888   888888888889864


No 57 
>PRK04860 hypothetical protein; Provisional
Probab=95.90  E-value=0.0043  Score=45.11  Aligned_cols=36  Identities=22%  Similarity=0.586  Sum_probs=17.8

Q ss_pred             eeecCcchhhccChhHHHHHHHHhhcCCCcccCcccccccc
Q psy11589         94 EYCCHICKKVFLRNRNLVCHIKAVHENVREHQCSVCGKAFA  134 (262)
Q Consensus        94 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~  134 (262)
                      +|.|. |+.   ....+..| .++|.++++|.|..|+..|.
T Consensus       119 ~Y~C~-C~~---~~~~~rrH-~ri~~g~~~YrC~~C~~~l~  154 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRH-NRVVRGEAVYRCRRCGETLV  154 (160)
T ss_pred             EEEcC-CCC---eeCHHHHH-HHHhcCCccEECCCCCceeE
Confidence            35554 544   34444555 34455555555555555443


No 58 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=95.85  E-value=0.0087  Score=28.75  Aligned_cols=19  Identities=32%  Similarity=0.667  Sum_probs=11.3

Q ss_pred             cCCCCCcccCChHHHHHHHH
Q psy11589        237 VCNMCPSTFKLKKHLRQHYK  256 (262)
Q Consensus       237 ~C~~C~~~f~~~~~L~~H~~  256 (262)
                      .|+.||+.| ..+.|..|++
T Consensus         4 ~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    4 PCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             cCCCCCCEE-CHHHHHHHHH
Confidence            566666666 5555666654


No 59 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=95.62  E-value=0.022  Score=45.74  Aligned_cols=128  Identities=25%  Similarity=0.384  Sum_probs=81.6

Q ss_pred             eecCc--chhhccChhHHHHHHHHhhcCCCcccCcccc---cccc------CchhHHhHHhhhCCCCc----cccCcccc
Q psy11589         95 YCCHI--CKKVFLRNRNLVCHIKAVHENVREHQCSVCG---KAFA------DITNMKVHMRIHTGEKK----YVCETCGA  159 (262)
Q Consensus        95 ~~C~~--C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~---~~f~------~~~~l~~H~~~h~~~~~----~~C~~C~~  159 (262)
                      |.|+.  |.........|..|.+..|..   +.|.+|-   +.|.      +...|+.|...-..+..    -.|..|..
T Consensus       152 F~CP~skc~~~C~~~k~lk~H~K~~H~~---~~C~~C~~nKk~F~~E~~lF~~~~Lr~H~~~G~~e~GFKGHP~C~FC~~  228 (493)
T COG5236         152 FKCPKSKCHRRCGSLKELKKHYKAQHGF---VLCSECIGNKKDFWNEIRLFRSSTLRDHKNGGLEEEGFKGHPLCIFCKI  228 (493)
T ss_pred             hcCCchhhhhhhhhHHHHHHHHHhhcCc---EEhHhhhcCcccCccceeeeecccccccccCCccccCcCCCchhhhccc
Confidence            67775  777777778888887766643   5566652   2332      34566777654333322    34888888


Q ss_pred             cccCcchHHHHHhhcCCCcccCCcc----hhcCCCChHHHHHHHhhcCCCCcccccc--cc----cccCChHHHHHHHHh
Q psy11589        160 SFALWGSLNVHSYSHTNTQFVCSYC----GNTYKNPKALTSHIRNSHTIHQKSICDV--CG----KEFRMKRQLKEHMAV  229 (262)
Q Consensus       160 ~f~~~~~l~~H~~~h~~~~~~C~~C----~~~f~~~~~l~~H~~~~H~~~~~~~C~~--C~----~~f~~~~~l~~H~~~  229 (262)
                      .|-...+|..|++..+++-+.|+.-    .+.|.+...|..|.+..|     |.|.+  |.    ..|.....|..|+..
T Consensus       229 ~FYdDDEL~~HcR~~HE~ChICD~v~p~~~QYFK~Y~~Le~HF~~~h-----y~ct~qtc~~~k~~vf~~~~el~~h~~~  303 (493)
T COG5236         229 YFYDDDELRRHCRLRHEACHICDMVGPIRYQYFKSYEDLEAHFRNAH-----YCCTFQTCRVGKCYVFPYHTELLEHLTR  303 (493)
T ss_pred             eecChHHHHHHHHhhhhhhhhhhccCccchhhhhCHHHHHHHhhcCc-----eEEEEEEEecCcEEEeccHHHHHHHHHH
Confidence            8888888888888877654444332    234777788888877433     44443  22    357888888888754


Q ss_pred             h
Q psy11589        230 H  230 (262)
Q Consensus       230 h  230 (262)
                      -
T Consensus       304 ~  304 (493)
T COG5236         304 F  304 (493)
T ss_pred             H
Confidence            3


No 60 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=95.38  E-value=0.015  Score=27.93  Aligned_cols=19  Identities=32%  Similarity=0.854  Sum_probs=11.3

Q ss_pred             cccccccccCChHHHHHHHH
Q psy11589        209 ICDVCGKEFRMKRQLKEHMA  228 (262)
Q Consensus       209 ~C~~C~~~f~~~~~l~~H~~  228 (262)
                      .|+.||+.| ..+.|..|+.
T Consensus         4 ~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    4 PCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             cCCCCCCEE-CHHHHHHHHH
Confidence            566666666 4455666654


No 61 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=95.15  E-value=0.015  Score=30.36  Aligned_cols=22  Identities=32%  Similarity=0.677  Sum_probs=16.5

Q ss_pred             CccCCCCCcccCChHHHHHHHH
Q psy11589        235 PFVCNMCPSTFKLKKHLRQHYK  256 (262)
Q Consensus       235 ~~~C~~C~~~f~~~~~L~~H~~  256 (262)
                      +|.|++|+..|.+...+..|++
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHC
Confidence            5677888888877777777764


No 62 
>KOG4173|consensus
Probab=95.08  E-value=0.013  Score=43.49  Aligned_cols=75  Identities=25%  Similarity=0.542  Sum_probs=48.6

Q ss_pred             cccCc--ccccccCcchHHHHHhhcCCCcccCCcchhcCCCChHHHHHHHhhc---------CCCCcccccc--cccccC
Q psy11589        152 YVCET--CGASFALWGSLNVHSYSHTNTQFVCSYCGNTYKNPKALTSHIRNSH---------TIHQKSICDV--CGKEFR  218 (262)
Q Consensus       152 ~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~~H---------~~~~~~~C~~--C~~~f~  218 (262)
                      +.|++  |...|.+...+..|..+-++  -.|.+|.+.|.+...|..|+...|         .|..-|+|-+  |+..|.
T Consensus        80 ~~cqvagc~~~~d~lD~~E~hY~~~h~--~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KFk  157 (253)
T KOG4173|consen   80 FACQVAGCCQVFDALDDYEHHYHTLHG--NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKFK  157 (253)
T ss_pred             ccccccchHHHHhhhhhHHHhhhhccc--chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhhh
Confidence            56655  66667666666666655443  257777777777777777776444         2445567743  777777


Q ss_pred             ChHHHHHHHH
Q psy11589        219 MKRQLKEHMA  228 (262)
Q Consensus       219 ~~~~l~~H~~  228 (262)
                      +...-..|+-
T Consensus       158 T~r~RkdH~I  167 (253)
T KOG4173|consen  158 TSRDRKDHMI  167 (253)
T ss_pred             hhhhhhhHHH
Confidence            7777777764


No 63 
>KOG2893|consensus
Probab=95.04  E-value=0.0066  Score=46.05  Aligned_cols=41  Identities=27%  Similarity=0.621  Sum_probs=23.5

Q ss_pred             CCcchhcCCCChHHHHHHHhhcCCCCcccccccccccCChHHHHHH
Q psy11589        181 CSYCGNTYKNPKALTSHIRNSHTIHQKSICDVCGKEFRMKRQLKEH  226 (262)
Q Consensus       181 C~~C~~~f~~~~~l~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H  226 (262)
                      |-+|++.|.+...|+.|++.     +-|+|.+|-+..-+--.|..|
T Consensus        13 cwycnrefddekiliqhqka-----khfkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQKA-----KHFKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             eeecccccchhhhhhhhhhh-----ccceeeeehhhhccCCCceee
Confidence            56666666666666666553     336666666655554455544


No 64 
>KOG2893|consensus
Probab=94.68  E-value=0.01  Score=45.05  Aligned_cols=48  Identities=25%  Similarity=0.422  Sum_probs=38.6

Q ss_pred             ecCCCcccccchhHHHhhhhhcCCCCeeecCcchhhccChhHHHHHHHHhhc
Q psy11589         68 KCPDCSVIVVSYSGFKSHLDIHNVEKEYCCHICKKVFLRNRNLVCHIKAVHE  119 (262)
Q Consensus        68 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~  119 (262)
                      .|.+|++.|.+..-|..|++..    -|+|-+|-+...+--.|..|-..+|.
T Consensus        12 wcwycnrefddekiliqhqkak----hfkchichkkl~sgpglsihcmqvhk   59 (341)
T KOG2893|consen   12 WCWYCNREFDDEKILIQHQKAK----HFKCHICHKKLFSGPGLSIHCMQVHK   59 (341)
T ss_pred             eeeecccccchhhhhhhhhhhc----cceeeeehhhhccCCCceeehhhhhh
Confidence            5888999999888888888753    38888888888888888888766664


No 65 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=94.40  E-value=0.11  Score=35.08  Aligned_cols=48  Identities=19%  Similarity=0.439  Sum_probs=25.8

Q ss_pred             CCcchhcCCCChHHHHHHHhhcCCCCcccccccccccCChHHHHHHHHhhC
Q psy11589        181 CSYCGNTYKNPKALTSHIRNSHTIHQKSICDVCGKEFRMKRQLKEHMAVHT  231 (262)
Q Consensus       181 C~~C~~~f~~~~~l~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~h~  231 (262)
                      |--|...|.......   ...-.....|+|+.|...|--.-++-.|..+|+
T Consensus        58 C~~C~~~f~~~~~~~---~~~~~~~~~y~C~~C~~~FC~dCD~fiHe~Lh~  105 (112)
T TIGR00622        58 CFGCQGPFPKPPVSP---FDELKDSHRYVCAVCKNVFCVDCDVFVHESLHC  105 (112)
T ss_pred             ccCcCCCCCCccccc---ccccccccceeCCCCCCccccccchhhhhhccC
Confidence            666666666542111   000112345777777777776666666665553


No 66 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=94.20  E-value=0.027  Score=29.10  Aligned_cols=10  Identities=40%  Similarity=1.238  Sum_probs=5.2

Q ss_pred             CCccCCCCCc
Q psy11589        234 RPFVCNMCPS  243 (262)
Q Consensus       234 ~~~~C~~C~~  243 (262)
                      .+..|+.||.
T Consensus        16 ~~~~CP~Cg~   25 (33)
T cd00350          16 APWVCPVCGA   25 (33)
T ss_pred             CCCcCcCCCC
Confidence            4455555553


No 67 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=94.01  E-value=0.013  Score=50.17  Aligned_cols=148  Identities=22%  Similarity=0.377  Sum_probs=81.1

Q ss_pred             eeecCcchhhccChhHHHHHHHH-hhcCC--CcccCc--cccccccCchhHHhHHhhhCCCCccccCc--ccccccCcch
Q psy11589         94 EYCCHICKKVFLRNRNLVCHIKA-VHENV--REHQCS--VCGKAFADITNMKVHMRIHTGEKKYVCET--CGASFALWGS  166 (262)
Q Consensus        94 ~~~C~~C~~~f~~~~~l~~H~~~-~h~~~--~~~~C~--~C~~~f~~~~~l~~H~~~h~~~~~~~C~~--C~~~f~~~~~  166 (262)
                      ++.|..|...|.....|..|... .|.++  +++.|+  .|++.|.....+..|...|.+..++.+..  +...+.....
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  368 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKLLNSSSKFSPLLN  368 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCccccccccCccccccccC
Confidence            35566666666666666666332 56666  666666  56666666666666666666555544433  2222221111


Q ss_pred             ------HHHHHhhcCCCcccCCc--chhcCCCChHHHHHHHhhcCCCC--cccccccccccCChHHHHHHHHhhCCCCCc
Q psy11589        167 ------LNVHSYSHTNTQFVCSY--CGNTYKNPKALTSHIRNSHTIHQ--KSICDVCGKEFRMKRQLKEHMAVHTTDRPF  236 (262)
Q Consensus       167 ------l~~H~~~h~~~~~~C~~--C~~~f~~~~~l~~H~~~~H~~~~--~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~  236 (262)
                            +...........+.+..  |...+.....+..|.. .|...+  .+.+..|.+.+.....+..|++.+....++
T Consensus       369 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  447 (467)
T COG5048         369 NEPPQSLQQYKDLKNDKKSETLSNSCIRNFKRDSNLSLHII-THLSFRPYNCKNPPCSKSFNRHYNLIPHKKIHTNHAPL  447 (467)
T ss_pred             CCCccchhhccCccCCccccccccchhhhhccccccccccc-cccccCCcCCCCCcchhhccCcccccccccccccCCce
Confidence                  11111111112333322  5555555555555554 444433  466677888888888888888887777666


Q ss_pred             cCCCCC
Q psy11589        237 VCNMCP  242 (262)
Q Consensus       237 ~C~~C~  242 (262)
                      .|..++
T Consensus       448 ~~~~~~  453 (467)
T COG5048         448 LCSILK  453 (467)
T ss_pred             eecccc
Confidence            655543


No 68 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=93.85  E-value=0.1  Score=35.26  Aligned_cols=49  Identities=18%  Similarity=0.371  Sum_probs=34.6

Q ss_pred             cccccccccCChHHHHHHHHhhCCCCCccCCCCCcccCChHHHHHHHHhhc
Q psy11589        209 ICDVCGKEFRMKRQLKEHMAVHTTDRPFVCNMCPSTFKLKKHLRQHYKVHL  259 (262)
Q Consensus       209 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~H~  259 (262)
                      .|--|...|.......  ...-.....|+|+.|...|=..-++-.|...|.
T Consensus        57 ~C~~C~~~f~~~~~~~--~~~~~~~~~y~C~~C~~~FC~dCD~fiHe~Lh~  105 (112)
T TIGR00622        57 FCFGCQGPFPKPPVSP--FDELKDSHRYVCAVCKNVFCVDCDVFVHESLHC  105 (112)
T ss_pred             cccCcCCCCCCccccc--ccccccccceeCCCCCCccccccchhhhhhccC
Confidence            4999999998653111  000123456999999999998888888887774


No 69 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=93.57  E-value=0.03  Score=47.92  Aligned_cols=149  Identities=22%  Similarity=0.393  Sum_probs=105.7

Q ss_pred             cceecCCCcccccchhHHHhhhh--hcCCC--CeeecC--cchhhccChhHHHHHHHHhhcCCCcccCcc--ccccccCc
Q psy11589         65 VSYKCPDCSVIVVSYSGFKSHLD--IHNVE--KEYCCH--ICKKVFLRNRNLVCHIKAVHENVREHQCSV--CGKAFADI  136 (262)
Q Consensus        65 ~~~~C~~C~~~f~~~~~l~~H~~--~h~~~--~~~~C~--~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~--C~~~f~~~  136 (262)
                      .++.|..|...|.....|..|.+  .|.++  .++.|+  .|++.|.....+..| ...|.+..++.+..  +...+...
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~  366 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRH-ILLHTSISPAKEKLLNSSSKFSPL  366 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCC-cccccCCCccccccccCccccccc
Confidence            46899999999999999999999  89999  899999  799999999999999 56787777766654  33333222


Q ss_pred             hhHHhH-----HhhhCCCCcccc--CcccccccCcchHHHHHhhcCC---CcccCCcchhcCCCChHHHHHHHhhcCCCC
Q psy11589        137 TNMKVH-----MRIHTGEKKYVC--ETCGASFALWGSLNVHSYSHTN---TQFVCSYCGNTYKNPKALTSHIRNSHTIHQ  206 (262)
Q Consensus       137 ~~l~~H-----~~~h~~~~~~~C--~~C~~~f~~~~~l~~H~~~h~~---~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~  206 (262)
                      ..-..+     ...-.......+  ..|...+.....+..|...+..   ..+.+..|...+.....+..|++ .|....
T Consensus       367 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~  445 (467)
T COG5048         367 LNNEPPQSLQQYKDLKNDKKSETLSNSCIRNFKRDSNLSLHIITHLSFRPYNCKNPPCSKSFNRHYNLIPHKK-IHTNHA  445 (467)
T ss_pred             cCCCCccchhhccCccCCccccccccchhhhhccccccccccccccccCCcCCCCCcchhhccCccccccccc-ccccCC
Confidence            221101     111112223333  2355666666677777766654   36778889999999999999988 777777


Q ss_pred             ccccccccc
Q psy11589        207 KSICDVCGK  215 (262)
Q Consensus       207 ~~~C~~C~~  215 (262)
                      ++.|..++.
T Consensus       446 ~~~~~~~~~  454 (467)
T COG5048         446 PLLCSILKS  454 (467)
T ss_pred             ceeeccccc
Confidence            776655443


No 70 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=93.42  E-value=0.29  Score=33.22  Aligned_cols=26  Identities=31%  Similarity=0.598  Sum_probs=19.2

Q ss_pred             CceecccCCCCCceeeehHHHHHHHhhhccC
Q psy11589          8 SDFVCNLCPPGSKVVVKYVHYLERHVRKHHT   38 (262)
Q Consensus         8 ~~~~C~~C~~~~~~~~~~~~~l~~H~~~~~~   38 (262)
                      +-..|..|+.    .... +.+..|++..|.
T Consensus        10 ~vlIC~~C~~----av~~-~~v~~HL~~~H~   35 (109)
T PF12013_consen   10 RVLICRQCQY----AVQP-SEVESHLRKRHH   35 (109)
T ss_pred             CEEEeCCCCc----ccCc-hHHHHHHHHhcc
Confidence            5678999987    4433 889999986543


No 71 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=93.17  E-value=0.078  Score=27.57  Aligned_cols=24  Identities=25%  Similarity=0.516  Sum_probs=21.3

Q ss_pred             CceecccCCCCCceeeehHHHHHHHhhh
Q psy11589          8 SDFVCNLCPPGSKVVVKYVHYLERHVRK   35 (262)
Q Consensus         8 ~~~~C~~C~~~~~~~~~~~~~l~~H~~~   35 (262)
                      .+|.|.+|+.    .|.+...+..|+..
T Consensus         2 ~~~~C~~C~~----~~~~~~~~~~H~~g   25 (35)
T smart00451        2 GGFYCKLCNV----TFTDEISVEAHLKG   25 (35)
T ss_pred             cCeEccccCC----ccCCHHHHHHHHCh
Confidence            4689999999    99999999999864


No 72 
>KOG4173|consensus
Probab=93.09  E-value=0.054  Score=40.27  Aligned_cols=84  Identities=19%  Similarity=0.449  Sum_probs=67.3

Q ss_pred             CcccCcc--ccccccCchhHHhHHhhhCCCCccccCcccccccCcchHHHHHhhcCC-----------CcccCCc--chh
Q psy11589        122 REHQCSV--CGKAFADITNMKVHMRIHTGEKKYVCETCGASFALWGSLNVHSYSHTN-----------TQFVCSY--CGN  186 (262)
Q Consensus       122 ~~~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~-----------~~~~C~~--C~~  186 (262)
                      ..+.|++  |...|.+...+..|..+-++   -.|..|.+.|.+...|..|+..-++           ..|.|.+  |+.
T Consensus        78 ~~~~cqvagc~~~~d~lD~~E~hY~~~h~---~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~  154 (253)
T KOG4173|consen   78 PAFACQVAGCCQVFDALDDYEHHYHTLHG---NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTE  154 (253)
T ss_pred             ccccccccchHHHHhhhhhHHHhhhhccc---chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhh
Confidence            4578877  88899988888888876665   3699999999999999999865433           2478854  999


Q ss_pred             cCCCChHHHHHHHhhcCCCCcc
Q psy11589        187 TYKNPKALTSHIRNSHTIHQKS  208 (262)
Q Consensus       187 ~f~~~~~l~~H~~~~H~~~~~~  208 (262)
                      .|.+...-..|+-..|.-...|
T Consensus       155 KFkT~r~RkdH~I~~Hk~Pa~f  176 (253)
T KOG4173|consen  155 KFKTSRDRKDHMIRMHKYPADF  176 (253)
T ss_pred             hhhhhhhhhhHHHHhccCCcce
Confidence            9999999999999888754444


No 73 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=93.07  E-value=0.15  Score=34.69  Aligned_cols=25  Identities=24%  Similarity=0.558  Sum_probs=20.1

Q ss_pred             ccC----CCCCcccCChHHHHHHHHhhcc
Q psy11589        236 FVC----NMCPSTFKLKKHLRQHYKVHLK  260 (262)
Q Consensus       236 ~~C----~~C~~~f~~~~~L~~H~~~H~~  260 (262)
                      |.|    +.|++.+.+...+.+|.+.++|
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            788    8888888888888888877765


No 74 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=91.23  E-value=0.17  Score=29.00  Aligned_cols=27  Identities=15%  Similarity=0.528  Sum_probs=13.3

Q ss_pred             CCccceecCCCcccccchhHHHhhhhh
Q psy11589         62 NKKVSYKCPDCSVIVVSYSGFKSHLDI   88 (262)
Q Consensus        62 ~~~~~~~C~~C~~~f~~~~~l~~H~~~   88 (262)
                      .++.-+.|+-|+..|....+..+|...
T Consensus        13 DGE~~lrCPRC~~~FR~~K~Y~RHVNK   39 (65)
T COG4049          13 DGEEFLRCPRCGMVFRRRKDYIRHVNK   39 (65)
T ss_pred             CCceeeeCCchhHHHHHhHHHHHHhhH
Confidence            344445555555555555555555443


No 75 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=90.29  E-value=0.15  Score=26.44  Aligned_cols=10  Identities=40%  Similarity=0.906  Sum_probs=5.1

Q ss_pred             cccccccccc
Q psy11589        208 SICDVCGKEF  217 (262)
Q Consensus       208 ~~C~~C~~~f  217 (262)
                      |.|.+||..+
T Consensus         3 ~~C~~CG~i~   12 (34)
T cd00729           3 WVCPVCGYIH   12 (34)
T ss_pred             EECCCCCCEe
Confidence            4555555443


No 76 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=89.49  E-value=0.2  Score=28.75  Aligned_cols=32  Identities=25%  Similarity=0.472  Sum_probs=27.2

Q ss_pred             hcCCCCeeecCcchhhccChhHHHHHHHHhhc
Q psy11589         88 IHNVEKEYCCHICKKVFLRNRNLVCHIKAVHE  119 (262)
Q Consensus        88 ~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~  119 (262)
                      .-.++..+.|+-|+..|....+...|+...|.
T Consensus        11 ~RDGE~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          11 DRDGEEFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             ccCCceeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            34567779999999999999999999877774


No 77 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=89.09  E-value=0.2  Score=36.57  Aligned_cols=23  Identities=39%  Similarity=1.040  Sum_probs=16.3

Q ss_pred             cccCCcchhcCCCChHHHHHHHhhcCCCCcccccccc
Q psy11589        178 QFVCSYCGNTYKNPKALTSHIRNSHTIHQKSICDVCG  214 (262)
Q Consensus       178 ~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~C~~C~  214 (262)
                      .|.|++||..              +.++.|-+||+||
T Consensus       134 ~~vC~vCGy~--------------~~ge~P~~CPiCg  156 (166)
T COG1592         134 VWVCPVCGYT--------------HEGEAPEVCPICG  156 (166)
T ss_pred             EEEcCCCCCc--------------ccCCCCCcCCCCC
Confidence            5778888763              4456777788887


No 78 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=88.39  E-value=0.35  Score=23.39  Aligned_cols=10  Identities=30%  Similarity=0.853  Sum_probs=6.5

Q ss_pred             cCCCCCcccC
Q psy11589        237 VCNMCPSTFK  246 (262)
Q Consensus       237 ~C~~C~~~f~  246 (262)
                      .|+.||+.|.
T Consensus        16 ~Cp~CG~~F~   25 (26)
T PF10571_consen   16 FCPHCGYDFE   25 (26)
T ss_pred             cCCCCCCCCc
Confidence            5677776664


No 79 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=87.86  E-value=0.092  Score=40.42  Aligned_cols=13  Identities=23%  Similarity=0.470  Sum_probs=8.2

Q ss_pred             ccccccccccCCh
Q psy11589        208 SICDVCGKEFRMK  220 (262)
Q Consensus       208 ~~C~~C~~~f~~~  220 (262)
                      ..||.||.+|...
T Consensus        49 ~vCP~CgyA~~~~   61 (214)
T PF09986_consen   49 WVCPHCGYAAFEE   61 (214)
T ss_pred             EECCCCCCccccc
Confidence            4577777766543


No 80 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=87.21  E-value=0.14  Score=39.37  Aligned_cols=14  Identities=29%  Similarity=0.653  Sum_probs=11.2

Q ss_pred             cccCCcchhcCCCC
Q psy11589        178 QFVCSYCGNTYKNP  191 (262)
Q Consensus       178 ~~~C~~C~~~f~~~  191 (262)
                      .+.||.||++|...
T Consensus        48 V~vCP~CgyA~~~~   61 (214)
T PF09986_consen   48 VWVCPHCGYAAFEE   61 (214)
T ss_pred             EEECCCCCCccccc
Confidence            36899999987765


No 81 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=87.17  E-value=0.36  Score=26.73  Aligned_cols=26  Identities=31%  Similarity=0.703  Sum_probs=14.4

Q ss_pred             ccccccccccCChHHHHHHHHhhCCCCCccCCCCCcc
Q psy11589        208 SICDVCGKEFRMKRQLKEHMAVHTTDRPFVCNMCPST  244 (262)
Q Consensus       208 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~  244 (262)
                      |.|..||..|...           ...+.+|+.||..
T Consensus         3 Y~C~~Cg~~~~~~-----------~~~~irC~~CG~r   28 (44)
T smart00659        3 YICGECGRENEIK-----------SKDVVRCRECGYR   28 (44)
T ss_pred             EECCCCCCEeecC-----------CCCceECCCCCce
Confidence            5666666665532           2244566666654


No 82 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=85.78  E-value=0.42  Score=25.37  Aligned_cols=9  Identities=22%  Similarity=0.678  Sum_probs=3.6

Q ss_pred             ccCCCCCcc
Q psy11589        236 FVCNMCPST  244 (262)
Q Consensus       236 ~~C~~C~~~  244 (262)
                      ..|+.|+..
T Consensus        26 v~C~~C~~~   34 (38)
T TIGR02098        26 VRCGKCGHV   34 (38)
T ss_pred             EECCCCCCE
Confidence            334444433


No 83 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=85.75  E-value=0.31  Score=37.79  Aligned_cols=26  Identities=23%  Similarity=0.453  Sum_probs=17.7

Q ss_pred             CCCccCCCCCcccCChHHHHHHHHhh
Q psy11589        233 DRPFVCNMCPSTFKLKKHLRQHYKVH  258 (262)
Q Consensus       233 ~~~~~C~~C~~~f~~~~~L~~H~~~H  258 (262)
                      .+++.||.||+....-.+|.+-.|+|
T Consensus       207 ~k~~PCPKCg~et~eTkdLSmStR~h  232 (314)
T PF06524_consen  207 GKPIPCPKCGYETQETKDLSMSTRSH  232 (314)
T ss_pred             CCCCCCCCCCCcccccccceeeeecc
Confidence            36778888887777666666555554


No 84 
>PHA00626 hypothetical protein
Probab=85.18  E-value=0.2  Score=28.83  Aligned_cols=12  Identities=25%  Similarity=0.537  Sum_probs=5.4

Q ss_pred             cccccccccccC
Q psy11589        207 KSICDVCGKEFR  218 (262)
Q Consensus       207 ~~~C~~C~~~f~  218 (262)
                      .|.|+.||+.|+
T Consensus        23 rYkCkdCGY~ft   34 (59)
T PHA00626         23 DYVCCDCGYNDS   34 (59)
T ss_pred             ceEcCCCCCeec
Confidence            344444444443


No 85 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=84.59  E-value=0.49  Score=26.73  Aligned_cols=28  Identities=29%  Similarity=0.701  Sum_probs=15.1

Q ss_pred             cccccccccccCChHHHHHHHHhhCCCCCccCCCCCcc
Q psy11589        207 KSICDVCGKEFRMKRQLKEHMAVHTTDRPFVCNMCPST  244 (262)
Q Consensus       207 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~  244 (262)
                      .|.|..||+.|...          .......|++||..
T Consensus         6 ~Y~C~~Cg~~~~~~----------~~~~~irCp~Cg~r   33 (49)
T COG1996           6 EYKCARCGREVELD----------QETRGIRCPYCGSR   33 (49)
T ss_pred             EEEhhhcCCeeehh----------hccCceeCCCCCcE
Confidence            46677777666111          12344567777653


No 86 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=84.58  E-value=0.8  Score=26.08  Aligned_cols=21  Identities=24%  Similarity=0.610  Sum_probs=13.4

Q ss_pred             ccCCCCCcccCCh-----HHHHHHHH
Q psy11589        236 FVCNMCPSTFKLK-----KHLRQHYK  256 (262)
Q Consensus       236 ~~C~~C~~~f~~~-----~~L~~H~~  256 (262)
                      -.|.+|++.+...     ++|.+|++
T Consensus        19 a~C~~C~~~l~~~~~~gTs~L~rHl~   44 (50)
T smart00614       19 AKCKYCGKKLSRSSKGGTSNLRRHLR   44 (50)
T ss_pred             EEecCCCCEeeeCCCCCcHHHHHHHH
Confidence            3566666666554     47777776


No 87 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=83.96  E-value=0.83  Score=24.18  Aligned_cols=10  Identities=30%  Similarity=0.959  Sum_probs=4.3

Q ss_pred             ecCCCccccc
Q psy11589         68 KCPDCSVIVV   77 (262)
Q Consensus        68 ~C~~C~~~f~   77 (262)
                      .|+.|+..|.
T Consensus         4 ~CP~C~~~f~   13 (37)
T PF13719_consen    4 TCPNCQTRFR   13 (37)
T ss_pred             ECCCCCceEE
Confidence            3444444443


No 88 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=83.77  E-value=1.1  Score=32.64  Aligned_cols=33  Identities=18%  Similarity=0.388  Sum_probs=20.8

Q ss_pred             CCCcccccccccccCChHHHHHHHHhhCCCCCccCCCCCccc
Q psy11589        204 IHQKSICDVCGKEFRMKRQLKEHMAVHTTDRPFVCNMCPSTF  245 (262)
Q Consensus       204 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f  245 (262)
                      ...-|.|+.|+..|+....+.         .-|.|+.||...
T Consensus       106 ~~~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~L  138 (158)
T TIGR00373       106 NNMFFICPNMCVRFTFNEAME---------LNFTCPRCGAML  138 (158)
T ss_pred             CCCeEECCCCCcEeeHHHHHH---------cCCcCCCCCCEe
Confidence            345567777777776666653         247777777653


No 89 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=83.41  E-value=0.88  Score=30.76  Aligned_cols=12  Identities=42%  Similarity=1.046  Sum_probs=4.9

Q ss_pred             cccccccccccC
Q psy11589        207 KSICDVCGKEFR  218 (262)
Q Consensus       207 ~~~C~~C~~~f~  218 (262)
                      |-.|+.||..|.
T Consensus        26 PivCP~CG~~~~   37 (108)
T PF09538_consen   26 PIVCPKCGTEFP   37 (108)
T ss_pred             CccCCCCCCccC
Confidence            334444444443


No 90 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=83.30  E-value=0.97  Score=23.77  Aligned_cols=9  Identities=33%  Similarity=1.036  Sum_probs=3.8

Q ss_pred             cCCCccccc
Q psy11589         69 CPDCSVIVV   77 (262)
Q Consensus        69 C~~C~~~f~   77 (262)
                      |+.|+..|.
T Consensus         5 Cp~C~~~y~   13 (36)
T PF13717_consen    5 CPNCQAKYE   13 (36)
T ss_pred             CCCCCCEEe
Confidence            444444443


No 91 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=83.26  E-value=0.36  Score=26.07  Aligned_cols=10  Identities=60%  Similarity=1.554  Sum_probs=4.1

Q ss_pred             cccCcccccc
Q psy11589        152 YVCETCGASF  161 (262)
Q Consensus       152 ~~C~~C~~~f  161 (262)
                      |.|+.||..|
T Consensus         6 y~C~~Cg~~f   15 (41)
T smart00834        6 YRCEDCGHTF   15 (41)
T ss_pred             EEcCCCCCEE
Confidence            3344444433


No 92 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=81.99  E-value=0.7  Score=27.14  Aligned_cols=7  Identities=43%  Similarity=1.735  Sum_probs=2.6

Q ss_pred             cccCccc
Q psy11589        152 YVCETCG  158 (262)
Q Consensus       152 ~~C~~C~  158 (262)
                      |.|+.||
T Consensus        26 F~CPnCG   32 (59)
T PRK14890         26 FLCPNCG   32 (59)
T ss_pred             eeCCCCC
Confidence            3333333


No 93 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=81.97  E-value=1.4  Score=34.33  Aligned_cols=39  Identities=18%  Similarity=0.477  Sum_probs=17.4

Q ss_pred             CCCcccCccccccccCchhHHhHHhhh--CCCCccccCcccc
Q psy11589        120 NVREHQCSVCGKAFADITNMKVHMRIH--TGEKKYVCETCGA  159 (262)
Q Consensus       120 ~~~~~~C~~C~~~f~~~~~l~~H~~~h--~~~~~~~C~~C~~  159 (262)
                      +.+.|.|..|....-. ..--.|+..-  .....|+|.-|++
T Consensus       139 GGrif~CsfC~~flCE-DDQFEHQAsCQvLe~E~~KC~SCNr  179 (314)
T PF06524_consen  139 GGRIFKCSFCDNFLCE-DDQFEHQASCQVLESETFKCQSCNR  179 (314)
T ss_pred             CCeEEEeecCCCeeec-cchhhhhhhhhhhhccccccccccc
Confidence            4456666666653322 2222343221  1223466666654


No 94 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=81.80  E-value=1.2  Score=24.62  Aligned_cols=23  Identities=22%  Similarity=0.587  Sum_probs=11.1

Q ss_pred             CCCccCCCCCcccCCh----HHHHHHH
Q psy11589        233 DRPFVCNMCPSTFKLK----KHLRQHY  255 (262)
Q Consensus       233 ~~~~~C~~C~~~f~~~----~~L~~H~  255 (262)
                      ....+|.+|++.+...    ++|.+|+
T Consensus        14 ~~~a~C~~C~~~~~~~~~~ts~l~~HL   40 (45)
T PF02892_consen   14 KKKAKCKYCGKVIKYSSGGTSNLKRHL   40 (45)
T ss_dssp             SS-EEETTTTEE-----SSTHHHHHHH
T ss_pred             cCeEEeCCCCeEEeeCCCcHHHHHHhh
Confidence            3445666666665553    5666666


No 95 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=81.54  E-value=0.9  Score=30.73  Aligned_cols=12  Identities=42%  Similarity=1.093  Sum_probs=5.1

Q ss_pred             ccccCccccccc
Q psy11589        151 KYVCETCGASFA  162 (262)
Q Consensus       151 ~~~C~~C~~~f~  162 (262)
                      |..|+.||..|.
T Consensus        26 PivCP~CG~~~~   37 (108)
T PF09538_consen   26 PIVCPKCGTEFP   37 (108)
T ss_pred             CccCCCCCCccC
Confidence            344444444443


No 96 
>KOG2186|consensus
Probab=81.14  E-value=1  Score=34.90  Aligned_cols=45  Identities=27%  Similarity=0.633  Sum_probs=19.4

Q ss_pred             cccCcccccccCcchHHHHHhhcCCCcccCCcchhcCCCChHHHHHH
Q psy11589        152 YVCETCGASFALWGSLNVHSYSHTNTQFVCSYCGNTYKNPKALTSHI  198 (262)
Q Consensus       152 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~f~~~~~l~~H~  198 (262)
                      |.|..||....- ..+..|+....+.-|.|-.|+.+|.. ..+..|.
T Consensus         4 FtCnvCgEsvKK-p~vekH~srCrn~~fSCIDC~k~F~~-~sYknH~   48 (276)
T KOG2186|consen    4 FTCNVCGESVKK-PQVEKHMSRCRNAYFSCIDCGKTFER-VSYKNHT   48 (276)
T ss_pred             Eehhhhhhhccc-cchHHHHHhccCCeeEEeeccccccc-chhhhhh
Confidence            344444443322 23334444444444444445544444 3344443


No 97 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=79.93  E-value=0.62  Score=26.74  Aligned_cols=12  Identities=25%  Similarity=0.736  Sum_probs=7.8

Q ss_pred             eecCCCcccccc
Q psy11589         67 YKCPDCSVIVVS   78 (262)
Q Consensus        67 ~~C~~C~~~f~~   78 (262)
                      |.|..|+..|..
T Consensus         6 y~C~~Cg~~fe~   17 (52)
T TIGR02605         6 YRCTACGHRFEV   17 (52)
T ss_pred             EEeCCCCCEeEE
Confidence            667777766654


No 98 
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=79.86  E-value=1.3  Score=40.48  Aligned_cols=29  Identities=28%  Similarity=0.562  Sum_probs=17.2

Q ss_pred             hcCCCCcccccccccccCChHHHHHHHHhhCCCCCccCCCCCcc
Q psy11589        201 SHTIHQKSICDVCGKEFRMKRQLKEHMAVHTTDRPFVCNMCPST  244 (262)
Q Consensus       201 ~H~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~  244 (262)
                      .|.......|..||..               ...|..|+.||..
T Consensus       456 ~H~~~~~L~CH~Cg~~---------------~~~p~~Cp~Cgs~  484 (730)
T COG1198         456 LHKATGQLRCHYCGYQ---------------EPIPQSCPECGSE  484 (730)
T ss_pred             EecCCCeeEeCCCCCC---------------CCCCCCCCCCCCC
Confidence            4445566677777633               2356677777654


No 99 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=79.58  E-value=1.7  Score=32.37  Aligned_cols=31  Identities=19%  Similarity=0.503  Sum_probs=17.8

Q ss_pred             CcccccccccccCChHHHHHHHHhhCCCCCccCCCCCccc
Q psy11589        206 QKSICDVCGKEFRMKRQLKEHMAVHTTDRPFVCNMCPSTF  245 (262)
Q Consensus       206 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f  245 (262)
                      .-|.|+.|+..|+....+.         .-|.|+.||...
T Consensus       116 ~~Y~Cp~C~~rytf~eA~~---------~~F~Cp~Cg~~L  146 (178)
T PRK06266        116 MFFFCPNCHIRFTFDEAME---------YGFRCPQCGEML  146 (178)
T ss_pred             CEEECCCCCcEEeHHHHhh---------cCCcCCCCCCCC
Confidence            4466666666666555442         246666666553


No 100
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=78.98  E-value=0.87  Score=25.42  Aligned_cols=30  Identities=27%  Similarity=0.433  Sum_probs=17.5

Q ss_pred             ceecCCCcccccchhHHHhhhhhcCCCCeeecCcchhhcc
Q psy11589         66 SYKCPDCSVIVVSYSGFKSHLDIHNVEKEYCCHICKKVFL  105 (262)
Q Consensus        66 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  105 (262)
                      .|.|+.||..|.....          .....|+.|+..+.
T Consensus         3 ~y~C~~CG~~~~~~~~----------~~~~~Cp~CG~~~~   32 (46)
T PRK00398          3 EYKCARCGREVELDEY----------GTGVRCPYCGYRIL   32 (46)
T ss_pred             EEECCCCCCEEEECCC----------CCceECCCCCCeEE
Confidence            4777777776653221          11467777776543


No 101
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=78.94  E-value=1.3  Score=32.39  Aligned_cols=25  Identities=32%  Similarity=0.804  Sum_probs=20.2

Q ss_pred             cccccccccccCChHHHHHHHHhhCCCCCccCCCCCcc
Q psy11589        207 KSICDVCGKEFRMKRQLKEHMAVHTTDRPFVCNMCPST  244 (262)
Q Consensus       207 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~  244 (262)
                      -|.|++||..+             -|+.|-+||+||-.
T Consensus       134 ~~vC~vCGy~~-------------~ge~P~~CPiCga~  158 (166)
T COG1592         134 VWVCPVCGYTH-------------EGEAPEVCPICGAP  158 (166)
T ss_pred             EEEcCCCCCcc-------------cCCCCCcCCCCCCh
Confidence            69999998654             46789999999943


No 102
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=78.56  E-value=2.2  Score=20.52  Aligned_cols=19  Identities=16%  Similarity=0.454  Sum_probs=12.8

Q ss_pred             cCCCCCcccCChHHHHHHHH
Q psy11589        237 VCNMCPSTFKLKKHLRQHYK  256 (262)
Q Consensus       237 ~C~~C~~~f~~~~~L~~H~~  256 (262)
                      .||+|++.+ ....+..|+.
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            577777776 5566667664


No 103
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=78.17  E-value=1.9  Score=23.57  Aligned_cols=23  Identities=22%  Similarity=0.416  Sum_probs=20.3

Q ss_pred             ceecccCCCCCceeeehHHHHHHHhhh
Q psy11589          9 DFVCNLCPPGSKVVVKYVHYLERHVRK   35 (262)
Q Consensus         9 ~~~C~~C~~~~~~~~~~~~~l~~H~~~   35 (262)
                      .|+|-.|+.    +....++|-.||+-
T Consensus        20 ~ykcfqcpf----tc~~kshl~nhmky   42 (54)
T PF15269_consen   20 KYKCFQCPF----TCNEKSHLFNHMKY   42 (54)
T ss_pred             cceeecCCc----ccchHHHHHHHHHH
Confidence            478999999    89999999999974


No 104
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=77.54  E-value=0.64  Score=25.41  Aligned_cols=7  Identities=57%  Similarity=1.545  Sum_probs=2.6

Q ss_pred             cCccccc
Q psy11589        154 CETCGAS  160 (262)
Q Consensus       154 C~~C~~~  160 (262)
                      |..||..
T Consensus         8 C~~Cg~~   14 (42)
T PF09723_consen    8 CEECGHE   14 (42)
T ss_pred             eCCCCCE
Confidence            3333333


No 105
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=77.52  E-value=2.3  Score=30.60  Aligned_cols=36  Identities=17%  Similarity=0.337  Sum_probs=17.1

Q ss_pred             CeeecCcchhhccChhHHHHHHHHhhcCCCcccCccccccc
Q psy11589         93 KEYCCHICKKVFLRNRNLVCHIKAVHENVREHQCSVCGKAF  133 (262)
Q Consensus        93 ~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f  133 (262)
                      ..|.|+.|+..|.....+..-    .. +..|.|+.||...
T Consensus        98 ~~Y~Cp~C~~~y~~~ea~~~~----d~-~~~f~Cp~Cg~~l  133 (147)
T smart00531       98 AYYKCPNCQSKYTFLEANQLL----DM-DGTFTCPRCGEEL  133 (147)
T ss_pred             cEEECcCCCCEeeHHHHHHhc----CC-CCcEECCCCCCEE
Confidence            346666666665543332210    11 2336666666554


No 106
>KOG2186|consensus
Probab=76.36  E-value=1.8  Score=33.70  Aligned_cols=46  Identities=24%  Similarity=0.588  Sum_probs=25.2

Q ss_pred             eecCcchhhccChhHHHHHHHHhhcCCCcccCccccccccCchhHHhHHh
Q psy11589         95 YCCHICKKVFLRNRNLVCHIKAVHENVREHQCSVCGKAFADITNMKVHMR  144 (262)
Q Consensus        95 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~  144 (262)
                      |.|..|+.... +..+..|+.+-+ + ..|.|-.|+..|.. ..+..|..
T Consensus         4 FtCnvCgEsvK-Kp~vekH~srCr-n-~~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    4 FTCNVCGESVK-KPQVEKHMSRCR-N-AYFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             Eehhhhhhhcc-ccchHHHHHhcc-C-CeeEEeeccccccc-chhhhhhh
Confidence            56666666544 334555644333 2 45666666666665 45555544


No 107
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=76.32  E-value=2  Score=31.31  Aligned_cols=17  Identities=18%  Similarity=0.057  Sum_probs=7.6

Q ss_pred             cccCccccccccCchhH
Q psy11589        123 EHQCSVCGKAFADITNM  139 (262)
Q Consensus       123 ~~~C~~C~~~f~~~~~l  139 (262)
                      -|.|+.|+..|+....+
T Consensus       109 ~Y~Cp~c~~r~tf~eA~  125 (158)
T TIGR00373       109 FFICPNMCVRFTFNEAM  125 (158)
T ss_pred             eEECCCCCcEeeHHHHH
Confidence            34455555444443333


No 108
>KOG2807|consensus
Probab=76.04  E-value=4.3  Score=32.92  Aligned_cols=21  Identities=19%  Similarity=0.360  Sum_probs=13.9

Q ss_pred             CcccCCcchhcCCCChHHHHH
Q psy11589        177 TQFVCSYCGNTYKNPKALTSH  197 (262)
Q Consensus       177 ~~~~C~~C~~~f~~~~~l~~H  197 (262)
                      -|..|+.|+-+......|.+=
T Consensus       289 LP~eCpiC~ltLVss~hLARS  309 (378)
T KOG2807|consen  289 LPIECPICSLTLVSSPHLARS  309 (378)
T ss_pred             CCccCCccceeEecchHHHHH
Confidence            366777777777766666543


No 109
>PF12907 zf-met2:  Zinc-binding
Probab=75.67  E-value=2  Score=23.17  Aligned_cols=13  Identities=31%  Similarity=0.437  Sum_probs=6.4

Q ss_pred             hHHHHHHHhhcCC
Q psy11589        192 KALTSHIRNSHTI  204 (262)
Q Consensus       192 ~~l~~H~~~~H~~  204 (262)
                      ..|..|..+.|..
T Consensus        18 ~~L~eH~enKHpK   30 (40)
T PF12907_consen   18 PQLKEHAENKHPK   30 (40)
T ss_pred             HHHHHHHHccCCC
Confidence            3455555544544


No 110
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=74.42  E-value=1.5  Score=22.33  Aligned_cols=6  Identities=50%  Similarity=1.403  Sum_probs=2.4

Q ss_pred             cCCcch
Q psy11589        180 VCSYCG  185 (262)
Q Consensus       180 ~C~~C~  185 (262)
                      +|+.||
T Consensus        19 rC~~CG   24 (32)
T PF03604_consen   19 RCPECG   24 (32)
T ss_dssp             SBSSSS
T ss_pred             ECCcCC
Confidence            344443


No 111
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=74.01  E-value=2.5  Score=23.14  Aligned_cols=21  Identities=43%  Similarity=0.740  Sum_probs=12.7

Q ss_pred             ccCCCCCcccCChHHHHHHHH
Q psy11589        236 FVCNMCPSTFKLKKHLRQHYK  256 (262)
Q Consensus       236 ~~C~~C~~~f~~~~~L~~H~~  256 (262)
                      |+|-.|..+...++.|-+||+
T Consensus        21 ykcfqcpftc~~kshl~nhmk   41 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMK   41 (54)
T ss_pred             ceeecCCcccchHHHHHHHHH
Confidence            456666666666666666654


No 112
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=73.12  E-value=0.95  Score=22.70  Aligned_cols=8  Identities=50%  Similarity=1.294  Sum_probs=3.4

Q ss_pred             cccCCcch
Q psy11589        178 QFVCSYCG  185 (262)
Q Consensus       178 ~~~C~~C~  185 (262)
                      .+.|+.|+
T Consensus        19 ~~vCp~C~   26 (30)
T PF08274_consen   19 LLVCPECG   26 (30)
T ss_dssp             SEEETTTT
T ss_pred             EEeCCccc
Confidence            34444443


No 113
>KOG2071|consensus
Probab=72.69  E-value=3.5  Score=36.32  Aligned_cols=25  Identities=20%  Similarity=0.567  Sum_probs=19.7

Q ss_pred             CcccCCcchhcCCCChHHHHHHHhhc
Q psy11589        177 TQFVCSYCGNTYKNPKALTSHIRNSH  202 (262)
Q Consensus       177 ~~~~C~~C~~~f~~~~~l~~H~~~~H  202 (262)
                      .+-.|..||..|........|+. .|
T Consensus       417 ~pnqC~~CG~R~~~~ee~sk~md-~H  441 (579)
T KOG2071|consen  417 SPNQCKSCGLRFDDSEERSKHMD-IH  441 (579)
T ss_pred             CcchhcccccccccchhhhhHhh-hh
Confidence            45789999999998888877776 45


No 114
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=71.79  E-value=5.3  Score=28.73  Aligned_cols=36  Identities=14%  Similarity=0.540  Sum_probs=19.6

Q ss_pred             CcccCccccccccCchhHHhHHhhhCCCCccccCcccccc
Q psy11589        122 REHQCSVCGKAFADITNMKVHMRIHTGEKKYVCETCGASF  161 (262)
Q Consensus       122 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f  161 (262)
                      ..|.|+.|+..|.....+.. .  . ....|.|+.||...
T Consensus        98 ~~Y~Cp~C~~~y~~~ea~~~-~--d-~~~~f~Cp~Cg~~l  133 (147)
T smart00531       98 AYYKCPNCQSKYTFLEANQL-L--D-MDGTFTCPRCGEEL  133 (147)
T ss_pred             cEEECcCCCCEeeHHHHHHh-c--C-CCCcEECCCCCCEE
Confidence            45777777777664333222 0  1 12337777777654


No 115
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=71.72  E-value=2.3  Score=39.06  Aligned_cols=28  Identities=25%  Similarity=0.676  Sum_probs=15.7

Q ss_pred             hcCCCcccCccccccccCchhHHhHHhhhCCCCccccCccccc
Q psy11589        118 HENVREHQCSVCGKAFADITNMKVHMRIHTGEKKYVCETCGAS  160 (262)
Q Consensus       118 h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~  160 (262)
                      |.......|..||..               ...|..|+.||..
T Consensus       457 H~~~~~L~CH~Cg~~---------------~~~p~~Cp~Cgs~  484 (730)
T COG1198         457 HKATGQLRCHYCGYQ---------------EPIPQSCPECGSE  484 (730)
T ss_pred             ecCCCeeEeCCCCCC---------------CCCCCCCCCCCCC
Confidence            333445566666654               2345667777754


No 116
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=71.61  E-value=3.1  Score=29.01  Aligned_cols=15  Identities=20%  Similarity=0.441  Sum_probs=9.2

Q ss_pred             ccceecCCCcccccc
Q psy11589         64 KVSYKCPDCSVIVVS   78 (262)
Q Consensus        64 ~~~~~C~~C~~~f~~   78 (262)
                      ...|+|++|..+..+
T Consensus        78 ~~lYeCnIC~etS~e   92 (140)
T PF05290_consen   78 PKLYECNICKETSAE   92 (140)
T ss_pred             CCceeccCcccccch
Confidence            355777777666544


No 117
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=70.28  E-value=2.5  Score=29.41  Aligned_cols=15  Identities=27%  Similarity=0.647  Sum_probs=7.9

Q ss_pred             cccccccccccCChH
Q psy11589        207 KSICDVCGKEFRMKR  221 (262)
Q Consensus       207 ~~~C~~C~~~f~~~~  221 (262)
                      |++|..||+.|...+
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            345555555555443


No 118
>PRK04023 DNA polymerase II large subunit; Validated
Probab=70.18  E-value=4.3  Score=38.25  Aligned_cols=10  Identities=20%  Similarity=0.348  Sum_probs=5.6

Q ss_pred             ccCCCCCccc
Q psy11589        236 FVCNMCPSTF  245 (262)
Q Consensus       236 ~~C~~C~~~f  245 (262)
                      +.|+.||..-
T Consensus       664 y~CPKCG~El  673 (1121)
T PRK04023        664 DECEKCGREP  673 (1121)
T ss_pred             CcCCCCCCCC
Confidence            4566666543


No 119
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=69.74  E-value=3.6  Score=28.44  Aligned_cols=11  Identities=27%  Similarity=0.646  Sum_probs=5.0

Q ss_pred             cccCCcchhcC
Q psy11589        178 QFVCSYCGNTY  188 (262)
Q Consensus       178 ~~~C~~C~~~f  188 (262)
                      |..|+.||..|
T Consensus        26 p~vcP~cg~~~   36 (129)
T TIGR02300        26 PAVSPYTGEQF   36 (129)
T ss_pred             CccCCCcCCcc
Confidence            44444444444


No 120
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=69.49  E-value=1.8  Score=25.55  Aligned_cols=21  Identities=24%  Similarity=0.673  Sum_probs=10.1

Q ss_pred             hHHHHHHHHhhCCCCCccCCC
Q psy11589        220 KRQLKEHMAVHTTDRPFVCNM  240 (262)
Q Consensus       220 ~~~l~~H~~~h~~~~~~~C~~  240 (262)
                      +..|..|+...=..++..|++
T Consensus        23 r~~l~~H~~~~C~~~~v~C~~   43 (60)
T PF02176_consen   23 RKELDDHLENECPKRPVPCPY   43 (60)
T ss_dssp             CCCHHHHHHTTSTTSEEE-SS
T ss_pred             HHHHHHHHHccCCCCcEECCC
Confidence            334555555444444555555


No 121
>PF14353 CpXC:  CpXC protein
Probab=68.84  E-value=1.2  Score=31.11  Aligned_cols=10  Identities=40%  Similarity=1.185  Sum_probs=5.4

Q ss_pred             cCcccccccc
Q psy11589        125 QCSVCGKAFA  134 (262)
Q Consensus       125 ~C~~C~~~f~  134 (262)
                      .|+.|+..|.
T Consensus         3 tCP~C~~~~~   12 (128)
T PF14353_consen    3 TCPHCGHEFE   12 (128)
T ss_pred             CCCCCCCeeE
Confidence            4555655554


No 122
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=68.34  E-value=1.2  Score=32.31  Aligned_cols=17  Identities=24%  Similarity=0.681  Sum_probs=10.1

Q ss_pred             cccCcccccccCcchHH
Q psy11589        152 YVCETCGASFALWGSLN  168 (262)
Q Consensus       152 ~~C~~C~~~f~~~~~l~  168 (262)
                      +.|+.||++|.+...+.
T Consensus        29 ~~c~~c~~~f~~~e~~~   45 (154)
T PRK00464         29 RECLACGKRFTTFERVE   45 (154)
T ss_pred             eeccccCCcceEeEecc
Confidence            56666666666554433


No 123
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=68.25  E-value=3.6  Score=30.70  Aligned_cols=32  Identities=19%  Similarity=0.522  Sum_probs=18.0

Q ss_pred             CeeecCcchhhccChhHHHHHHHHhhcCCCcccCcccccccc
Q psy11589         93 KEYCCHICKKVFLRNRNLVCHIKAVHENVREHQCSVCGKAFA  134 (262)
Q Consensus        93 ~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~  134 (262)
                      .-|.|+.|+..|.....+.          ..|.|+.||....
T Consensus       116 ~~Y~Cp~C~~rytf~eA~~----------~~F~Cp~Cg~~L~  147 (178)
T PRK06266        116 MFFFCPNCHIRFTFDEAME----------YGFRCPQCGEMLE  147 (178)
T ss_pred             CEEECCCCCcEEeHHHHhh----------cCCcCCCCCCCCe
Confidence            3466666666665554431          2466666666543


No 124
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=66.72  E-value=4.9  Score=30.90  Aligned_cols=28  Identities=29%  Similarity=0.516  Sum_probs=18.6

Q ss_pred             CCeeecCcchhhccChhHHHHHHHHhhc
Q psy11589         92 EKEYCCHICKKVFLRNRNLVCHIKAVHE  119 (262)
Q Consensus        92 ~~~~~C~~C~~~f~~~~~l~~H~~~~h~  119 (262)
                      +..|.|++|++.|.-..-+.+||...|.
T Consensus        75 ~~K~~C~lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   75 EDKWRCPLCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             SEEEEE-SSS-EESSHHHHHHHHHHH-H
T ss_pred             CCEECCCCCCcccCChHHHHHHHhhcCH
Confidence            3457788888888888888888777774


No 125
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=66.64  E-value=2.8  Score=19.80  Aligned_cols=8  Identities=38%  Similarity=0.862  Sum_probs=3.7

Q ss_pred             cccccccc
Q psy11589        207 KSICDVCG  214 (262)
Q Consensus       207 ~~~C~~C~  214 (262)
                      +|.|+.||
T Consensus        16 ~f~CPnCG   23 (24)
T PF07754_consen   16 PFPCPNCG   23 (24)
T ss_pred             eEeCCCCC
Confidence            34444444


No 126
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=64.97  E-value=2.6  Score=23.68  Aligned_cols=14  Identities=21%  Similarity=0.503  Sum_probs=10.6

Q ss_pred             ceecccCCCCCceeeehH
Q psy11589          9 DFVCNLCPPGSKVVVKYV   26 (262)
Q Consensus         9 ~~~C~~C~~~~~~~~~~~   26 (262)
                      .|+|..|+.    ++.-.
T Consensus         1 ky~C~~Cgy----vYd~~   14 (47)
T PF00301_consen    1 KYQCPVCGY----VYDPE   14 (47)
T ss_dssp             EEEETTTSB----EEETT
T ss_pred             CcCCCCCCE----EEcCC
Confidence            388999998    77533


No 127
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=64.89  E-value=2.7  Score=32.24  Aligned_cols=23  Identities=30%  Similarity=0.605  Sum_probs=11.8

Q ss_pred             cccccccccccCChHHHHHHHHh
Q psy11589        207 KSICDVCGKEFRMKRQLKEHMAV  229 (262)
Q Consensus       207 ~~~C~~C~~~f~~~~~l~~H~~~  229 (262)
                      .|.|+.|+|.|.-..-...|+..
T Consensus        77 K~~C~lc~KlFkg~eFV~KHI~n   99 (214)
T PF04959_consen   77 KWRCPLCGKLFKGPEFVRKHIFN   99 (214)
T ss_dssp             EEEE-SSS-EESSHHHHHHHHHH
T ss_pred             EECCCCCCcccCChHHHHHHHhh
Confidence            45555555555555555555544


No 128
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=63.22  E-value=6.3  Score=25.26  Aligned_cols=30  Identities=27%  Similarity=0.520  Sum_probs=18.6

Q ss_pred             ceecCCCcccccchhHHHhhhhhcCCCCeeecCcchhhcc
Q psy11589         66 SYKCPDCSVIVVSYSGFKSHLDIHNVEKEYCCHICKKVFL  105 (262)
Q Consensus        66 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  105 (262)
                      .|.|+.|++.--        .+.  ....+.|..|+..|.
T Consensus        35 ~~~Cp~C~~~~V--------kR~--a~GIW~C~kCg~~fA   64 (89)
T COG1997          35 KHVCPFCGRTTV--------KRI--ATGIWKCRKCGAKFA   64 (89)
T ss_pred             CCcCCCCCCcce--------eee--ccCeEEcCCCCCeec
Confidence            467888887521        111  234678888887775


No 129
>KOG2807|consensus
Probab=62.02  E-value=16  Score=29.81  Aligned_cols=22  Identities=18%  Similarity=0.380  Sum_probs=12.9

Q ss_pred             cccCCcchhcCCCChHHHHHHH
Q psy11589        178 QFVCSYCGNTYKNPKALTSHIR  199 (262)
Q Consensus       178 ~~~C~~C~~~f~~~~~l~~H~~  199 (262)
                      .|.|+.|...|-..-+...|..
T Consensus       345 ~y~C~~Ck~~FCldCDv~iHes  366 (378)
T KOG2807|consen  345 RYRCESCKNVFCLDCDVFIHES  366 (378)
T ss_pred             cEEchhccceeeccchHHHHhh
Confidence            4666666666665555555544


No 130
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=61.03  E-value=13  Score=30.70  Aligned_cols=26  Identities=19%  Similarity=0.609  Sum_probs=14.1

Q ss_pred             cCCCCcccccccc-cccCChHHHHHHH
Q psy11589        202 HTIHQKSICDVCG-KEFRMKRQLKEHM  227 (262)
Q Consensus       202 H~~~~~~~C~~C~-~~f~~~~~l~~H~  227 (262)
                      |.-++.|.|.+|| +.+..+..+.+|-
T Consensus       369 hgLd~ef~CEICgNyvy~GR~~FdrHF  395 (470)
T COG5188         369 HGLDIEFECEICGNYVYYGRDRFDRHF  395 (470)
T ss_pred             cCCCcceeeeecccccccchHHHHhhh
Confidence            4444446666666 5555555555554


No 131
>KOG2071|consensus
Probab=60.90  E-value=9.2  Score=33.82  Aligned_cols=28  Identities=18%  Similarity=0.274  Sum_probs=22.8

Q ss_pred             CCCceecccCCCCCceeeehHHHHHHHhhhcc
Q psy11589          6 ENSDFVCNLCPPGSKVVVKYVHYLERHVRKHH   37 (262)
Q Consensus         6 ~~~~~~C~~C~~~~~~~~~~~~~l~~H~~~~~   37 (262)
                      .+.|-.|..||.    .|...+....||..|-
T Consensus       415 ~~~pnqC~~CG~----R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  415 KDSPNQCKSCGL----RFDDSEERSKHMDIHD  442 (579)
T ss_pred             cCCcchhccccc----ccccchhhhhHhhhhh
Confidence            356789999999    8988888888887764


No 132
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=60.08  E-value=5.5  Score=28.04  Aligned_cols=22  Identities=32%  Similarity=0.750  Sum_probs=9.5

Q ss_pred             ccCCCCCcccCChHHHHHHHHhhcc
Q psy11589        236 FVCNMCPSTFKLKKHLRQHYKVHLK  260 (262)
Q Consensus       236 ~~C~~C~~~f~~~~~L~~H~~~H~~  260 (262)
                      ..|-+||+.|..   |.+|+++|+|
T Consensus        73 i~clecGk~~k~---LkrHL~~~~g   94 (132)
T PF05443_consen   73 IICLECGKKFKT---LKRHLRTHHG   94 (132)
T ss_dssp             EE-TBT--EESB---HHHHHHHTT-
T ss_pred             eEEccCCcccch---HHHHHHHccC
Confidence            455556655543   3556555544


No 133
>PRK04023 DNA polymerase II large subunit; Validated
Probab=59.86  E-value=7.9  Score=36.63  Aligned_cols=9  Identities=44%  Similarity=1.269  Sum_probs=6.0

Q ss_pred             ccCcccccc
Q psy11589        124 HQCSVCGKA  132 (262)
Q Consensus       124 ~~C~~C~~~  132 (262)
                      ..|+.||..
T Consensus       627 RfCpsCG~~  635 (1121)
T PRK04023        627 RKCPSCGKE  635 (1121)
T ss_pred             ccCCCCCCc
Confidence            567777765


No 134
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=59.50  E-value=12  Score=30.23  Aligned_cols=22  Identities=18%  Similarity=0.469  Sum_probs=13.1

Q ss_pred             cccCCcchhcCCCChHHHHHHH
Q psy11589        178 QFVCSYCGNTYKNPKALTSHIR  199 (262)
Q Consensus       178 ~~~C~~C~~~f~~~~~l~~H~~  199 (262)
                      .|.|+.|...|-..-....|..
T Consensus       388 rY~Ce~CK~~FC~dCdvfiHe~  409 (421)
T COG5151         388 RYQCELCKSTFCSDCDVFIHET  409 (421)
T ss_pred             ceechhhhhhhhhhhHHHHHHH
Confidence            4666666666666555555544


No 135
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=58.62  E-value=4.3  Score=23.16  Aligned_cols=11  Identities=27%  Similarity=0.540  Sum_probs=6.3

Q ss_pred             CccCCCCCccc
Q psy11589        235 PFVCNMCPSTF  245 (262)
Q Consensus       235 ~~~C~~C~~~f  245 (262)
                      .+.|+.||+.+
T Consensus        37 r~~C~~Cgyt~   47 (50)
T PRK00432         37 RWHCGKCGYTE   47 (50)
T ss_pred             cEECCCcCCEE
Confidence            45666666553


No 136
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=57.39  E-value=7.3  Score=25.70  Aligned_cols=14  Identities=29%  Similarity=0.638  Sum_probs=8.8

Q ss_pred             cccccccccccCCh
Q psy11589        207 KSICDVCGKEFRMK  220 (262)
Q Consensus       207 ~~~C~~C~~~f~~~  220 (262)
                      |++|..||..|..-
T Consensus         2 pH~CtrCG~vf~~g   15 (112)
T COG3364           2 PHQCTRCGEVFDDG   15 (112)
T ss_pred             Cceecccccccccc
Confidence            45666666666664


No 137
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=56.75  E-value=4.6  Score=28.92  Aligned_cols=34  Identities=21%  Similarity=0.534  Sum_probs=18.9

Q ss_pred             CcccccccccccCChHHHHHHHHhhCCCCCccCCCCCcc
Q psy11589        206 QKSICDVCGKEFRMKRQLKEHMAVHTTDRPFVCNMCPST  244 (262)
Q Consensus       206 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~  244 (262)
                      -+|.|. |+..|.+..   +|-.+-.|+ .|.|..|+-.
T Consensus       116 ~~Y~C~-C~q~~l~~R---Rhn~~~~g~-~YrC~~C~gk  149 (156)
T COG3091         116 YPYRCQ-CQQHYLRIR---RHNTVRRGE-VYRCGKCGGK  149 (156)
T ss_pred             eeEEee-cCCccchhh---hcccccccc-eEEeccCCce
Confidence            456676 766655442   344444455 5777776543


No 138
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=56.58  E-value=8.9  Score=30.93  Aligned_cols=25  Identities=20%  Similarity=0.469  Sum_probs=15.9

Q ss_pred             CcccccccccccCChHHHHHHHHhh
Q psy11589        206 QKSICDVCGKEFRMKRQLKEHMAVH  230 (262)
Q Consensus       206 ~~~~C~~C~~~f~~~~~l~~H~~~h  230 (262)
                      ..|+|+.|...|-..-+.-.|-..|
T Consensus       387 ~rY~Ce~CK~~FC~dCdvfiHe~Lh  411 (421)
T COG5151         387 GRYQCELCKSTFCSDCDVFIHETLH  411 (421)
T ss_pred             cceechhhhhhhhhhhHHHHHHHHh
Confidence            4567777776666666666665554


No 139
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=56.08  E-value=8.7  Score=20.94  Aligned_cols=11  Identities=27%  Similarity=1.099  Sum_probs=5.6

Q ss_pred             eecCCCccccc
Q psy11589         67 YKCPDCSVIVV   77 (262)
Q Consensus        67 ~~C~~C~~~f~   77 (262)
                      +.|+.||....
T Consensus        20 ~vC~~CG~Vl~   30 (43)
T PF08271_consen   20 LVCPNCGLVLE   30 (43)
T ss_dssp             EEETTT-BBEE
T ss_pred             EECCCCCCEee
Confidence            45666665543


No 140
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=56.08  E-value=3.9  Score=25.38  Aligned_cols=15  Identities=40%  Similarity=0.840  Sum_probs=7.2

Q ss_pred             CcccCc--cccccccCc
Q psy11589        122 REHQCS--VCGKAFADI  136 (262)
Q Consensus       122 ~~~~C~--~C~~~f~~~  136 (262)
                      ..+.|.  .||.+|...
T Consensus        26 ~Y~qC~N~eCg~tF~t~   42 (72)
T PRK09678         26 RYHQCQNVNCSATFITY   42 (72)
T ss_pred             eeeecCCCCCCCEEEEE
Confidence            344554  455555443


No 141
>KOG4167|consensus
Probab=54.67  E-value=2.5  Score=38.04  Aligned_cols=25  Identities=32%  Similarity=0.475  Sum_probs=23.2

Q ss_pred             CccCCCCCcccCChHHHHHHHHhhc
Q psy11589        235 PFVCNMCPSTFKLKKHLRQHYKVHL  259 (262)
Q Consensus       235 ~~~C~~C~~~f~~~~~L~~H~~~H~  259 (262)
                      -|-|..|++.|....++..||++|.
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHH
Confidence            3999999999999999999999996


No 142
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=54.64  E-value=5.2  Score=21.01  Aligned_cols=8  Identities=38%  Similarity=1.468  Sum_probs=3.3

Q ss_pred             Cccccccc
Q psy11589        126 CSVCGKAF  133 (262)
Q Consensus       126 C~~C~~~f  133 (262)
                      |+.|+..|
T Consensus         4 C~~Cg~~Y   11 (36)
T PF05191_consen    4 CPKCGRIY   11 (36)
T ss_dssp             ETTTTEEE
T ss_pred             cCCCCCcc
Confidence            44444443


No 143
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=54.63  E-value=8.2  Score=22.38  Aligned_cols=26  Identities=50%  Similarity=1.211  Sum_probs=14.3

Q ss_pred             ccCccccccccCchhHHhHHhhhCCCCccccCcccccc
Q psy11589        124 HQCSVCGKAFADITNMKVHMRIHTGEKKYVCETCGASF  161 (262)
Q Consensus       124 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f  161 (262)
                      ..|+.|+..|..            ++....|+.|+..+
T Consensus         6 ~~C~~Cg~~~~~------------~dDiVvCp~Cgapy   31 (54)
T PF14446_consen    6 CKCPVCGKKFKD------------GDDIVVCPECGAPY   31 (54)
T ss_pred             ccChhhCCcccC------------CCCEEECCCCCCcc
Confidence            356666666643            23345566666544


No 144
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=54.61  E-value=7.8  Score=25.00  Aligned_cols=10  Identities=40%  Similarity=1.052  Sum_probs=4.2

Q ss_pred             cccCcccccc
Q psy11589        152 YVCETCGASF  161 (262)
Q Consensus       152 ~~C~~C~~~f  161 (262)
                      -.|..||..|
T Consensus        59 a~CkkCGfef   68 (97)
T COG3357          59 ARCKKCGFEF   68 (97)
T ss_pred             hhhcccCccc
Confidence            3344444444


No 145
>KOG2593|consensus
Probab=53.67  E-value=12  Score=31.71  Aligned_cols=35  Identities=26%  Similarity=0.591  Sum_probs=18.1

Q ss_pred             CcccCCcchhcCCCChHHHHHHHhhcCCCCccccccccc
Q psy11589        177 TQFVCSYCGNTYKNPKALTSHIRNSHTIHQKSICDVCGK  215 (262)
Q Consensus       177 ~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~C~~C~~  215 (262)
                      ..|.||.|.+.|.....+..    .-.....|.|..|+-
T Consensus       127 ~~Y~Cp~C~kkyt~Lea~~L----~~~~~~~F~C~~C~g  161 (436)
T KOG2593|consen  127 AGYVCPNCQKKYTSLEALQL----LDNETGEFHCENCGG  161 (436)
T ss_pred             ccccCCccccchhhhHHHHh----hcccCceEEEecCCC
Confidence            34666666666665554432    222334466666653


No 146
>KOG0696|consensus
Probab=51.93  E-value=8.6  Score=32.78  Aligned_cols=45  Identities=24%  Similarity=0.449  Sum_probs=21.5

Q ss_pred             HHhhcCCCcccCCcchhcCCCChHHHHHHHhhcCCCCcccccccc
Q psy11589        170 HSYSHTNTQFVCSYCGNTYKNPKALTSHIRNSHTIHQKSICDVCG  214 (262)
Q Consensus       170 H~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~C~~C~  214 (262)
                      |.+-|.-..|.||-=++.+.+...-..|....|+-..|--|+.||
T Consensus        84 HkrChefVtF~CPGadkg~dtDdpr~kHkf~~~tYssPTFCDhCG  128 (683)
T KOG0696|consen   84 HKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYSSPTFCDHCG  128 (683)
T ss_pred             hhhhcceEEEECCCCCCCCCCCCcccccceeeeecCCCchhhhHH
Confidence            444443344555555555555444444444344444444455554


No 147
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=51.58  E-value=8.6  Score=33.28  Aligned_cols=28  Identities=18%  Similarity=0.597  Sum_probs=23.3

Q ss_pred             cccCCcchhcCCCChHHHHHHHhhcCCC
Q psy11589        178 QFVCSYCGNTYKNPKALTSHIRNSHTIH  205 (262)
Q Consensus       178 ~~~C~~C~~~f~~~~~l~~H~~~~H~~~  205 (262)
                      =+.|+.|.+.|.+...+..|+...|.+.
T Consensus        57 FWiCp~CskkF~d~~~~~~H~~~eH~~~   84 (466)
T PF04780_consen   57 FWICPRCSKKFSDAESCLSHMEQEHPAG   84 (466)
T ss_pred             EeeCCcccceeCCHHHHHHHHHHhhhhh
Confidence            4689999999999999999988778653


No 148
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=51.33  E-value=7.9  Score=20.71  Aligned_cols=13  Identities=31%  Similarity=0.603  Sum_probs=10.0

Q ss_pred             CccCCCCCcccCC
Q psy11589        235 PFVCNMCPSTFKL  247 (262)
Q Consensus       235 ~~~C~~C~~~f~~  247 (262)
                      ||+|+.|+..|=.
T Consensus        12 ~f~C~~C~~~FC~   24 (39)
T smart00154       12 GFKCRHCGNLFCG   24 (39)
T ss_pred             CeECCccCCcccc
Confidence            7888888887754


No 149
>KOG1280|consensus
Probab=50.13  E-value=14  Score=30.40  Aligned_cols=37  Identities=19%  Similarity=0.542  Sum_probs=21.0

Q ss_pred             eeecCcchhhccChhHHHHHHHHhhcCCCc-ccCcccc
Q psy11589         94 EYCCHICKKVFLRNRNLVCHIKAVHENVRE-HQCSVCG  130 (262)
Q Consensus        94 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~-~~C~~C~  130 (262)
                      .|.|+.|+..-.+...|..|+...|....+ ..|++|.
T Consensus        79 SftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   79 SFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             cccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            466666666666666666666666654321 3444443


No 150
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=49.83  E-value=8  Score=27.41  Aligned_cols=15  Identities=20%  Similarity=0.319  Sum_probs=10.5

Q ss_pred             cceecCCCcccccch
Q psy11589         65 VSYKCPDCSVIVVSY   79 (262)
Q Consensus        65 ~~~~C~~C~~~f~~~   79 (262)
                      ..+.|..||..|...
T Consensus        69 ~~~~C~~CG~~~~~~   83 (135)
T PRK03824         69 AVLKCRNCGNEWSLK   83 (135)
T ss_pred             eEEECCCCCCEEecc
Confidence            447888888777653


No 151
>KOG2272|consensus
Probab=48.84  E-value=17  Score=28.48  Aligned_cols=15  Identities=27%  Similarity=0.671  Sum_probs=11.0

Q ss_pred             CccCCCCCcccCChH
Q psy11589        235 PFVCNMCPSTFKLKK  249 (262)
Q Consensus       235 ~~~C~~C~~~f~~~~  249 (262)
                      -|.|+.|++...++.
T Consensus       280 cf~Cs~Cdkkl~~K~  294 (332)
T KOG2272|consen  280 CFSCSTCDKKLTQKN  294 (332)
T ss_pred             ccccccccccccccc
Confidence            388888888776654


No 152
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=48.55  E-value=18  Score=21.00  Aligned_cols=10  Identities=20%  Similarity=0.713  Sum_probs=4.9

Q ss_pred             eecCCCcccc
Q psy11589         67 YKCPDCSVIV   76 (262)
Q Consensus        67 ~~C~~C~~~f   76 (262)
                      ..|+.||..+
T Consensus        23 V~Cp~CGael   32 (54)
T TIGR01206        23 VICDECGAEL   32 (54)
T ss_pred             EeCCCCCCEE
Confidence            3455555443


No 153
>PF09416 UPF1_Zn_bind:  RNA helicase (UPF2 interacting domain);  InterPro: IPR018999 UPF1 (or regulator of nonsense transcripts 1 homologue) is an essential RNA helicase that detects mRNAs containing premature stop codons and triggers their degradation. This domain contains 3 zinc binding motifs and forms interactions with another protein (UPF2) that is also involved nonsense-mediated mRNA decay (NMD) []. ; GO: 0003677 DNA binding, 0004386 helicase activity, 0005524 ATP binding, 0008270 zinc ion binding, 0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay, 0005737 cytoplasm; PDB: 2IYK_B 2WJY_A 2WJV_A 2XZL_A.
Probab=48.32  E-value=20  Score=25.89  Aligned_cols=55  Identities=15%  Similarity=0.272  Sum_probs=26.2

Q ss_pred             ccCCCceecccCCCCCceeee------hHHHHHHHhhhccCCccCccccccccccccccccccCCCccceecCCCccc
Q psy11589          4 KHENSDFVCNLCPPGSKVVVK------YVHYLERHVRKHHTMFLRLPKVHSHFRKKNAIHVNNINKKVSYKCPDCSVI   75 (262)
Q Consensus         4 ~~~~~~~~C~~C~~~~~~~~~------~~~~l~~H~~~~~~~~~~~~~l~~~~~~~~~~h~~~~~~~~~~~C~~C~~~   75 (262)
                      +......+|..|++    -|=      ..+++..|+..-.     ....        ..|....-++..++|..||-.
T Consensus         9 ~~p~~vv~C~~c~k----WFCNg~~~~s~SHIv~HLv~sr-----h~ev--------~LH~~s~lgdt~leCy~Cg~~   69 (152)
T PF09416_consen    9 HDPSCVVKCNTCNK----WFCNGRGNTSGSHIVNHLVRSR-----HKEV--------SLHPDSPLGDTVLECYNCGSR   69 (152)
T ss_dssp             --CCCEEEETTTTE----EEES--TTSSS-HHHHHHHHHT--------E--------EE-TTSTT-S-B---TTT---
T ss_pred             CCcccEeEcCCCCc----EeecCCCCCcccHHHHHHHHcc-----CCce--------eeCCCCCCCCcEEEEEecCCC
Confidence            44556678998888    773      4567888875421     1122        344445556777899999853


No 154
>KOG2593|consensus
Probab=48.16  E-value=16  Score=31.11  Aligned_cols=37  Identities=24%  Similarity=0.532  Sum_probs=22.7

Q ss_pred             CCeeecCcchhhccChhHHHHHHHHhhcCCCcccCcccccc
Q psy11589         92 EKEYCCHICKKVFLRNRNLVCHIKAVHENVREHQCSVCGKA  132 (262)
Q Consensus        92 ~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~  132 (262)
                      ...|.|+.|.+.|.....+..-    -.....|.|..|+-.
T Consensus       126 ~~~Y~Cp~C~kkyt~Lea~~L~----~~~~~~F~C~~C~ge  162 (436)
T KOG2593|consen  126 VAGYVCPNCQKKYTSLEALQLL----DNETGEFHCENCGGE  162 (436)
T ss_pred             cccccCCccccchhhhHHHHhh----cccCceEEEecCCCc
Confidence            3457788888777766655322    233445777777643


No 155
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=48.15  E-value=9.1  Score=25.66  Aligned_cols=29  Identities=21%  Similarity=0.674  Sum_probs=16.5

Q ss_pred             ccCcccccccCcchHHHHHhhcCCCcccCCcchhcCCCC
Q psy11589        153 VCETCGASFALWGSLNVHSYSHTNTQFVCSYCGNTYKNP  191 (262)
Q Consensus       153 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~f~~~  191 (262)
                      .|+.|+..|...          .+..|.||+|+..+...
T Consensus         4 ~CP~C~seytY~----------dg~~~iCpeC~~EW~~~   32 (109)
T TIGR00686         4 PCPKCNSEYTYH----------DGTQLICPSCLYEWNEN   32 (109)
T ss_pred             cCCcCCCcceEe----------cCCeeECcccccccccc
Confidence            366666655443          23456677777666544


No 156
>KOG4167|consensus
Probab=47.55  E-value=5.3  Score=36.15  Aligned_cols=26  Identities=15%  Similarity=0.511  Sum_probs=18.6

Q ss_pred             cceecCCCcccccchhHHHhhhhhcC
Q psy11589         65 VSYKCPDCSVIVVSYSGFKSHLDIHN   90 (262)
Q Consensus        65 ~~~~C~~C~~~f~~~~~l~~H~~~h~   90 (262)
                      ..|.|..|++.|....++..||++|.
T Consensus       791 giFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  791 GIFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             ceeehHHHHHHHHHHhhhhHHHHHHH
Confidence            34777777777777777777777764


No 157
>KOG1280|consensus
Probab=47.51  E-value=15  Score=30.21  Aligned_cols=24  Identities=21%  Similarity=0.378  Sum_probs=13.1

Q ss_pred             ccccCcccccccCcchHHHHHhhc
Q psy11589        151 KYVCETCGASFALWGSLNVHSYSH  174 (262)
Q Consensus       151 ~~~C~~C~~~f~~~~~l~~H~~~h  174 (262)
                      .|.|+.|+..=.+...|..|....
T Consensus        79 SftCPyC~~~Gfte~~f~~Hv~s~  102 (381)
T KOG1280|consen   79 SFTCPYCGIMGFTERQFGTHVLSQ  102 (381)
T ss_pred             cccCCcccccccchhHHHHHhhhc
Confidence            455555555555555555555443


No 158
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=45.52  E-value=19  Score=35.27  Aligned_cols=8  Identities=38%  Similarity=1.298  Sum_probs=4.0

Q ss_pred             ccCccccc
Q psy11589        124 HQCSVCGK  131 (262)
Q Consensus       124 ~~C~~C~~  131 (262)
                      +.|+.||.
T Consensus       668 rkCPkCG~  675 (1337)
T PRK14714        668 RRCPSCGT  675 (1337)
T ss_pred             EECCCCCC
Confidence            44555554


No 159
>COG4640 Predicted membrane protein [Function unknown]
Probab=45.16  E-value=15  Score=30.90  Aligned_cols=24  Identities=17%  Similarity=0.529  Sum_probs=16.2

Q ss_pred             cCCCCcccccccccccCChHHHHH
Q psy11589        202 HTIHQKSICDVCGKEFRMKRQLKE  225 (262)
Q Consensus       202 H~~~~~~~C~~C~~~f~~~~~l~~  225 (262)
                      +..+..++|+.||..|.+...+..
T Consensus        10 qk~Ed~~qC~qCG~~~t~~~sqan   33 (465)
T COG4640          10 QKAEDDVQCTQCGHKFTSRQSQAN   33 (465)
T ss_pred             ccccccccccccCCcCCchhhhhh
Confidence            344555668888888887766554


No 160
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=45.06  E-value=24  Score=19.86  Aligned_cols=11  Identities=18%  Similarity=0.573  Sum_probs=6.1

Q ss_pred             eecCCCccccc
Q psy11589         67 YKCPDCSVIVV   77 (262)
Q Consensus        67 ~~C~~C~~~f~   77 (262)
                      +.|+.||..+.
T Consensus        21 ~vC~~Cg~~~~   31 (52)
T smart00661       21 FVCRKCGYEEP   31 (52)
T ss_pred             EECCcCCCeEE
Confidence            55666665443


No 161
>KOG3408|consensus
Probab=44.85  E-value=15  Score=25.23  Aligned_cols=23  Identities=26%  Similarity=0.476  Sum_probs=13.1

Q ss_pred             CcccccccccccCChHHHHHHHH
Q psy11589        206 QKSICDVCGKEFRMKRQLKEHMA  228 (262)
Q Consensus       206 ~~~~C~~C~~~f~~~~~l~~H~~  228 (262)
                      ..|.|-.|.+.|.+...|..|.+
T Consensus        56 GqfyCi~CaRyFi~~~~l~~H~k   78 (129)
T KOG3408|consen   56 GQFYCIECARYFIDAKALKTHFK   78 (129)
T ss_pred             ceeehhhhhhhhcchHHHHHHHh
Confidence            34556666666666666655543


No 162
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=44.58  E-value=17  Score=32.12  Aligned_cols=15  Identities=33%  Similarity=0.680  Sum_probs=8.0

Q ss_pred             cCCCCcccccccccc
Q psy11589        202 HTIHQKSICDVCGKE  216 (262)
Q Consensus       202 H~~~~~~~C~~C~~~  216 (262)
                      |.......|..||..
T Consensus       235 h~~~~~l~Ch~Cg~~  249 (505)
T TIGR00595       235 HKKEGKLRCHYCGYQ  249 (505)
T ss_pred             ecCCCeEEcCCCcCc
Confidence            444445566666643


No 163
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=44.48  E-value=14  Score=22.48  Aligned_cols=10  Identities=40%  Similarity=0.730  Sum_probs=4.7

Q ss_pred             cccccccccc
Q psy11589        207 KSICDVCGKE  216 (262)
Q Consensus       207 ~~~C~~C~~~  216 (262)
                      .|.|+.||..
T Consensus        46 ~~~C~~Cg~~   55 (69)
T PF07282_consen   46 VFTCPNCGFE   55 (69)
T ss_pred             eEEcCCCCCE
Confidence            3445555444


No 164
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=44.00  E-value=21  Score=20.28  Aligned_cols=10  Identities=30%  Similarity=0.836  Sum_probs=4.8

Q ss_pred             eecCCCcccc
Q psy11589         67 YKCPDCSVIV   76 (262)
Q Consensus        67 ~~C~~C~~~f   76 (262)
                      +.|..||..|
T Consensus         5 l~C~dCg~~F   14 (49)
T PF13451_consen    5 LTCKDCGAEF   14 (49)
T ss_pred             EEcccCCCeE
Confidence            4455555444


No 165
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=43.89  E-value=7.9  Score=22.18  Aligned_cols=20  Identities=30%  Similarity=0.665  Sum_probs=6.5

Q ss_pred             eeecCcchhhccChhHHHHH
Q psy11589         94 EYCCHICKKVFLRNRNLVCH  113 (262)
Q Consensus        94 ~~~C~~C~~~f~~~~~l~~H  113 (262)
                      .|.|+.|...|-..=++-.|
T Consensus        21 ~y~C~~C~~~FC~dCD~fiH   40 (51)
T PF07975_consen   21 RYRCPKCKNHFCIDCDVFIH   40 (51)
T ss_dssp             EE--TTTT--B-HHHHHTTT
T ss_pred             eEECCCCCCccccCcChhhh
Confidence            34444444444444444333


No 166
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=43.87  E-value=18  Score=20.84  Aligned_cols=14  Identities=29%  Similarity=0.769  Sum_probs=7.4

Q ss_pred             CcccccccccccCC
Q psy11589        206 QKSICDVCGKEFRM  219 (262)
Q Consensus       206 ~~~~C~~C~~~f~~  219 (262)
                      +.+.|..||..|-.
T Consensus        17 rk~~Cr~Cg~~~C~   30 (57)
T cd00065          17 RRHHCRNCGRIFCS   30 (57)
T ss_pred             cccccCcCcCCcCh
Confidence            34556666655543


No 167
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=43.70  E-value=11  Score=29.39  Aligned_cols=73  Identities=16%  Similarity=0.368  Sum_probs=37.6

Q ss_pred             chhHHhHHhhhCCC-----CccccCcccccccCcchHHHHHhhcCC-CcccCCcchhcCCCChHHHHHHHhhcCCCCccc
Q psy11589        136 ITNMKVHMRIHTGE-----KKYVCETCGASFALWGSLNVHSYSHTN-TQFVCSYCGNTYKNPKALTSHIRNSHTIHQKSI  209 (262)
Q Consensus       136 ~~~l~~H~~~h~~~-----~~~~C~~C~~~f~~~~~l~~H~~~h~~-~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~  209 (262)
                      ..+|+.....+.+.     ..|.|..|+...  +.      +.-.. ..-+|..|.+.|.-...  .    .--|...|.
T Consensus        92 e~Nlrm~d~a~~~~ip~~drqFaC~~Cd~~W--wR------rvp~rKeVSRCr~C~~rYDPVP~--d----kmwG~aef~  157 (278)
T PF15135_consen   92 EENLRMFDDAQENLIPSVDRQFACSSCDHMW--WR------RVPQRKEVSRCRKCRKRYDPVPC--D----KMWGIAEFH  157 (278)
T ss_pred             HHHHHHhhhhhhccccccceeeeccccchHH--Hh------ccCcccccccccccccccCCCcc--c----cccceeeee
Confidence            44555554444333     557788886432  10      11111 34567777776543321  0    011334588


Q ss_pred             ccccccccCChHH
Q psy11589        210 CDVCGKEFRMKRQ  222 (262)
Q Consensus       210 C~~C~~~f~~~~~  222 (262)
                      |+.|+..|.....
T Consensus       158 C~~C~h~F~G~~q  170 (278)
T PF15135_consen  158 CPKCRHNFRGFAQ  170 (278)
T ss_pred             cccccccchhhhh
Confidence            8888888886543


No 168
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=43.70  E-value=16  Score=25.60  Aligned_cols=20  Identities=45%  Similarity=0.806  Sum_probs=10.2

Q ss_pred             cccccccccCChHHHHHHHHhhC
Q psy11589        209 ICDVCGKEFRMKRQLKEHMAVHT  231 (262)
Q Consensus       209 ~C~~C~~~f~~~~~l~~H~~~h~  231 (262)
                      .|-++|+.|.   .|++|+.+|.
T Consensus        78 icLEDGkkfK---SLKRHL~t~~   97 (148)
T COG4957          78 ICLEDGKKFK---SLKRHLTTHY   97 (148)
T ss_pred             EEeccCcchH---HHHHHHhccc
Confidence            4555555553   3455555543


No 169
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=43.53  E-value=21  Score=20.77  Aligned_cols=15  Identities=27%  Similarity=0.463  Sum_probs=8.4

Q ss_pred             CCCcccccccccccC
Q psy11589        204 IHQKSICDVCGKEFR  218 (262)
Q Consensus       204 ~~~~~~C~~C~~~f~  218 (262)
                      +...|.|+.||..+-
T Consensus        11 ~~v~~~Cp~cGipth   25 (55)
T PF13824_consen   11 AHVNFECPDCGIPTH   25 (55)
T ss_pred             cccCCcCCCCCCcCc
Confidence            344566666666543


No 170
>KOG3408|consensus
Probab=43.41  E-value=13  Score=25.42  Aligned_cols=24  Identities=33%  Similarity=0.625  Sum_probs=21.8

Q ss_pred             CCccCCCCCcccCChHHHHHHHHh
Q psy11589        234 RPFVCNMCPSTFKLKKHLRQHYKV  257 (262)
Q Consensus       234 ~~~~C~~C~~~f~~~~~L~~H~~~  257 (262)
                      ..|-|-.|.+-|.+...|..|.++
T Consensus        56 GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   56 GQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             ceeehhhhhhhhcchHHHHHHHhc
Confidence            449999999999999999999876


No 171
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=43.36  E-value=18  Score=31.36  Aligned_cols=26  Identities=23%  Similarity=0.551  Sum_probs=16.2

Q ss_pred             eecCcchhhccChhHHHHHHHHhhcC
Q psy11589         95 YCCHICKKVFLRNRNLVCHIKAVHEN  120 (262)
Q Consensus        95 ~~C~~C~~~f~~~~~l~~H~~~~h~~  120 (262)
                      +.|+.|++.|.+...+..|+...|.+
T Consensus        58 WiCp~CskkF~d~~~~~~H~~~eH~~   83 (466)
T PF04780_consen   58 WICPRCSKKFSDAESCLSHMEQEHPA   83 (466)
T ss_pred             eeCCcccceeCCHHHHHHHHHHhhhh
Confidence            55666666666666666666655543


No 172
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=42.85  E-value=11  Score=25.81  Aligned_cols=10  Identities=20%  Similarity=0.401  Sum_probs=4.7

Q ss_pred             ccCCcchhcC
Q psy11589        179 FVCSYCGNTY  188 (262)
Q Consensus       179 ~~C~~C~~~f  188 (262)
                      ..|..|+..|
T Consensus        71 ~~C~~Cg~~~   80 (113)
T PRK12380         71 AWCWDCSQVV   80 (113)
T ss_pred             EEcccCCCEE
Confidence            4455555443


No 173
>PF03833 PolC_DP2:  DNA polymerase II large subunit DP2;  InterPro: IPR016033 DP2 is the large subunit of a two-subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus. The structure of DP2 appears to be organised as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit. This entry represents the N-terminal ~950 residue component of DP2.; GO: 0003887 DNA-directed DNA polymerase activity; PDB: 3O59_X.
Probab=42.55  E-value=8.2  Score=35.79  Aligned_cols=10  Identities=40%  Similarity=0.959  Sum_probs=0.0

Q ss_pred             cccccccccc
Q psy11589        208 SICDVCGKEF  217 (262)
Q Consensus       208 ~~C~~C~~~f  217 (262)
                      |.|+.|+...
T Consensus       681 ~~Cp~C~~~~  690 (900)
T PF03833_consen  681 YVCPDCGIEV  690 (900)
T ss_dssp             ----------
T ss_pred             eecccccccc
Confidence            5566665443


No 174
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=41.92  E-value=10  Score=26.02  Aligned_cols=11  Identities=18%  Similarity=0.543  Sum_probs=5.1

Q ss_pred             ccCCcchhcCC
Q psy11589        179 FVCSYCGNTYK  189 (262)
Q Consensus       179 ~~C~~C~~~f~  189 (262)
                      ..|..|+..|.
T Consensus        71 ~~C~~Cg~~~~   81 (115)
T TIGR00100        71 CECEDCSEEVS   81 (115)
T ss_pred             EEcccCCCEEe
Confidence            34555554433


No 175
>PRK10220 hypothetical protein; Provisional
Probab=41.76  E-value=15  Score=24.68  Aligned_cols=15  Identities=13%  Similarity=0.795  Sum_probs=8.5

Q ss_pred             CcccCCcchhcCCCC
Q psy11589        177 TQFVCSYCGNTYKNP  191 (262)
Q Consensus       177 ~~~~C~~C~~~f~~~  191 (262)
                      ..|.|+.|+..+...
T Consensus        19 ~~~vCpeC~hEW~~~   33 (111)
T PRK10220         19 GMYICPECAHEWNDA   33 (111)
T ss_pred             CeEECCcccCcCCcc
Confidence            346666666655544


No 176
>PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=41.28  E-value=3.8  Score=25.37  Aligned_cols=9  Identities=22%  Similarity=0.892  Sum_probs=2.9

Q ss_pred             cccCccccc
Q psy11589        152 YVCETCGAS  160 (262)
Q Consensus       152 ~~C~~C~~~  160 (262)
                      ..|..|+..
T Consensus        42 v~Cg~C~~~   50 (71)
T PF05495_consen   42 VICGKCRTE   50 (71)
T ss_dssp             EEETTT--E
T ss_pred             eECCCCCCc
Confidence            344444433


No 177
>KOG4377|consensus
Probab=41.06  E-value=13  Score=31.39  Aligned_cols=19  Identities=21%  Similarity=0.363  Sum_probs=13.9

Q ss_pred             cccccCChHHHHHHHHhhC
Q psy11589        213 CGKEFRMKRQLKEHMAVHT  231 (262)
Q Consensus       213 C~~~f~~~~~l~~H~~~h~  231 (262)
                      |+..+.+.+.+..|.+.|.
T Consensus       409 c~~tl~s~sqm~shkrkhe  427 (480)
T KOG4377|consen  409 CEATLYSVSQMASHKRKHE  427 (480)
T ss_pred             CceEEEehhhhhhhhhhhh
Confidence            7777777777777776663


No 178
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=40.25  E-value=6.7  Score=25.45  Aligned_cols=10  Identities=30%  Similarity=1.182  Sum_probs=4.1

Q ss_pred             ccCCcchhcC
Q psy11589        179 FVCSYCGNTY  188 (262)
Q Consensus       179 ~~C~~C~~~f  188 (262)
                      |.|..|++.|
T Consensus        54 W~C~~C~~~~   63 (90)
T PF01780_consen   54 WKCKKCGKKF   63 (90)
T ss_dssp             EEETTTTEEE
T ss_pred             eecCCCCCEE
Confidence            4444444433


No 179
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=40.20  E-value=18  Score=23.09  Aligned_cols=13  Identities=23%  Similarity=0.728  Sum_probs=5.9

Q ss_pred             eeecCcchhhccC
Q psy11589         94 EYCCHICKKVFLR  106 (262)
Q Consensus        94 ~~~C~~C~~~f~~  106 (262)
                      ...|..|+..|..
T Consensus        46 ~~~C~~Cg~~~~~   58 (81)
T PF05129_consen   46 ILSCRVCGESFQT   58 (81)
T ss_dssp             EEEESSS--EEEE
T ss_pred             EEEecCCCCeEEE
Confidence            3556666655543


No 180
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=39.96  E-value=12  Score=18.38  Aligned_cols=18  Identities=39%  Similarity=0.759  Sum_probs=8.9

Q ss_pred             eecCCCcccccchhHHHhh
Q psy11589         67 YKCPDCSVIVVSYSGFKSH   85 (262)
Q Consensus        67 ~~C~~C~~~f~~~~~l~~H   85 (262)
                      |.|-.|++.| +......|
T Consensus         1 ~sCiDC~~~F-~~~~y~~H   18 (28)
T PF08790_consen    1 FSCIDCSKDF-DGDSYKSH   18 (28)
T ss_dssp             EEETTTTEEE-EGGGTTT-
T ss_pred             CeeecCCCCc-CcCCcCCC
Confidence            3566666666 33333444


No 181
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=39.56  E-value=23  Score=25.43  Aligned_cols=11  Identities=36%  Similarity=1.099  Sum_probs=9.6

Q ss_pred             ceecCCCcccc
Q psy11589         66 SYKCPDCSVIV   76 (262)
Q Consensus        66 ~~~C~~C~~~f   76 (262)
                      -+.|+.|++.|
T Consensus       124 f~~C~~C~kiy  134 (147)
T PF01927_consen  124 FWRCPGCGKIY  134 (147)
T ss_pred             EEECCCCCCEe
Confidence            57899999987


No 182
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=39.34  E-value=13  Score=22.49  Aligned_cols=9  Identities=33%  Similarity=1.158  Sum_probs=2.4

Q ss_pred             cCCcchhcC
Q psy11589        180 VCSYCGNTY  188 (262)
Q Consensus       180 ~C~~C~~~f  188 (262)
                      .|..|++.|
T Consensus        11 ~C~~C~~~F   19 (69)
T PF01363_consen   11 NCMICGKKF   19 (69)
T ss_dssp             B-TTT--B-
T ss_pred             cCcCcCCcC
Confidence            344455544


No 183
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=39.30  E-value=20  Score=20.70  Aligned_cols=11  Identities=36%  Similarity=0.978  Sum_probs=5.0

Q ss_pred             ccccccccccC
Q psy11589        208 SICDVCGKEFR  218 (262)
Q Consensus       208 ~~C~~C~~~f~  218 (262)
                      ++|+.||..+.
T Consensus        29 W~C~~Cgh~w~   39 (55)
T PF14311_consen   29 WKCPKCGHEWK   39 (55)
T ss_pred             EECCCCCCeeE
Confidence            44444444443


No 184
>KOG4124|consensus
Probab=38.95  E-value=5.1  Score=32.81  Aligned_cols=26  Identities=31%  Similarity=0.699  Sum_probs=19.4

Q ss_pred             CcccCCc--chhcCCCChHHHHHHHhhc
Q psy11589        177 TQFVCSY--CGNTYKNPKALTSHIRNSH  202 (262)
Q Consensus       177 ~~~~C~~--C~~~f~~~~~l~~H~~~~H  202 (262)
                      ++|.|++  |.+.+....+|..|....|
T Consensus       348 ~~~~~~vp~~~~~~~n~ng~~~~~~~~h  375 (442)
T KOG4124|consen  348 KPYKCPVPNCDKAYKNQNGLKYHKLHGH  375 (442)
T ss_pred             CCCCCCCCcchhhcccCcceeeccccCc
Confidence            5677865  9999988888888865434


No 185
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=38.82  E-value=7.7  Score=29.88  Aligned_cols=9  Identities=33%  Similarity=0.792  Sum_probs=6.7

Q ss_pred             ccCCcchhc
Q psy11589        179 FVCSYCGNT  187 (262)
Q Consensus       179 ~~C~~C~~~  187 (262)
                      +.||.|.++
T Consensus        63 vvCP~C~yA   71 (267)
T COG1655          63 VVCPICYYA   71 (267)
T ss_pred             EEcchhhHH
Confidence            578888864


No 186
>KOG1842|consensus
Probab=38.72  E-value=18  Score=30.92  Aligned_cols=29  Identities=28%  Similarity=0.454  Sum_probs=19.7

Q ss_pred             CcccCCcchhcCCCChHHHHHHHhhcCCC
Q psy11589        177 TQFVCSYCGNTYKNPKALTSHIRNSHTIH  205 (262)
Q Consensus       177 ~~~~C~~C~~~f~~~~~l~~H~~~~H~~~  205 (262)
                      ..|.||+|...|.+...|..|....|.++
T Consensus        14 egflCPiC~~dl~~~~~L~~H~d~eH~~e   42 (505)
T KOG1842|consen   14 EGFLCPICLLDLPNLSALNDHLDVEHFEE   42 (505)
T ss_pred             hcccCchHhhhhhhHHHHHHHHhhhcccc
Confidence            35677777777777777777776556443


No 187
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=37.96  E-value=10  Score=24.63  Aligned_cols=10  Identities=30%  Similarity=0.727  Sum_probs=4.2

Q ss_pred             ccCCcchhcC
Q psy11589        179 FVCSYCGNTY  188 (262)
Q Consensus       179 ~~C~~C~~~f  188 (262)
                      |.|..|++.|
T Consensus        55 W~C~~C~~~~   64 (90)
T PTZ00255         55 WRCKGCKKTV   64 (90)
T ss_pred             EEcCCCCCEE
Confidence            4444444433


No 188
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=37.91  E-value=20  Score=19.47  Aligned_cols=16  Identities=38%  Similarity=1.043  Sum_probs=11.1

Q ss_pred             cccccccccCChHHHH
Q psy11589        209 ICDVCGKEFRMKRQLK  224 (262)
Q Consensus       209 ~C~~C~~~f~~~~~l~  224 (262)
                      .|++||+.|+......
T Consensus        10 ~C~~C~rpf~WRKKW~   25 (42)
T PF10013_consen   10 ICPVCGRPFTWRKKWA   25 (42)
T ss_pred             cCcccCCcchHHHHHH
Confidence            5788888887765543


No 189
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=37.48  E-value=7.9  Score=35.15  Aligned_cols=13  Identities=38%  Similarity=1.221  Sum_probs=6.2

Q ss_pred             CCcchhcCCCChH
Q psy11589        181 CSYCGNTYKNPKA  193 (262)
Q Consensus       181 C~~C~~~f~~~~~  193 (262)
                      |+.|.+.+.+..+
T Consensus       154 C~~C~~EY~dP~n  166 (750)
T COG0068         154 CPFCDKEYKDPLN  166 (750)
T ss_pred             CHHHHHHhcCccc
Confidence            5555554444433


No 190
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=37.27  E-value=39  Score=18.07  Aligned_cols=16  Identities=25%  Similarity=0.524  Sum_probs=7.9

Q ss_pred             eecCCCcccccchhHH
Q psy11589         67 YKCPDCSVIVVSYSGF   82 (262)
Q Consensus        67 ~~C~~C~~~f~~~~~l   82 (262)
                      ..|+.|+-.+-+...|
T Consensus        20 d~C~~C~G~W~d~~el   35 (41)
T PF13453_consen   20 DVCPSCGGIWFDAGEL   35 (41)
T ss_pred             EECCCCCeEEccHHHH
Confidence            4455555555444444


No 191
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=37.21  E-value=14  Score=25.47  Aligned_cols=10  Identities=30%  Similarity=0.730  Sum_probs=4.5

Q ss_pred             cccccccccc
Q psy11589        208 SICDVCGKEF  217 (262)
Q Consensus       208 ~~C~~C~~~f  217 (262)
                      +.|..||..|
T Consensus        72 ~~C~~Cg~~~   81 (117)
T PRK00564         72 LECKDCSHVF   81 (117)
T ss_pred             EEhhhCCCcc
Confidence            4444444443


No 192
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=37.05  E-value=10  Score=20.72  Aligned_cols=12  Identities=42%  Similarity=1.099  Sum_probs=6.5

Q ss_pred             CccCCCCCcccC
Q psy11589        235 PFVCNMCPSTFK  246 (262)
Q Consensus       235 ~~~C~~C~~~f~  246 (262)
                      |+.|+.|+..|=
T Consensus        13 ~~~C~~C~~~FC   24 (43)
T PF01428_consen   13 PFKCKHCGKSFC   24 (43)
T ss_dssp             HEE-TTTS-EE-
T ss_pred             CeECCCCCcccC
Confidence            577777777664


No 193
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=36.38  E-value=31  Score=23.19  Aligned_cols=12  Identities=17%  Similarity=0.404  Sum_probs=5.4

Q ss_pred             Cccccccccccc
Q psy11589        206 QKSICDVCGKEF  217 (262)
Q Consensus       206 ~~~~C~~C~~~f  217 (262)
                      .|..|+.||++|
T Consensus        25 dPiVsPytG~s~   36 (129)
T COG4530          25 DPIVSPYTGKSY   36 (129)
T ss_pred             CccccCcccccc
Confidence            344444444444


No 194
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=36.03  E-value=30  Score=18.34  Aligned_cols=21  Identities=19%  Similarity=0.450  Sum_probs=8.1

Q ss_pred             CccCCCCCcccC-Ch-HHHHHHH
Q psy11589        235 PFVCNMCPSTFK-LK-KHLRQHY  255 (262)
Q Consensus       235 ~~~C~~C~~~f~-~~-~~L~~H~  255 (262)
                      .|-|++|+..++ +. +.-+.|.
T Consensus         3 ryyCdyC~~~~~~d~~~~Rk~H~   25 (38)
T PF06220_consen    3 RYYCDYCKKYLTHDSPSIRKQHE   25 (38)
T ss_dssp             S-B-TTT--B-S--SHHHHHHHT
T ss_pred             CeecccccceecCCChHHHHHhh
Confidence            467888887773 32 2335554


No 196
>PF07800 DUF1644:  Protein of unknown function (DUF1644);  InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function. The region of interest contains nine highly conserved cysteine residues and is approximately 160 amino acids in length, which probably represent a zinc-binding domain. 
Probab=35.61  E-value=1.2e+02  Score=22.11  Aligned_cols=17  Identities=24%  Similarity=0.321  Sum_probs=9.0

Q ss_pred             ChHHHHHHHhhcCCCCc
Q psy11589        191 PKALTSHIRNSHTIHQK  207 (262)
Q Consensus       191 ~~~l~~H~~~~H~~~~~  207 (262)
                      -..|..|.+..|...+|
T Consensus       121 Y~eLrKHar~~HP~~rP  137 (162)
T PF07800_consen  121 YSELRKHARSEHPSARP  137 (162)
T ss_pred             HHHHHHHHHhhCCCCCC
Confidence            34555555555555444


No 197
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=35.60  E-value=47  Score=17.92  Aligned_cols=24  Identities=17%  Similarity=0.209  Sum_probs=17.0

Q ss_pred             ceecccCCCCCceee--ehHHHHHHHhhhc
Q psy11589          9 DFVCNLCPPGSKVVV--KYVHYLERHVRKH   36 (262)
Q Consensus         9 ~~~C~~C~~~~~~~~--~~~~~l~~H~~~~   36 (262)
                      .-.|+.||.    .|  ...+.-..|.+-|
T Consensus        13 ~~~C~~CgM----~Y~~~~~eD~~~H~~yH   38 (41)
T PF13878_consen   13 ATTCPTCGM----LYSPGSPEDEKLHKKYH   38 (41)
T ss_pred             CcCCCCCCC----EECCCCHHHHHHHHHHH
Confidence            468999999    66  4456667776654


No 198
>KOG1842|consensus
Probab=35.42  E-value=23  Score=30.23  Aligned_cols=26  Identities=27%  Similarity=0.673  Sum_probs=19.7

Q ss_pred             ceecCCCcccccchhHHHhhhhhcCC
Q psy11589         66 SYKCPDCSVIVVSYSGFKSHLDIHNV   91 (262)
Q Consensus        66 ~~~C~~C~~~f~~~~~l~~H~~~h~~   91 (262)
                      .|.|++|...|.+...|..|+...+.
T Consensus        15 gflCPiC~~dl~~~~~L~~H~d~eH~   40 (505)
T KOG1842|consen   15 GFLCPICLLDLPNLSALNDHLDVEHF   40 (505)
T ss_pred             cccCchHhhhhhhHHHHHHHHhhhcc
Confidence            47788888888888888888776443


No 199
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=35.34  E-value=10  Score=24.64  Aligned_cols=11  Identities=27%  Similarity=1.026  Sum_probs=4.8

Q ss_pred             cccCCcchhcC
Q psy11589        178 QFVCSYCGNTY  188 (262)
Q Consensus       178 ~~~C~~C~~~f  188 (262)
                      .|.|..|++.|
T Consensus        53 IW~C~~C~~~~   63 (91)
T TIGR00280        53 IWTCRKCGAKF   63 (91)
T ss_pred             EEEcCCCCCEE
Confidence            34444444443


No 200
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=34.91  E-value=24  Score=30.14  Aligned_cols=14  Identities=29%  Similarity=0.551  Sum_probs=7.9

Q ss_pred             cccccccccccCCh
Q psy11589        207 KSICDVCGKEFRMK  220 (262)
Q Consensus       207 ~~~C~~C~~~f~~~  220 (262)
                      -|+|+.||..+...
T Consensus       367 g~rC~kCg~~~~~~  380 (421)
T COG1571         367 GFRCKKCGTRARET  380 (421)
T ss_pred             CcccccccccCCcc
Confidence            45666666555544


No 201
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=34.40  E-value=12  Score=24.78  Aligned_cols=8  Identities=38%  Similarity=1.186  Sum_probs=3.3

Q ss_pred             ccCccccc
Q psy11589        124 HQCSVCGK  131 (262)
Q Consensus       124 ~~C~~C~~  131 (262)
                      |.|+.|+.
T Consensus        23 FtCp~Cgh   30 (104)
T COG4888          23 FTCPRCGH   30 (104)
T ss_pred             EecCccCC
Confidence            44444443


No 202
>PRK14873 primosome assembly protein PriA; Provisional
Probab=33.92  E-value=27  Score=32.10  Aligned_cols=14  Identities=21%  Similarity=0.589  Sum_probs=8.3

Q ss_pred             cCCCCccccccccc
Q psy11589        202 HTIHQKSICDVCGK  215 (262)
Q Consensus       202 H~~~~~~~C~~C~~  215 (262)
                      |.......|..||.
T Consensus       405 h~~~~~l~Ch~CG~  418 (665)
T PRK14873        405 PSAGGTPRCRWCGR  418 (665)
T ss_pred             ecCCCeeECCCCcC
Confidence            44445567777773


No 203
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=33.77  E-value=12  Score=20.15  Aligned_cols=9  Identities=33%  Similarity=0.958  Sum_probs=4.2

Q ss_pred             eecCcchhh
Q psy11589         95 YCCHICKKV  103 (262)
Q Consensus        95 ~~C~~C~~~  103 (262)
                      |.|..|+..
T Consensus        29 y~C~~C~~~   37 (40)
T smart00440       29 YVCTKCGHR   37 (40)
T ss_pred             EEeCCCCCE
Confidence            445545443


No 204
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=33.39  E-value=15  Score=25.15  Aligned_cols=12  Identities=42%  Similarity=0.952  Sum_probs=5.8

Q ss_pred             ccccccccccCC
Q psy11589        208 SICDVCGKEFRM  219 (262)
Q Consensus       208 ~~C~~C~~~f~~  219 (262)
                      ..|..||..|.-
T Consensus        71 ~~C~~Cg~~~~~   82 (113)
T PF01155_consen   71 ARCRDCGHEFEP   82 (113)
T ss_dssp             EEETTTS-EEEC
T ss_pred             EECCCCCCEEec
Confidence            455555555543


No 205
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=33.07  E-value=18  Score=21.19  Aligned_cols=9  Identities=33%  Similarity=0.534  Sum_probs=4.2

Q ss_pred             ecCCCcccc
Q psy11589         68 KCPDCSVIV   76 (262)
Q Consensus        68 ~C~~C~~~f   76 (262)
                      +|.+|++.+
T Consensus         4 kC~lCdk~~   12 (56)
T PF09963_consen    4 KCILCDKKE   12 (56)
T ss_pred             EEEecCCEE
Confidence            344555443


No 206
>KOG0717|consensus
Probab=32.95  E-value=24  Score=30.44  Aligned_cols=22  Identities=32%  Similarity=0.730  Sum_probs=18.5

Q ss_pred             ccCCCCCcccCChHHHHHHHHh
Q psy11589        236 FVCNMCPSTFKLKKHLRQHYKV  257 (262)
Q Consensus       236 ~~C~~C~~~f~~~~~L~~H~~~  257 (262)
                      +-|.+|+++|.+...|.+|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            7789999999998888888754


No 207
>KOG2907|consensus
Probab=32.50  E-value=32  Score=23.31  Aligned_cols=11  Identities=45%  Similarity=0.975  Sum_probs=5.7

Q ss_pred             eecCcchhhcc
Q psy11589         95 YCCHICKKVFL  105 (262)
Q Consensus        95 ~~C~~C~~~f~  105 (262)
                      |.|+.|++.|.
T Consensus       103 YTC~kC~~k~~  113 (116)
T KOG2907|consen  103 YTCPKCKYKFT  113 (116)
T ss_pred             EEcCccceeee
Confidence            55555555443


No 208
>PRK05580 primosome assembly protein PriA; Validated
Probab=31.91  E-value=35  Score=31.57  Aligned_cols=11  Identities=27%  Similarity=0.812  Sum_probs=5.4

Q ss_pred             CCccccccccc
Q psy11589        205 HQKSICDVCGK  215 (262)
Q Consensus       205 ~~~~~C~~C~~  215 (262)
                      .....|..||.
T Consensus       406 ~~~l~Ch~Cg~  416 (679)
T PRK05580        406 QRRLRCHHCGY  416 (679)
T ss_pred             CCeEECCCCcC
Confidence            34445555553


No 209
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=31.69  E-value=15  Score=33.55  Aligned_cols=13  Identities=31%  Similarity=0.721  Sum_probs=6.5

Q ss_pred             cCcchhhccChhH
Q psy11589         97 CHICKKVFLRNRN  109 (262)
Q Consensus        97 C~~C~~~f~~~~~  109 (262)
                      |+.|.+.+.+..+
T Consensus       154 C~~C~~EY~dP~n  166 (750)
T COG0068         154 CPFCDKEYKDPLN  166 (750)
T ss_pred             CHHHHHHhcCccc
Confidence            5555555554444


No 210
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=31.47  E-value=17  Score=20.92  Aligned_cols=12  Identities=17%  Similarity=0.670  Sum_probs=6.4

Q ss_pred             cCCCCCcccCCh
Q psy11589        237 VCNMCPSTFKLK  248 (262)
Q Consensus       237 ~C~~C~~~f~~~  248 (262)
                      .||+|++.|...
T Consensus        22 ~CPlC~r~l~~e   33 (54)
T PF04423_consen   22 CCPLCGRPLDEE   33 (54)
T ss_dssp             E-TTT--EE-HH
T ss_pred             cCCCCCCCCCHH
Confidence            899999988754


No 211
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=31.38  E-value=14  Score=25.26  Aligned_cols=9  Identities=22%  Similarity=0.582  Sum_probs=4.4

Q ss_pred             ccCCcchhc
Q psy11589        179 FVCSYCGNT  187 (262)
Q Consensus       179 ~~C~~C~~~  187 (262)
                      ..|..|+..
T Consensus        71 ~~C~~Cg~~   79 (114)
T PRK03681         71 CWCETCQQY   79 (114)
T ss_pred             EEcccCCCe
Confidence            445555543


No 212
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=31.32  E-value=6.1  Score=21.12  Aligned_cols=8  Identities=38%  Similarity=1.090  Sum_probs=3.7

Q ss_pred             eecCcchh
Q psy11589         95 YCCHICKK  102 (262)
Q Consensus        95 ~~C~~C~~  102 (262)
                      |.|..|+.
T Consensus        29 y~C~~C~~   36 (39)
T PF01096_consen   29 YVCCNCGH   36 (39)
T ss_dssp             EEESSSTE
T ss_pred             EEeCCCCC
Confidence            44444443


No 213
>KOG0717|consensus
Probab=31.18  E-value=21  Score=30.68  Aligned_cols=22  Identities=32%  Similarity=0.472  Sum_probs=19.7

Q ss_pred             cccCcccccccCcchHHHHHhh
Q psy11589        152 YVCETCGASFALWGSLNVHSYS  173 (262)
Q Consensus       152 ~~C~~C~~~f~~~~~l~~H~~~  173 (262)
                      +.|.+|+++|.+...|..|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            7899999999999999999654


No 214
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=30.63  E-value=29  Score=20.56  Aligned_cols=41  Identities=12%  Similarity=0.351  Sum_probs=22.4

Q ss_pred             ccCCcchhc-CCCChHHHHHHHhhcCCCCcccccccccccCCh
Q psy11589        179 FVCSYCGNT-YKNPKALTSHIRNSHTIHQKSICDVCGKEFRMK  220 (262)
Q Consensus       179 ~~C~~C~~~-f~~~~~l~~H~~~~H~~~~~~~C~~C~~~f~~~  220 (262)
                      .+|.+|++. +.+...+..-.. ....-+.|.|++|.-....+
T Consensus         3 vkCiiCd~v~~iD~rt~~tKrL-rN~PIrtymC~eC~~Rva~k   44 (68)
T COG4896           3 VKCIICDRVDEIDNRTFKTKRL-RNKPIRTYMCPECEHRVAIK   44 (68)
T ss_pred             ceEEEecceeeecchhHHHHHh-hCCCceeEechhhHhhhchh
Confidence            356677653 444444444332 23445567888887655444


No 215
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=29.44  E-value=22  Score=17.49  Aligned_cols=6  Identities=33%  Similarity=0.960  Sum_probs=2.0

Q ss_pred             cccccc
Q psy11589        208 SICDVC  213 (262)
Q Consensus       208 ~~C~~C  213 (262)
                      |.|.+|
T Consensus        16 Y~C~~C   21 (30)
T PF07649_consen   16 YRCSEC   21 (30)
T ss_dssp             EE-TTT
T ss_pred             EECccC
Confidence            334333


No 216
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=29.20  E-value=14  Score=23.95  Aligned_cols=11  Identities=27%  Similarity=0.969  Sum_probs=4.8

Q ss_pred             cccCCcchhcC
Q psy11589        178 QFVCSYCGNTY  188 (262)
Q Consensus       178 ~~~C~~C~~~f  188 (262)
                      .|.|..|++.|
T Consensus        54 IW~C~~C~~~~   64 (90)
T PRK03976         54 IWECRKCGAKF   64 (90)
T ss_pred             EEEcCCCCCEE
Confidence            34444444443


No 217
>PRK05978 hypothetical protein; Provisional
Probab=28.61  E-value=20  Score=25.77  Aligned_cols=10  Identities=40%  Similarity=1.262  Sum_probs=5.2

Q ss_pred             cccccccccC
Q psy11589        209 ICDVCGKEFR  218 (262)
Q Consensus       209 ~C~~C~~~f~  218 (262)
                      .|+.||..|.
T Consensus        54 ~C~~CG~~~~   63 (148)
T PRK05978         54 HCAACGEDFT   63 (148)
T ss_pred             CccccCCccc
Confidence            3555555543


No 218
>PRK04351 hypothetical protein; Provisional
Probab=28.18  E-value=24  Score=25.50  Aligned_cols=11  Identities=18%  Similarity=0.803  Sum_probs=5.3

Q ss_pred             CCccCCCCCcc
Q psy11589        234 RPFVCNMCPST  244 (262)
Q Consensus       234 ~~~~C~~C~~~  244 (262)
                      ..|.|..|+-.
T Consensus       131 ~~yrCg~C~g~  141 (149)
T PRK04351        131 KRYRCGKCRGK  141 (149)
T ss_pred             CcEEeCCCCcE
Confidence            33555555433


No 219
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=27.85  E-value=15  Score=26.47  Aligned_cols=10  Identities=40%  Similarity=1.305  Sum_probs=4.7

Q ss_pred             ccCCcchhcC
Q psy11589        179 FVCSYCGNTY  188 (262)
Q Consensus       179 ~~C~~C~~~f  188 (262)
                      |.|+.|+..+
T Consensus       124 ~~C~~C~~~~  133 (157)
T PF10263_consen  124 YRCPSCGREY  133 (157)
T ss_pred             EEcCCCCCEe
Confidence            4454454443


No 220
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=27.85  E-value=6.5  Score=31.90  Aligned_cols=55  Identities=24%  Similarity=0.704  Sum_probs=19.3

Q ss_pred             CCCccccCcccccccCcchHHHHHhhcCCCcccCCcchhcCCCChHHHHHHHhhcCCCCccccccccccc
Q psy11589        148 GEKKYVCETCGASFALWGSLNVHSYSHTNTQFVCSYCGNTYKNPKALTSHIRNSHTIHQKSICDVCGKEF  217 (262)
Q Consensus       148 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~C~~C~~~f  217 (262)
                      |.+-..|+.|+-....             ....|+.||..-...-.+.. .. .-.+.+-+.|..|+..+
T Consensus       194 G~R~L~Cs~C~t~W~~-------------~R~~Cp~Cg~~~~~~l~~~~-~e-~~~~~rve~C~~C~~Yl  248 (290)
T PF04216_consen  194 GKRYLHCSLCGTEWRF-------------VRIKCPYCGNTDHEKLEYFT-VE-GEPAYRVEVCESCGSYL  248 (290)
T ss_dssp             -EEEEEETTT--EEE---------------TTS-TTT---SS-EEE----------SEEEEEETTTTEEE
T ss_pred             ccEEEEcCCCCCeeee-------------cCCCCcCCCCCCCcceeeEe-cC-CCCcEEEEECCcccchH
Confidence            4444566666644422             23467777765433322211 00 12234456666666543


No 221
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=27.63  E-value=29  Score=23.15  Aligned_cols=23  Identities=26%  Similarity=0.515  Sum_probs=16.0

Q ss_pred             CcccccccccccCChHHHHHHHH
Q psy11589        206 QKSICDVCGKEFRMKRQLKEHMA  228 (262)
Q Consensus       206 ~~~~C~~C~~~f~~~~~l~~H~~  228 (262)
                      ..+-|-.|.+.|.+...|..|.+
T Consensus        54 GqhYCieCaryf~t~~aL~~Hkk   76 (126)
T COG5112          54 GQHYCIECARYFITEKALMEHKK   76 (126)
T ss_pred             ceeeeehhHHHHHHHHHHHHHhc
Confidence            44667777777777777777754


No 222
>COG1773 Rubredoxin [Energy production and conversion]
Probab=25.90  E-value=39  Score=19.68  Aligned_cols=13  Identities=23%  Similarity=0.646  Sum_probs=10.5

Q ss_pred             CceecccCCCCCceeee
Q psy11589          8 SDFVCNLCPPGSKVVVK   24 (262)
Q Consensus         8 ~~~~C~~C~~~~~~~~~   24 (262)
                      +.|+|..||.    +|.
T Consensus         2 ~~~~C~~CG~----vYd   14 (55)
T COG1773           2 KRWRCSVCGY----VYD   14 (55)
T ss_pred             CceEecCCce----Eec
Confidence            3689999998    775


No 223
>KOG2636|consensus
Probab=25.77  E-value=47  Score=28.55  Aligned_cols=28  Identities=18%  Similarity=0.616  Sum_probs=21.2

Q ss_pred             hcCCCCcccccccc-cccCChHHHHHHHH
Q psy11589        201 SHTIHQKSICDVCG-KEFRMKRQLKEHMA  228 (262)
Q Consensus       201 ~H~~~~~~~C~~C~-~~f~~~~~l~~H~~  228 (262)
                      .|.-...|.|.+|| +++..+..+.+|-.
T Consensus       395 LHGL~~ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  395 LHGLDIEYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             hcCCCcccceeeccCccccCcHHHHHHhH
Confidence            56667778888888 77777888888854


No 224
>KOG3507|consensus
Probab=25.43  E-value=53  Score=19.36  Aligned_cols=33  Identities=21%  Similarity=0.375  Sum_probs=19.5

Q ss_pred             ccceecCCCcccccchhHHHhhhhhcCCCCeeecCcchhhccCh
Q psy11589         64 KVSYKCPDCSVIVVSYSGFKSHLDIHNVEKEYCCHICKKVFLRN  107 (262)
Q Consensus        64 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~  107 (262)
                      ...|.|..|+..-.-           .....+.|..||...-.+
T Consensus        18 ~miYiCgdC~~en~l-----------k~~D~irCReCG~RIlyK   50 (62)
T KOG3507|consen   18 TMIYICGDCGQENTL-----------KRGDVIRCRECGYRILYK   50 (62)
T ss_pred             cEEEEeccccccccc-----------cCCCcEehhhcchHHHHH
Confidence            345888888874321           122457888888764443


No 225
>PLN02294 cytochrome c oxidase subunit Vb
Probab=25.32  E-value=35  Score=25.12  Aligned_cols=13  Identities=31%  Similarity=0.986  Sum_probs=6.6

Q ss_pred             CCccCCCCCcccC
Q psy11589        234 RPFVCNMCPSTFK  246 (262)
Q Consensus       234 ~~~~C~~C~~~f~  246 (262)
                      +|++|+.||..|.
T Consensus       140 kp~RCpeCG~~fk  152 (174)
T PLN02294        140 KSFECPVCTQYFE  152 (174)
T ss_pred             CceeCCCCCCEEE
Confidence            3555555555443


No 226
>PF03145 Sina:  Seven in absentia protein family;  InterPro: IPR018121 The seven in absentia (sina) gene was first identified in Drosophila. The Drosophila Sina protein is essential for the determination of the R7 pathway in photoreceptor cell development: the loss of functional Sina results in the transformation of the R7 precursor cell to a non-neuronal cell type. The Sina protein contains an N-terminal RING finger domain C3HC4-type. Through this domain, Sina binds E2 ubiquitin-conjugating enzymes (UbcD1) Sina also interacts with Tramtrack (TTK88) via PHYL. Tramtrack is a transcriptional repressor that blocks photoreceptor determination, while PHYL down-regulates the activity of TTK88. In turn, the activity of PHYL requires the activation of the Sevenless receptor tyrosine kinase, a process essential for R7 determination. It is thought that Sina targets TTK88 for degradation, therefore promoting the R7 pathway. Murine and human homologues of Sina have also been identified. The human homologue Siah-1 [] also binds E2 enzymes (UbcH5) and through a series of physical interactions, targets beta-catenin for ubiquitin degradation. Siah-1 expression is enhanced by p53, itself promoted by DNA damage. Thus this pathway links DNA damage to beta-catenin degradation [, ]. Sina proteins, therefore, physically interact with a variety of proteins. The N-terminal RING finger domain that binds ubiquitin conjugating enzymes is a C3HC4-type, and does not form part of the alignment for this family. The remainder C-terminal part is involved in interactions with other proteins, and is included in this alignment. In addition to the Drosophila protein and mammalian homologues, whose similarity was noted previously, this family also includes putative homologues from Caenorhabditis elegans, Arabidopsis thaliana.; GO: 0006511 ubiquitin-dependent protein catabolic process, 0007275 multicellular organismal development, 0005634 nucleus; PDB: 2A25_A 1K2F_B 2AN6_C.
Probab=25.31  E-value=58  Score=24.65  Aligned_cols=46  Identities=22%  Similarity=0.447  Sum_probs=22.2

Q ss_pred             ccccccCcchHHHHHhhcCCCcccCCc----chhcCCCChHHHHHHHhhcCC
Q psy11589        157 CGASFALWGSLNVHSYSHTNTQFVCSY----CGNTYKNPKALTSHIRNSHTI  204 (262)
Q Consensus       157 C~~~f~~~~~l~~H~~~h~~~~~~C~~----C~~~f~~~~~l~~H~~~~H~~  204 (262)
                      |...+ .......|.....-+|+.||.    |+..- ....|..|....|..
T Consensus        24 C~~~~-~~~~~~~HE~~C~~~p~~CP~~~~~C~~~G-~~~~l~~Hl~~~H~~   73 (198)
T PF03145_consen   24 CTETF-PYSEKREHEEECPFRPCSCPFPGSGCDWQG-SYKELLDHLRDKHSW   73 (198)
T ss_dssp             ---EE--GGGHHHHHHT-TTSEEE-SSSSTT---EE-ECCCHHHHHHHHTTT
T ss_pred             Ccccc-cccChhhHhccCCCcCCcCCCCCCCccccC-CHHHHHHHHHHHCCC
Confidence            55553 334566677666667777766    65443 334677777766653


No 227
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=25.19  E-value=35  Score=22.64  Aligned_cols=13  Identities=38%  Similarity=0.858  Sum_probs=7.4

Q ss_pred             CCccCCCCCcccC
Q psy11589        234 RPFVCNMCPSTFK  246 (262)
Q Consensus       234 ~~~~C~~C~~~f~  246 (262)
                      +|++|+.||..|.
T Consensus        78 ~~~rC~eCG~~fk   90 (97)
T cd00924          78 KPKRCPECGHVFK   90 (97)
T ss_pred             CceeCCCCCcEEE
Confidence            4566666665553


No 228
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=25.09  E-value=68  Score=16.46  Aligned_cols=21  Identities=14%  Similarity=0.355  Sum_probs=10.6

Q ss_pred             ccCCCCCcccCChHHHHHHHHh
Q psy11589        236 FVCNMCPSTFKLKKHLRQHYKV  257 (262)
Q Consensus       236 ~~C~~C~~~f~~~~~L~~H~~~  257 (262)
                      +.|+.|++.. ..+-+..|+..
T Consensus         5 ~~C~nC~R~v-~a~RfA~HLek   25 (33)
T PF08209_consen    5 VECPNCGRPV-AASRFAPHLEK   25 (33)
T ss_dssp             EE-TTTSSEE-EGGGHHHHHHH
T ss_pred             EECCCCcCCc-chhhhHHHHHH
Confidence            4566666653 34445555543


No 229
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=24.53  E-value=1e+02  Score=23.00  Aligned_cols=13  Identities=15%  Similarity=0.588  Sum_probs=6.0

Q ss_pred             CcccccccccccC
Q psy11589        206 QKSICDVCGKEFR  218 (262)
Q Consensus       206 ~~~~C~~C~~~f~  218 (262)
                      .-|.|+.|...|+
T Consensus       112 ~~y~C~~~~~r~s  124 (176)
T COG1675         112 NYYVCPNCHVKYS  124 (176)
T ss_pred             CceeCCCCCCccc
Confidence            3355555444444


No 230
>PTZ00448 hypothetical protein; Provisional
Probab=24.27  E-value=57  Score=27.36  Aligned_cols=23  Identities=22%  Similarity=0.590  Sum_probs=17.7

Q ss_pred             CccCCCCCcccCChHHHHHHHHh
Q psy11589        235 PFVCNMCPSTFKLKKHLRQHYKV  257 (262)
Q Consensus       235 ~~~C~~C~~~f~~~~~L~~H~~~  257 (262)
                      .|.|..|+-.|.+....+.|+++
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            57788888888777777777764


No 231
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=23.94  E-value=32  Score=18.08  Aligned_cols=10  Identities=20%  Similarity=0.697  Sum_probs=5.0

Q ss_pred             CccCCCCCcc
Q psy11589        235 PFVCNMCPST  244 (262)
Q Consensus       235 ~~~C~~C~~~  244 (262)
                      -|+|..||..
T Consensus         6 ~YkC~~CGni   15 (36)
T PF06397_consen    6 FYKCEHCGNI   15 (36)
T ss_dssp             EEE-TTT--E
T ss_pred             EEEccCCCCE
Confidence            4788888754


No 232
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=23.82  E-value=32  Score=19.26  Aligned_cols=17  Identities=29%  Similarity=0.841  Sum_probs=12.0

Q ss_pred             cccccccccCChHHHHH
Q psy11589        209 ICDVCGKEFRMKRQLKE  225 (262)
Q Consensus       209 ~C~~C~~~f~~~~~l~~  225 (262)
                      .|++|+..|.......+
T Consensus        14 ICpvCqRPFsWRkKW~~   30 (54)
T COG4338          14 ICPVCQRPFSWRKKWAR   30 (54)
T ss_pred             hhhhhcCchHHHHHHHH
Confidence            58888888887665443


No 233
>PF14369 zf-RING_3:  zinc-finger
Probab=23.67  E-value=98  Score=16.02  Aligned_cols=8  Identities=38%  Similarity=0.945  Sum_probs=3.9

Q ss_pred             cCcchhhc
Q psy11589         97 CHICKKVF  104 (262)
Q Consensus        97 C~~C~~~f  104 (262)
                      |+.|+..|
T Consensus        24 CP~C~~gF   31 (35)
T PF14369_consen   24 CPRCHGGF   31 (35)
T ss_pred             CcCCCCcE
Confidence            55554444


No 234
>TIGR03826 YvyF flagellar operon protein TIGR03826. This gene is found in flagellar operons of Bacillus-related organisms. Its function has not been determined and an official gene symbol has not been assigned, although the gene is designated yvyF in B. subtilus. A tentative assignment as a regulator is suggested in the NCBI record GI:16080597.
Probab=23.58  E-value=45  Score=23.70  Aligned_cols=12  Identities=33%  Similarity=0.852  Sum_probs=7.1

Q ss_pred             cccccccccccC
Q psy11589        207 KSICDVCGKEFR  218 (262)
Q Consensus       207 ~~~C~~C~~~f~  218 (262)
                      .|.|..||..-.
T Consensus        81 ~~~CE~CG~~I~   92 (137)
T TIGR03826        81 GYPCERCGTSIR   92 (137)
T ss_pred             cCcccccCCcCC
Confidence            366777766443


No 235
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=23.39  E-value=31  Score=28.29  Aligned_cols=13  Identities=23%  Similarity=0.649  Sum_probs=7.0

Q ss_pred             CCCCccccCcccc
Q psy11589        147 TGEKKYVCETCGA  159 (262)
Q Consensus       147 ~~~~~~~C~~C~~  159 (262)
                      .|.+-..|..|+-
T Consensus       208 ~G~RyL~CslC~t  220 (309)
T PRK03564        208 QGLRYLHCNLCES  220 (309)
T ss_pred             CCceEEEcCCCCC
Confidence            3444555666664


No 236
>KOG2636|consensus
Probab=23.36  E-value=60  Score=27.93  Aligned_cols=28  Identities=25%  Similarity=0.666  Sum_probs=23.4

Q ss_pred             HhhCCCCCccCCCCC-cccCChHHHHHHH
Q psy11589        228 AVHTTDRPFVCNMCP-STFKLKKHLRQHY  255 (262)
Q Consensus       228 ~~h~~~~~~~C~~C~-~~f~~~~~L~~H~  255 (262)
                      +.|.=...|.|.+|| +++.-...+.+|.
T Consensus       394 KLHGL~~ey~CEICGNy~Y~GrkaF~RHF  422 (497)
T KOG2636|consen  394 KLHGLDIEYNCEICGNYVYKGRKAFDRHF  422 (497)
T ss_pred             hhcCCCcccceeeccCccccCcHHHHHHh
Confidence            455556779999999 8999999999996


No 237
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=23.35  E-value=52  Score=16.98  Aligned_cols=9  Identities=44%  Similarity=1.224  Sum_probs=5.3

Q ss_pred             eecCCCccc
Q psy11589         67 YKCPDCSVI   75 (262)
Q Consensus        67 ~~C~~C~~~   75 (262)
                      +.|+.|+.+
T Consensus        23 ~vC~~Cg~I   31 (34)
T PF14803_consen   23 LVCPACGFI   31 (34)
T ss_dssp             EEETTTTEE
T ss_pred             eECCCCCCE
Confidence            556666654


No 238
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=23.30  E-value=22  Score=23.70  Aligned_cols=11  Identities=27%  Similarity=0.561  Sum_probs=5.6

Q ss_pred             ccccccccccC
Q psy11589        208 SICDVCGKEFR  218 (262)
Q Consensus       208 ~~C~~C~~~f~  218 (262)
                      ..|+.||..+.
T Consensus        43 ~~C~~CG~y~~   53 (99)
T PRK14892         43 ITCGNCGLYTE   53 (99)
T ss_pred             EECCCCCCccC
Confidence            34555555444


No 239
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=23.27  E-value=30  Score=19.59  Aligned_cols=9  Identities=33%  Similarity=0.914  Sum_probs=4.6

Q ss_pred             ccCCCCCcc
Q psy11589        236 FVCNMCPST  244 (262)
Q Consensus       236 ~~C~~C~~~  244 (262)
                      +.|..||++
T Consensus        38 ~~CGkCgyT   46 (51)
T COG1998          38 WACGKCGYT   46 (51)
T ss_pred             eEeccccce
Confidence            455555543


No 240
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=22.57  E-value=14  Score=19.39  Aligned_cols=11  Identities=36%  Similarity=0.748  Sum_probs=5.5

Q ss_pred             CCCCccccccc
Q psy11589        203 TIHQKSICDVC  213 (262)
Q Consensus       203 ~~~~~~~C~~C  213 (262)
                      .+...|.|..|
T Consensus        25 ~G~qryrC~~C   35 (36)
T PF03811_consen   25 SGHQRYRCKDC   35 (36)
T ss_pred             CCCEeEecCcC
Confidence            34444555555


No 241
>PTZ00448 hypothetical protein; Provisional
Probab=21.14  E-value=71  Score=26.84  Aligned_cols=23  Identities=17%  Similarity=0.427  Sum_probs=20.3

Q ss_pred             cccccccccccCChHHHHHHHHh
Q psy11589        207 KSICDVCGKEFRMKRQLKEHMAV  229 (262)
Q Consensus       207 ~~~C~~C~~~f~~~~~l~~H~~~  229 (262)
                      .|.|..|+..|.+....+.|+++
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            58899999999988999999875


No 242
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=21.00  E-value=34  Score=23.84  Aligned_cols=10  Identities=30%  Similarity=0.627  Sum_probs=4.9

Q ss_pred             ccCCcchhcCC
Q psy11589        179 FVCSYCGNTYK  189 (262)
Q Consensus       179 ~~C~~C~~~f~  189 (262)
                      +.| .|+..|.
T Consensus        71 ~~C-~Cg~~~~   80 (124)
T PRK00762         71 IEC-ECGYEGV   80 (124)
T ss_pred             EEe-eCcCccc
Confidence            445 5554443


No 243
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=21.00  E-value=25  Score=25.39  Aligned_cols=18  Identities=22%  Similarity=0.582  Sum_probs=11.4

Q ss_pred             CCccccCcccccccCcch
Q psy11589        149 EKKYVCETCGASFALWGS  166 (262)
Q Consensus       149 ~~~~~C~~C~~~f~~~~~  166 (262)
                      +.|..|..||+.|++...
T Consensus        66 ~~PsYC~~CGkpyPWt~~   83 (158)
T PF10083_consen   66 EAPSYCHNCGKPYPWTEN   83 (158)
T ss_pred             CCChhHHhCCCCCchHHH
Confidence            456667777777766533


No 244
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=20.51  E-value=80  Score=18.22  Aligned_cols=31  Identities=19%  Similarity=0.430  Sum_probs=15.7

Q ss_pred             cccccccccCChHHHHHHHHhhCCCCCccCCCCCc
Q psy11589        209 ICDVCGKEFRMKRQLKEHMAVHTTDRPFVCNMCPS  243 (262)
Q Consensus       209 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~  243 (262)
                      .|.-|+...+.....    .+..++....|+.||+
T Consensus        24 ~C~gC~~~l~~~~~~----~i~~~~~i~~Cp~CgR   54 (56)
T PF02591_consen   24 TCSGCHMELPPQELN----EIRKGDEIVFCPNCGR   54 (56)
T ss_pred             ccCCCCEEcCHHHHH----HHHcCCCeEECcCCCc
Confidence            566666555433221    1223355566777764


No 245
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=20.46  E-value=38  Score=24.25  Aligned_cols=11  Identities=36%  Similarity=1.159  Sum_probs=5.2

Q ss_pred             cccCCcchhcC
Q psy11589        178 QFVCSYCGNTY  188 (262)
Q Consensus       178 ~~~C~~C~~~f  188 (262)
                      .|.|..|+..+
T Consensus       112 ~y~C~~C~~~~  122 (146)
T smart00731      112 PYRCTGCGQRY  122 (146)
T ss_pred             EEECCCCCCCC
Confidence            34555455443


No 246
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=20.14  E-value=45  Score=22.17  Aligned_cols=13  Identities=31%  Similarity=0.631  Sum_probs=8.3

Q ss_pred             cccccccccccCC
Q psy11589        207 KSICDVCGKEFRM  219 (262)
Q Consensus       207 ~~~C~~C~~~f~~  219 (262)
                      .+.|+.|+..+..
T Consensus        16 ~~~C~~C~~~~~~   28 (104)
T TIGR01384        16 VYVCPSCGYEKEK   28 (104)
T ss_pred             eEECcCCCCcccc
Confidence            4677777766543


Done!