Query         psy11591
Match_columns 220
No_of_seqs    158 out of 1459
Neff          10.8
Searched_HMMs 46136
Date          Fri Aug 16 22:36:59 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy11591.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/11591hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus              100.0 4.3E-32 9.3E-37  195.3   5.1  134   58-192   130-266 (279)
  2 KOG1074|consensus              100.0 1.7E-31 3.7E-36  216.2   3.0  141   59-199   606-937 (958)
  3 KOG2462|consensus               99.9 8.2E-29 1.8E-33  178.4   4.7  133   28-163   129-265 (279)
  4 KOG3608|consensus               99.9 2.3E-25   5E-30  165.1   9.6  190    3-195   181-378 (467)
  5 KOG3623|consensus               99.9 2.3E-24 4.9E-29  172.9   6.5  106    2-107   211-330 (1007)
  6 KOG3608|consensus               99.9 1.2E-22 2.6E-27  150.8  10.9  187    4-193   139-345 (467)
  7 KOG3623|consensus               99.9 8.2E-22 1.8E-26  158.4   6.7   77    2-79    241-330 (1007)
  8 KOG1074|consensus               99.8   1E-20 2.3E-25  154.2   3.6  170    1-171   605-937 (958)
  9 KOG3576|consensus               99.7 1.1E-17 2.3E-22  115.7   4.2  125   27-168   115-239 (267)
 10 KOG3576|consensus               99.7 5.9E-18 1.3E-22  117.0   2.6  115   83-197   114-240 (267)
 11 PLN03086 PRLI-interacting fact  99.5 1.6E-13 3.5E-18  111.1   8.1  145   30-193   408-564 (567)
 12 PLN03086 PRLI-interacting fact  99.4 1.4E-12   3E-17  105.8   8.4  144    3-166   409-565 (567)
 13 PHA00733 hypothetical protein   99.2 4.5E-11 9.8E-16   79.7   5.9   55  138-194    70-124 (128)
 14 PHA00733 hypothetical protein   99.2 2.5E-11 5.4E-16   80.9   4.5   93   72-166    26-124 (128)
 15 PHA02768 hypothetical protein;  99.0 1.2E-10 2.6E-15   64.2   2.1   43  142-186     6-48  (55)
 16 KOG3993|consensus               99.0 2.1E-11 4.6E-16   93.5  -2.5  193    2-195   268-484 (500)
 17 KOG3993|consensus               99.0 7.2E-11 1.6E-15   90.7  -1.1  171   30-201   268-462 (500)
 18 PHA02768 hypothetical protein;  98.9 5.3E-10 1.2E-14   61.7   1.6   42  114-157     6-47  (55)
 19 PF13465 zf-H2C2_2:  Zinc-finge  98.8   4E-09 8.7E-14   49.8   1.9   24  157-180     2-25  (26)
 20 PF13465 zf-H2C2_2:  Zinc-finge  98.7 9.6E-09 2.1E-13   48.5   2.3   26  128-153     1-26  (26)
 21 PHA00616 hypothetical protein   98.7 4.2E-09   9E-14   55.3   1.1   32  142-173     2-33  (44)
 22 PHA00616 hypothetical protein   98.6 4.8E-08   1E-12   51.3   2.6   35    1-35      1-35  (44)
 23 PHA00732 hypothetical protein   98.5 1.3E-07 2.7E-12   57.4   2.8   44  114-163     2-46  (79)
 24 PF05605 zf-Di19:  Drought indu  98.4   7E-07 1.5E-11   50.3   3.9   51  141-194     2-54  (54)
 25 PHA00732 hypothetical protein   98.3 5.4E-07 1.2E-11   54.6   2.6   45  141-191     1-46  (79)
 26 PF05605 zf-Di19:  Drought indu  98.2 3.2E-06   7E-11   47.6   4.2   49   30-81      3-52  (54)
 27 PF00096 zf-C2H2:  Zinc finger,  98.0 2.4E-06 5.1E-11   39.0   1.1   22  142-163     1-22  (23)
 28 PF00096 zf-C2H2:  Zinc finger,  98.0 5.9E-06 1.3E-10   37.7   2.1   22  170-191     1-22  (23)
 29 PF13894 zf-C2H2_4:  C2H2-type   97.9 4.6E-06 9.9E-11   38.4   1.5   23  170-192     1-23  (24)
 30 PF13912 zf-C2H2_6:  C2H2-type   97.9 5.1E-06 1.1E-10   39.5   1.3   25  169-193     1-25  (27)
 31 PF12756 zf-C2H2_2:  C2H2 type   97.8 1.4E-05 2.9E-10   51.2   2.2   73  115-192     1-73  (100)
 32 PF13894 zf-C2H2_4:  C2H2-type   97.8 2.7E-05 5.9E-10   35.6   2.4   23  142-164     1-23  (24)
 33 COG5189 SFP1 Putative transcri  97.7 1.3E-05 2.9E-10   60.1   0.9   51  139-189   347-418 (423)
 34 PF13912 zf-C2H2_6:  C2H2-type   97.6 4.1E-05 8.8E-10   36.3   1.7   25  141-165     1-25  (27)
 35 PF12756 zf-C2H2_2:  C2H2 type   97.6 5.4E-05 1.2E-09   48.4   2.6   22   32-53      2-23  (100)
 36 PF09237 GAGA:  GAGA factor;  I  97.4 0.00011 2.4E-09   39.5   2.0   31  167-197    22-52  (54)
 37 PF09237 GAGA:  GAGA factor;  I  97.3 0.00026 5.7E-09   38.1   2.8   33  137-169    20-52  (54)
 38 PF13909 zf-H2C2_5:  C2H2-type   97.3 0.00011 2.5E-09   33.7   1.2   23  170-193     1-23  (24)
 39 smart00355 ZnF_C2H2 zinc finge  97.3 0.00019 4.2E-09   33.3   1.9   23  170-192     1-23  (26)
 40 COG5189 SFP1 Putative transcri  97.2  0.0001 2.2E-09   55.5   0.6   53  110-162   346-419 (423)
 41 PRK04860 hypothetical protein;  97.1 0.00031 6.8E-09   48.7   1.8   40  140-183   118-157 (160)
 42 PF12874 zf-met:  Zinc-finger o  97.0 0.00034 7.4E-09   32.4   1.0   23  170-192     1-23  (25)
 43 smart00355 ZnF_C2H2 zinc finge  96.9  0.0012 2.6E-08   30.5   2.7   23    2-24      1-23  (26)
 44 PF13909 zf-H2C2_5:  C2H2-type   96.7  0.0012 2.7E-08   30.1   1.8   23  142-165     1-23  (24)
 45 KOG2785|consensus               96.7  0.0072 1.6E-07   47.1   6.9  163   29-191     3-242 (390)
 46 KOG1146|consensus               96.6 0.00051 1.1E-08   61.1   0.2   51   32-82    439-489 (1406)
 47 PRK04860 hypothetical protein;  96.5  0.0022 4.8E-08   44.5   2.8   38  113-154   119-156 (160)
 48 PF12874 zf-met:  Zinc-finger o  96.5  0.0017 3.6E-08   30.0   1.5   22  142-163     1-22  (25)
 49 PF12171 zf-C2H2_jaz:  Zinc-fin  96.4  0.0014 3.1E-08   30.9   1.0   22  170-191     2-23  (27)
 50 KOG2231|consensus               95.9    0.04 8.7E-07   46.7   7.4   94   41-137   126-236 (669)
 51 PF12171 zf-C2H2_jaz:  Zinc-fin  95.5  0.0029 6.4E-08   29.8  -0.4   21  142-162     2-22  (27)
 52 KOG2482|consensus               95.4   0.078 1.7E-06   40.9   6.6  106   86-191   195-356 (423)
 53 KOG2785|consensus               95.3   0.041   9E-07   43.0   5.1   53  112-164   165-243 (390)
 54 KOG2893|consensus               95.1  0.0054 1.2E-07   44.6  -0.2   41   32-77     13-53  (341)
 55 KOG1146|consensus               95.0  0.0091   2E-07   53.7   0.8   53  139-191   463-540 (1406)
 56 KOG4173|consensus               94.6   0.016 3.5E-07   41.2   1.1   73  114-189    80-166 (253)
 57 PF13913 zf-C2HC_2:  zinc-finge  94.4   0.045 9.7E-07   25.2   2.1   18    3-21      4-21  (25)
 58 KOG2231|consensus               94.4   0.098 2.1E-06   44.5   5.4  119   61-190   118-260 (669)
 59 smart00451 ZnF_U1 U1-like zinc  94.2   0.037 7.9E-07   27.6   1.7   23  169-191     3-25  (35)
 60 KOG2482|consensus               94.1    0.19 4.1E-06   38.9   5.8  148   16-163   130-356 (423)
 61 PF12013 DUF3505:  Protein of u  94.0    0.16 3.4E-06   33.1   4.8   25  170-194    81-109 (109)
 62 KOG2893|consensus               93.9   0.014   3E-07   42.6  -0.3   48    3-54     12-59  (341)
 63 COG5236 Uncharacterized conser  93.9    0.14 3.1E-06   39.6   5.0   24   30-53    152-177 (493)
 64 TIGR00622 ssl1 transcription f  93.6   0.068 1.5E-06   34.5   2.4   48  144-193    58-105 (112)
 65 COG5236 Uncharacterized conser  93.4     0.2 4.3E-06   38.9   5.0  125   59-193   152-305 (493)
 66 smart00451 ZnF_U1 U1-like zinc  93.4   0.083 1.8E-06   26.3   2.1   22  141-162     3-24  (35)
 67 cd00350 rubredoxin_like Rubred  93.3   0.057 1.2E-06   26.7   1.4    9  114-122     2-10  (33)
 68 COG5048 FOG: Zn-finger [Genera  92.9   0.029 6.3E-07   45.6  -0.0   67  140-206   288-360 (467)
 69 COG5048 FOG: Zn-finger [Genera  92.9   0.017 3.7E-07   46.9  -1.4  150   28-177   288-454 (467)
 70 PF12013 DUF3505:  Protein of u  92.6     0.3 6.6E-06   31.7   4.4   54  112-166    10-109 (109)
 71 TIGR00622 ssl1 transcription f  91.8    0.27 5.8E-06   31.9   3.3   21   28-48     14-34  (112)
 72 PF10571 UPF0547:  Uncharacteri  90.7    0.14   3E-06   23.8   0.9    9  171-179    16-24  (26)
 73 PF09538 FYDLN_acid:  Protein o  90.3     0.2 4.4E-06   32.4   1.8   30  114-154    10-39  (108)
 74 COG4049 Uncharacterized protei  90.2    0.18 3.9E-06   27.8   1.2   30   25-54     13-42  (65)
 75 PHA00626 hypothetical protein   89.0    0.13 2.9E-06   28.4   0.2   13  168-180    22-34  (59)
 76 COG4049 Uncharacterized protei  88.2    0.26 5.6E-06   27.2   1.0   28  138-165    14-41  (65)
 77 cd00729 rubredoxin_SM Rubredox  87.7    0.32   7E-06   24.2   1.1    9  114-122     3-11  (34)
 78 KOG4173|consensus               87.7    0.34 7.3E-06   34.7   1.5   77   87-165    80-170 (253)
 79 PF13719 zinc_ribbon_5:  zinc-r  87.6     0.6 1.3E-05   23.7   2.1    9  170-178    26-34  (37)
 80 COG1592 Rubrerythrin [Energy p  86.4    0.98 2.1E-05   31.6   3.2   12  165-176   145-156 (166)
 81 COG1592 Rubrerythrin [Energy p  86.4    0.46   1E-05   33.2   1.6   25  112-149   133-157 (166)
 82 PRK00464 nrdR transcriptional   85.9   0.085 1.8E-06   36.5  -2.2   17  170-186    29-45  (154)
 83 PF05290 Baculo_IE-1:  Baculovi  85.6    0.35 7.5E-06   32.2   0.7   58   82-155    76-135 (140)
 84 PF09986 DUF2225:  Uncharacteri  85.5    0.15 3.2E-06   37.5  -1.2   13  170-182    49-61  (214)
 85 TIGR02098 MJ0042_CXXC MJ0042 f  85.2     0.8 1.7E-05   23.3   1.8   10  143-152     4-13  (38)
 86 PF13717 zinc_ribbon_4:  zinc-r  84.5     1.2 2.6E-05   22.4   2.2   12  143-154     4-15  (36)
 87 smart00659 RPOLCX RNA polymera  83.3     1.1 2.3E-05   23.8   1.8   10  114-123     3-12  (44)
 88 TIGR02300 FYDLN_acid conserved  82.8    0.93   2E-05   30.0   1.7   30  114-154    10-39  (129)
 89 KOG2186|consensus               82.1       1 2.2E-05   33.5   1.9   46  114-162     4-49  (276)
 90 KOG2186|consensus               81.7     1.4 2.9E-05   32.9   2.4   45   59-106     4-48  (276)
 91 TIGR00373 conserved hypothetic  81.1     2.2 4.8E-05   29.8   3.3   34  136-178   104-137 (158)
 92 COG2888 Predicted Zn-ribbon RN  80.8    0.81 1.7E-05   25.8   0.8   11  111-121    48-58  (61)
 93 PF09986 DUF2225:  Uncharacteri  78.7    0.36 7.8E-06   35.5  -1.3   44   28-71      4-61  (214)
 94 smart00531 TFIIE Transcription  78.2     2.2 4.8E-05   29.3   2.5   37   27-68     97-133 (147)
 95 PRK00398 rpoP DNA-directed RNA  78.0     1.8   4E-05   23.1   1.7    7  142-148    22-28  (46)
 96 TIGR00373 conserved hypothetic  77.9     2.3 5.1E-05   29.7   2.6   30   28-67    108-137 (158)
 97 TIGR02605 CxxC_CxxC_SSSS putat  77.7    0.29 6.3E-06   26.9  -1.6   29   30-66      6-34  (52)
 98 PF06524 NOA36:  NOA36 protein;  77.5    0.83 1.8E-05   34.1   0.3   29  166-194   206-234 (314)
 99 smart00531 TFIIE Transcription  76.9     4.1 8.8E-05   28.1   3.5   16  139-154    97-112 (147)
100 PRK06266 transcription initiat  76.8     2.8 6.1E-05   29.9   2.8   32  138-178   114-145 (178)
101 PRK06266 transcription initiat  76.5       1 2.2E-05   32.1   0.5   40   21-70    109-148 (178)
102 COG5151 SSL1 RNA polymerase II  76.3    0.82 1.8E-05   35.0  -0.0   49  143-193   364-412 (421)
103 PF02892 zf-BED:  BED zinc fing  76.3     3.4 7.4E-05   21.7   2.4   22  140-161    15-40  (45)
104 smart00834 CxxC_CXXC_SSSS Puta  76.2    0.32   7E-06   25.1  -1.6   29   30-66      6-34  (41)
105 smart00734 ZnF_Rad18 Rad18-lik  74.7     3.5 7.7E-05   19.0   1.9   19  143-162     3-21  (26)
106 PF09723 Zn-ribbon_8:  Zinc rib  74.5     0.9   2E-05   23.8  -0.2   29   30-66      6-34  (42)
107 PF12760 Zn_Tnp_IS1595:  Transp  73.2       2 4.4E-05   22.9   1.0   11  167-177    35-45  (46)
108 PRK09678 DNA-binding transcrip  72.6    0.62 1.3E-05   27.7  -1.2   42  142-185     2-45  (72)
109 smart00614 ZnF_BED BED zinc fi  72.5     3.5 7.5E-05   22.4   1.9   21  142-162    19-44  (50)
110 PF05443 ROS_MUCR:  ROS/MUCR tr  71.7     1.7 3.8E-05   29.2   0.6   22  142-166    73-94  (132)
111 PF08274 PhnA_Zn_Ribbon:  PhnA   70.8     1.3 2.9E-05   21.3  -0.0    9  169-177    19-27  (30)
112 PF02176 zf-TRAF:  TRAF-type zi  70.2     2.8   6E-05   23.6   1.2   21  126-146    23-43  (60)
113 PRK14890 putative Zn-ribbon RN  68.5     2.4 5.1E-05   24.0   0.6   10  112-121    47-56  (59)
114 COG1996 RPC10 DNA-directed RNA  68.1     3.1 6.7E-05   22.6   1.0   10  142-151     7-16  (49)
115 KOG4124|consensus               67.9    0.59 1.3E-05   36.4  -2.4   68  139-206   347-435 (442)
116 KOG2807|consensus               66.9     4.7  0.0001   31.4   2.2   26  168-193   344-369 (378)
117 PF05443 ROS_MUCR:  ROS/MUCR tr  64.7     5.5 0.00012   26.9   1.9   25  114-141    73-97  (132)
118 PF04959 ARS2:  Arsenite-resist  63.4     3.3 7.2E-05   30.4   0.8   28  113-140    77-104 (214)
119 PF04959 ARS2:  Arsenite-resist  62.5     3.2   7E-05   30.5   0.6   31  137-167    73-103 (214)
120 COG4530 Uncharacterized protei  61.7     5.3 0.00011   25.7   1.3   30  114-154    10-39  (129)
121 PF03811 Zn_Tnp_IS1:  InsA N-te  61.5     1.6 3.5E-05   22.0  -0.8   30  142-175     6-35  (36)
122 PF09845 DUF2072:  Zn-ribbon co  61.3     3.8 8.2E-05   27.4   0.7   13   87-99      2-14  (131)
123 COG1997 RPL43A Ribosomal prote  60.5     6.1 0.00013   24.3   1.4   11  141-151    53-63  (89)
124 PF03604 DNA_RNApol_7kD:  DNA d  60.3     3.5 7.6E-05   20.2   0.3    8  142-149    18-25  (32)
125 PRK04023 DNA polymerase II lar  59.0     8.8 0.00019   34.9   2.6    8  170-177   664-671 (1121)
126 KOG2593|consensus               58.4      11 0.00023   30.8   2.8   40   25-68    124-163 (436)
127 PF07754 DUF1610:  Domain of un  58.3     3.5 7.5E-05   18.7   0.1    7    2-8      17-23  (24)
128 PRK00432 30S ribosomal protein  58.1     4.4 9.5E-05   22.2   0.5   12  168-179    36-47  (50)
129 COG1998 RPS31 Ribosomal protei  57.2     4.1 8.9E-05   22.0   0.3   10  169-178    37-46  (51)
130 PF13453 zf-TFIIB:  Transcripti  55.0     5.1 0.00011   20.7   0.4   18   58-75     19-36  (41)
131 KOG3408|consensus               54.2       9  0.0002   25.2   1.5   25   26-50     54-78  (129)
132 PF12907 zf-met2:  Zinc-binding  53.3      12 0.00027   19.4   1.6   11   44-54     19-29  (40)
133 PF14353 CpXC:  CpXC protein     52.8      13 0.00027   24.9   2.1   10   60-69      3-12  (128)
134 KOG2593|consensus               52.8      14  0.0003   30.1   2.6   35  113-150   128-162 (436)
135 COG4888 Uncharacterized Zn rib  52.5     2.3   5E-05   26.8  -1.3   13  139-151    20-32  (104)
136 PF15269 zf-C2H2_7:  Zinc-finge  52.3      10 0.00022   20.0   1.2   21  170-190    21-41  (54)
137 COG3091 SprT Zn-dependent meta  52.0     7.4 0.00016   26.8   0.9   36  138-178   114-149 (156)
138 PF13878 zf-C2H2_3:  zinc-finge  51.8      14 0.00031   19.1   1.8   23    3-25     15-39  (41)
139 KOG3408|consensus               51.6     8.5 0.00019   25.3   1.1   25  167-191    55-79  (129)
140 KOG2907|consensus               51.2     7.4 0.00016   25.2   0.8   11  142-152   103-113 (116)
141 KOG4167|consensus               51.0     5.8 0.00013   34.4   0.3   25    2-26    793-817 (907)
142 PRK14714 DNA polymerase II lar  50.9      14 0.00031   34.5   2.7   11  141-151   692-702 (1337)
143 PF13451 zf-trcl:  Probable zin  49.8      14  0.0003   20.2   1.5   18  140-157     3-20  (49)
144 PF14311 DUF4379:  Domain of un  48.0      12 0.00027   20.7   1.3   13  114-126    29-41  (55)
145 PF07800 DUF1644:  Protein of u  48.0      62  0.0013   22.6   4.8   61  140-202    79-142 (162)
146 COG4957 Predicted transcriptio  47.1      14 0.00031   24.8   1.6   24  142-168    77-100 (148)
147 TIGR01206 lysW lysine biosynth  45.7      14  0.0003   20.6   1.2    8  142-149    23-30  (54)
148 PTZ00255 60S ribosomal protein  45.3      14 0.00029   23.1   1.2   11  141-151    54-64  (90)
149 COG1198 PriA Primosomal protei  44.9      10 0.00023   33.4   0.9   49  114-178   436-484 (730)
150 PF14446 Prok-RING_1:  Prokaryo  44.5       9 0.00019   21.3   0.3    9   89-97      8-16  (54)
151 PF07800 DUF1644:  Protein of u  44.2      29 0.00063   24.2   2.8   11   71-81    121-131 (162)
152 smart00661 RPOL9 RNA polymeras  43.0      22 0.00047   19.2   1.8   11  169-179    20-30  (52)
153 TIGR00244 transcriptional regu  42.2     3.9 8.5E-05   28.0  -1.6   13  171-183    30-42  (147)
154 KOG2071|consensus               41.8      17 0.00037   30.9   1.7   30  166-195   415-444 (579)
155 PF07975 C1_4:  TFIIH C1-like d  41.7     9.6 0.00021   21.0   0.2   27  167-193    19-45  (51)
156 PF15135 UPF0515:  Uncharacteri  41.5      28  0.0006   26.2   2.5   59   28-100   111-169 (278)
157 KOG1280|consensus               41.3      22 0.00048   28.1   2.1   25    2-26     80-104 (381)
158 COG1327 Predicted transcriptio  41.2     5.6 0.00012   27.3  -1.0   12  171-182    30-41  (156)
159 KOG1842|consensus               40.3      20 0.00042   29.4   1.7   26   30-55     16-41  (505)
160 PF04780 DUF629:  Protein of un  39.8      20 0.00043   29.8   1.8   27   30-56     58-84  (466)
161 smart00440 ZnF_C2C2 C2C2 Zinc   39.6     4.3 9.2E-05   21.0  -1.4    8  170-177    29-36  (40)
162 PF11672 DUF3268:  Protein of u  39.4     9.4  0.0002   24.5  -0.1    7  170-176    32-38  (102)
163 PRK03824 hypA hydrogenase nick  39.3     8.3 0.00018   26.1  -0.4   11   59-69     71-81  (135)
164 KOG1280|consensus               39.0      30 0.00065   27.4   2.5   36  113-148    79-116 (381)
165 PF06524 NOA36:  NOA36 protein;  38.5     9.9 0.00021   28.7  -0.1   82   81-164   137-232 (314)
166 PF14369 zf-RING_3:  zinc-finge  38.0      12 0.00027   18.6   0.2    9   60-68     23-31  (35)
167 PF01286 XPA_N:  XPA protein N-  37.9     7.2 0.00016   19.4  -0.6   12  143-154     5-16  (34)
168 TIGR00280 L37a ribosomal prote  37.8      17 0.00036   22.8   0.8   11  141-151    53-63  (91)
169 COG3357 Predicted transcriptio  37.8      16 0.00034   22.7   0.7   14  168-181    57-70  (97)
170 COG1773 Rubredoxin [Energy pro  37.4      14  0.0003   20.7   0.4   15  168-182     2-16  (55)
171 COG3364 Zn-ribbon containing p  36.8      21 0.00046   22.7   1.2   15  141-155     2-16  (112)
172 KOG1842|consensus               36.2      18 0.00039   29.6   1.0   24  142-165    16-39  (505)
173 PF05191 ADK_lid:  Adenylate ki  36.2      11 0.00023   19.0  -0.2    9  115-123     3-11  (36)
174 KOG2807|consensus               35.5      47   0.001   26.2   3.0   24  113-136   345-368 (378)
175 PF10537 WAC_Acf1_DNA_bd:  ATP-  35.5      45 0.00098   21.4   2.5   36   87-122     4-39  (102)
176 PF07282 OrfB_Zn_ribbon:  Putat  35.3      27 0.00059   20.2   1.5    9  141-149    46-54  (69)
177 PF03833 PolC_DP2:  DNA polymer  35.2      13 0.00027   33.2   0.0   10  141-150   680-689 (900)
178 smart00154 ZnF_AN1 AN1-like Zi  34.9      14  0.0003   19.0   0.1   10   30-39     13-22  (39)
179 COG1594 RPB9 DNA-directed RNA   34.6      11 0.00024   24.7  -0.3   11  141-151   100-110 (113)
180 COG5151 SSL1 RNA polymerase II  34.2      48   0.001   25.9   2.9   80   28-109   321-411 (421)
181 PF01780 Ribosomal_L37ae:  Ribo  33.9      11 0.00025   23.4  -0.3   10  142-151    54-63  (90)
182 KOG4167|consensus               33.8     8.5 0.00018   33.5  -1.2   27  169-195   792-818 (907)
183 PF06220 zf-U1:  U1 zinc finger  33.8      36 0.00077   17.3   1.5   11  169-179     3-13  (38)
184 PRK04023 DNA polymerase II lar  33.0      54  0.0012   30.2   3.4   20  198-217   664-683 (1121)
185 PF01363 FYVE:  FYVE zinc finge  32.8      20 0.00043   20.8   0.6    9  115-123    11-19  (69)
186 PRK03976 rpl37ae 50S ribosomal  32.7      22 0.00047   22.2   0.7   10  142-151    55-64  (90)
187 PRK03564 formate dehydrogenase  32.3      12 0.00026   29.3  -0.5   13   82-94    208-220 (309)
188 COG1571 Predicted DNA-binding   32.1      30 0.00064   28.4   1.6   30  143-183   352-381 (421)
189 COG1655 Uncharacterized protei  32.1     8.5 0.00018   28.5  -1.3   15  140-154    18-32  (267)
190 PRK14559 putative protein seri  31.3      33 0.00072   30.0   1.9   12  171-182    43-54  (645)
191 TIGR00100 hypA hydrogenase nic  31.2      24 0.00052   23.2   0.8   11  114-124    71-81  (115)
192 PF10276 zf-CHCC:  Zinc-finger   31.1      23 0.00051   18.3   0.6   12  140-151    28-39  (40)
193 TIGR00686 phnA alkylphosphonat  30.9      17 0.00036   23.5   0.0   12  169-180    19-30  (109)
194 PF01428 zf-AN1:  AN1-like Zinc  30.9      22 0.00047   18.5   0.5   13  140-152    12-24  (43)
195 PF00301 Rubredoxin:  Rubredoxi  30.6      17 0.00036   19.6   0.0   14  169-182     1-14  (47)
196 PRK12380 hydrogenase nickel in  30.2      25 0.00054   23.0   0.8   10  114-123    71-80  (113)
197 cd00730 rubredoxin Rubredoxin;  29.5      24 0.00052   19.3   0.5   13  169-181     1-13  (50)
198 KOG3002|consensus               29.5      57  0.0012   25.6   2.7   76  112-192    79-162 (299)
199 PF04780 DUF629:  Protein of un  29.4      45 0.00098   27.8   2.2   24  114-137    58-81  (466)
200 COG3677 Transposase and inacti  29.1      26 0.00056   23.6   0.7   35  142-181    31-65  (129)
201 PRK10220 hypothetical protein;  29.1      24 0.00053   22.8   0.5   12  169-180    20-31  (111)
202 PF13824 zf-Mss51:  Zinc-finger  28.9      40 0.00086   18.9   1.3   12   56-67     12-23  (55)
203 PF08790 zf-LYAR:  LYAR-type C2  28.5      13 0.00028   17.6  -0.6   18  170-188     1-18  (28)
204 KOG0717|consensus               28.5      39 0.00084   28.0   1.7   22  142-163   293-314 (508)
205 KOG4377|consensus               28.2      17 0.00036   29.5  -0.4   26  170-195   402-429 (480)
206 PRK14873 primosome assembly pr  28.1      47   0.001   29.3   2.2   27  136-178   405-431 (665)
207 cd00065 FYVE FYVE domain; Zinc  27.2      48   0.001   18.1   1.5    9  144-152     5-13  (57)
208 PF04423 Rad50_zn_hook:  Rad50   27.0      25 0.00054   19.3   0.3   12  143-154    22-33  (54)
209 COG5112 UFD2 U1-like Zn-finger  25.9      27 0.00059   22.3   0.4   23  168-190    54-76  (126)
210 KOG0717|consensus               25.9      36 0.00078   28.2   1.1   22  170-191   293-314 (508)
211 KOG3507|consensus               25.6      45 0.00098   18.9   1.1   10  141-150    37-46  (62)
212 TIGR00595 priA primosomal prot  25.1      57  0.0012   27.7   2.2   47  115-177   215-261 (505)
213 TIGR03826 YvyF flagellar opero  25.0      53  0.0012   22.4   1.6   40    3-55      5-44  (137)
214 PTZ00448 hypothetical protein;  24.5      52  0.0011   26.5   1.7   24  169-192   314-337 (373)
215 COG1326 Uncharacterized archae  24.2      49  0.0011   23.9   1.4   12   86-97     30-41  (201)
216 PRK00564 hypA hydrogenase nick  24.2      34 0.00074   22.5   0.6   10  114-123    72-81  (117)
217 PF07649 C1_3:  C1-like domain;  24.2      38 0.00082   15.9   0.6   10  113-122    15-24  (30)
218 PF08209 Sgf11:  Sgf11 (transcr  24.0      65  0.0014   15.9   1.4   22  142-164     5-26  (33)
219 smart00731 SprT SprT homologue  23.5      22 0.00048   24.3  -0.4   32  141-179   112-143 (146)
220 PF01155 HypA:  Hydrogenase exp  23.5      33 0.00071   22.4   0.4   11  114-124    71-81  (113)
221 PF10263 SprT-like:  SprT-like   23.4      24 0.00051   24.3  -0.3   11  141-151   123-133 (157)
222 COG4391 Uncharacterized protei  22.5      47   0.001   19.0   0.8   15  138-152    45-59  (62)
223 PF09963 DUF2197:  Uncharacteri  22.4      30 0.00064   19.5   0.0   10   84-93     29-38  (56)
224 COG1675 TFA1 Transcription ini  22.3 1.2E+02  0.0026   21.7   3.1   16  137-152   109-124 (176)
225 smart00064 FYVE Protein presen  22.2      50  0.0011   18.9   1.0   10  115-124    12-21  (68)
226 PLN03238 probable histone acet  22.0      83  0.0018   24.4   2.3   24  168-191    47-70  (290)
227 PLN02294 cytochrome c oxidase   21.8      43 0.00094   23.6   0.7   16  138-153   138-153 (174)
228 COG4640 Predicted membrane pro  21.7      69  0.0015   26.0   1.9   17  171-187    17-33  (465)
229 PRK03681 hypA hydrogenase nick  21.2      41 0.00088   22.0   0.5   10  114-123    71-80  (114)
230 PHA02998 RNA polymerase subuni  21.0      22 0.00048   25.2  -0.8    9  170-178   172-180 (195)
231 PF10013 DUF2256:  Uncharacteri  21.0      65  0.0014   16.9   1.1   15  171-185    10-24  (42)
232 PF07295 DUF1451:  Protein of u  20.9      28 0.00061   24.0  -0.3   28  141-178   112-139 (146)
233 PRK14892 putative transcriptio  20.6      34 0.00073   21.8   0.0   11  170-180    43-53  (99)
234 KOG4118|consensus               20.2      53  0.0011   19.0   0.8   24  142-165    39-62  (74)
235 PF04810 zf-Sec23_Sec24:  Sec23  20.1      18 0.00039   18.6  -1.1    8  141-148    24-31  (40)

No 1  
>KOG2462|consensus
Probab=99.97  E-value=4.3e-32  Score=195.29  Aligned_cols=134  Identities=34%  Similarity=0.706  Sum_probs=126.1

Q ss_pred             cccccccccccCChhHHHHHHhhcCC---CCcccCchhhhhcCCHHHHHhHHHHhCCcceecCcCccccCChhhHHHHHh
Q psy11591         58 THQCNHCGRAFSDKSNLTVHIRTHTD---EKKYMCELCGAEFAQWATLYNHKFTHNDIKFKCNYCEKVYNNPSNLQRHIK  134 (220)
Q Consensus        58 ~~~C~~C~~~~~~~~~l~~h~~~~~~---~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~C~~C~~~f~~~~~l~~H~~  134 (220)
                      .|.|++|++.+.+.++|..|.+.|-.   .+.+.|..||+++.+...|+.|+++|. .+..|.+||+.|...+.|+.|+|
T Consensus       130 r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~-l~c~C~iCGKaFSRPWLLQGHiR  208 (279)
T KOG2462|consen  130 RYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT-LPCECGICGKAFSRPWLLQGHIR  208 (279)
T ss_pred             ceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC-CCcccccccccccchHHhhcccc
Confidence            48999999999999999999988754   577999999999999999999999996 67899999999999999999999


Q ss_pred             hhcCCCceeCCccccccCCHHHHHHHHHHcCCCCcccccccccccCchhHHHHHhhhc
Q psy11591        135 THTDNSLYICEICGKDFGTARYLKRHKDTHNSVNTFVCEVCNTGFKVKKHLTQHYKSH  192 (220)
Q Consensus       135 ~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h  192 (220)
                      +|+|||||.|+.|+++|...++|+.|+++|.+.++|+|..|+|+|...+.|.+|.+.-
T Consensus       209 THTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~ES~  266 (279)
T KOG2462|consen  209 THTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSESA  266 (279)
T ss_pred             cccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhhhc
Confidence            9999999999999999999999999999999999999999999999999999998763


No 2  
>KOG1074|consensus
Probab=99.97  E-value=1.7e-31  Score=216.21  Aligned_cols=141  Identities=34%  Similarity=0.731  Sum_probs=130.2

Q ss_pred             ccccccccccCChhHHHHHHhhcCCCCcccCchhhhhcCCHHHHHhHHHHhCC-----cceecC---cCccccCChhhHH
Q psy11591         59 HQCNHCGRAFSDKSNLTVHIRTHTDEKKYMCELCGAEFAQWATLYNHKFTHND-----IKFKCN---YCEKVYNNPSNLQ  130 (220)
Q Consensus        59 ~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~-----~~~~C~---~C~~~f~~~~~l~  130 (220)
                      .+|-.|.+++.-.+.|+.|.++|+|++||+|.+||++|..+.+|+.|+..|..     .++.|+   +|-+.|.+...|.
T Consensus       606 NqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn~V~lp  685 (958)
T KOG1074|consen  606 NQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTNAVTLP  685 (958)
T ss_pred             cceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhccccccccccc
Confidence            47999999999999999999999999999999999999999999999999943     348899   9999999999999


Q ss_pred             HHHhhhcC------------------------------------------------------------------------
Q psy11591        131 RHIKTHTD------------------------------------------------------------------------  138 (220)
Q Consensus       131 ~H~~~h~~------------------------------------------------------------------------  138 (220)
                      +|+++|.+                                                                        
T Consensus       686 QhIriH~~~~~s~g~~a~e~~~~adq~~~~qk~~~~a~~f~~~~se~~~~~s~~~~~~~~~t~t~~~~~tp~~~e~~~~~  765 (958)
T KOG1074|consen  686 QHIRIHLGGQISNGGTAAEGILAADQCSSCQKTFSDARSFSQQISEQPSPESEPDEQMDERTETEELDVTPPPPENSCGR  765 (958)
T ss_pred             ceEEeecCCCCCCCcccccccchhcccchhhhcccccccchhhhhccCCcccCCcccccccccccccccCCCcccccccc
Confidence            99999873                                                                        


Q ss_pred             --------------------------------------------------------------------------------
Q psy11591        139 --------------------------------------------------------------------------------  138 (220)
Q Consensus       139 --------------------------------------------------------------------------------  138 (220)
                                                                                                      
T Consensus       766 ~~~~e~~i~~~g~te~asa~~~~vg~~s~~~~~~~~~~T~~k~~~~~~~~~~~~~~~v~~~pvl~~~~~~~l~eg~~t~~  845 (958)
T KOG1074|consen  766 ELEGEMAISVRGSTEEASANLDEVGTVSAAGEAGEEDDTSEKPTQASSFPGEILAPSVNMDPVLWNQETSMLNEGLATKT  845 (958)
T ss_pred             ccCcccccccccchhhhhcChhhhcCccccchhhhhcccCCCCcccccCCCcCCccccccCchhhccccccccccccccc
Confidence                                                                                            


Q ss_pred             -------------------------------CCceeCCccccccCCHHHHHHHHHHcCCCCcccccccccccCchhHHHH
Q psy11591        139 -------------------------------NSLYICEICGKDFGTARYLKRHKDTHNSVNTFVCEVCNTGFKVKKHLTQ  187 (220)
Q Consensus       139 -------------------------------~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~  187 (220)
                                                     .....|.+||+.|..++.|..|+++|++++||.|.+|++.|.....|..
T Consensus       846 n~~t~~~~~~sv~qs~~~p~l~p~l~~~~pvnn~h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnLKv  925 (958)
T KOG1074|consen  846 NEITPEGPADSVIQSGGVPTLEPSLGRPGPVNNAHVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNLKV  925 (958)
T ss_pred             ccccCCCcchhhhhhccccccCCCCCCCCcccchhhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhhhh
Confidence                                           1116799999999999999999999999999999999999999999999


Q ss_pred             HhhhcccccCCC
Q psy11591        188 HYKSHSMFIPPE  199 (220)
Q Consensus       188 H~~~h~~~~~~~  199 (220)
                      ||.+|....|+.
T Consensus       926 HMgtH~w~q~~s  937 (958)
T KOG1074|consen  926 HMGTHMWVQPPS  937 (958)
T ss_pred             hhccccccCCCc
Confidence            999999888775


No 3  
>KOG2462|consensus
Probab=99.95  E-value=8.2e-29  Score=178.42  Aligned_cols=133  Identities=33%  Similarity=0.678  Sum_probs=122.8

Q ss_pred             CCcccccchhhcCChhHHHHHHhhhcC---CCCcccccccccccCChhHHHHHHhhcCCCCcccCchhhhhcCCHHHHHh
Q psy11591         28 RPHVCHVCSKSFRNRGKLNVHYKRVHE---RIRTHQCNHCGRAFSDKSNLTVHIRTHTDEKKYMCELCGAEFAQWATLYN  104 (220)
Q Consensus        28 ~~~~C~~C~~~~~~~~~l~~H~~~~h~---~~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~  104 (220)
                      ..|+|+.|++.+.+.+.|.+|. +.|-   ..+.+.|++|++.+.+...|..|+++|.  .+..|.+||+.|...+.|+.
T Consensus       129 ~r~~c~eCgk~ysT~snLsrHk-Q~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQG  205 (279)
T KOG2462|consen  129 PRYKCPECGKSYSTSSNLSRHK-QTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQG  205 (279)
T ss_pred             Cceeccccccccccccccchhh-cccccccccccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhc
Confidence            4489999999999999999996 5553   3567999999999999999999999986  68999999999999999999


Q ss_pred             HHHHh-CCcceecCcCccccCChhhHHHHHhhhcCCCceeCCccccccCCHHHHHHHHHH
Q psy11591        105 HKFTH-NDIKFKCNYCEKVYNNPSNLQRHIKTHTDNSLYICEICGKDFGTARYLKRHKDT  163 (220)
Q Consensus       105 h~~~~-~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~  163 (220)
                      |+++| +++||.|+.|+++|.++++|+.|+++|.+.+.|.|+.|+|.|+..+.|.+|...
T Consensus       206 HiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  206 HIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             ccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhhh
Confidence            99999 899999999999999999999999999999999999999999999999999864


No 4  
>KOG3608|consensus
Probab=99.92  E-value=2.3e-25  Score=165.15  Aligned_cols=190  Identities=28%  Similarity=0.554  Sum_probs=169.8

Q ss_pred             CCccchhhhcCHHHHHHHHHHhhCCCCcccccchhhcCChhHHHHHHhhh-cCCCCcccccccccccCChhHHHHHHhhc
Q psy11591          3 KCPQCGALLKNIWSLREHIMIHTGERPHVCHVCSKSFRNRGKLNVHYKRV-HERIRTHQCNHCGRAFSDKSNLTVHIRTH   81 (220)
Q Consensus         3 ~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~~-h~~~~~~~C~~C~~~~~~~~~l~~h~~~~   81 (220)
                      .+..|...+.++..|+.|++.|++++...|+.||..|.+...|..|.++- -....+|+|..|.+.|.+...|..|+..|
T Consensus       181 ~W~~Ct~~~~~k~~LreH~r~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rH  260 (467)
T KOG3608|consen  181 NWAMCTKHMGNKYRLREHIRTHSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRH  260 (467)
T ss_pred             cchhhhhhhccHHHHHHHHHhcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHh
Confidence            34678899999999999999999999999999999999999999998543 33556899999999999999999999887


Q ss_pred             CCCCcccCchhhhhcCCHHHHHhHHHHh--CCcceecCcCccccCChhhHHHHHhhhcCCCceeCCc--cccccCCHHHH
Q psy11591         82 TDEKKYMCELCGAEFAQWATLYNHKFTH--NDIKFKCNYCEKVYNNPSNLQRHIKTHTDNSLYICEI--CGKDFGTARYL  157 (220)
Q Consensus        82 ~~~~~~~C~~C~~~f~~~~~l~~h~~~~--~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~--C~~~f~~~~~l  157 (220)
                      .  .-|+|+.|+.+....+.|..|++..  ..+||+|..|++.+.+.+.|.+|...|. +..|.|..  |..+|.+...+
T Consensus       261 v--n~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~~q~  337 (467)
T KOG3608|consen  261 V--NCYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTYTQM  337 (467)
T ss_pred             h--hcccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHHHHHH
Confidence            4  4599999999999999999999876  6899999999999999999999999887 78899988  99999999999


Q ss_pred             HHHHHHcC-CCC--cccccccccccCchhHHHHHhhhcccc
Q psy11591        158 KRHKDTHN-SVN--TFVCEVCNTGFKVKKHLTQHYKSHSMF  195 (220)
Q Consensus       158 ~~H~~~h~-~~~--~~~C~~C~~~f~~~~~l~~H~~~h~~~  195 (220)
                      ++|.+.++ |.+  +|.|-.|++.|.+..+|.+|+..-++.
T Consensus       338 ~~H~~evhEg~np~~Y~CH~Cdr~ft~G~~L~~HL~kkH~f  378 (467)
T KOG3608|consen  338 RRHFLEVHEGNNPILYACHCCDRFFTSGKSLSAHLMKKHGF  378 (467)
T ss_pred             HHHHHHhccCCCCCceeeecchhhhccchhHHHHHHHhhcc
Confidence            99987655 654  599999999999999999998554443


No 5  
>KOG3623|consensus
Probab=99.90  E-value=2.3e-24  Score=172.91  Aligned_cols=106  Identities=33%  Similarity=0.652  Sum_probs=90.4

Q ss_pred             CCCccchhhhcCHHHHHHHHHH-h-hCCCCcccccchhhcCChhHHHHHHhhhcCC------------CCcccccccccc
Q psy11591          2 FKCPQCGALLKNIWSLREHIMI-H-TGERPHVCHVCSKSFRNRGKLNVHYKRVHER------------IRTHQCNHCGRA   67 (220)
Q Consensus         2 ~~C~~C~~~f~~~~~l~~H~~~-~-~~~~~~~C~~C~~~~~~~~~l~~H~~~~h~~------------~~~~~C~~C~~~   67 (220)
                      ..|++|++.+.+...|..|+.. | ..+..|.|..|..+|..+..|..||..+-.+            .+.|+|.+|++.
T Consensus       211 ltcpycdrgykrltslkeHikyrhekne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgKA  290 (1007)
T KOG3623|consen  211 LTCPYCDRGYKRLTSLKEHIKYRHEKNEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECGKA  290 (1007)
T ss_pred             hcchhHHHHHHHHHHHHHHHHHHHhhCCCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccchh
Confidence            5799999999999999999874 3 3345589999999999999999998543222            245999999999


Q ss_pred             cCChhHHHHHHhhcCCCCcccCchhhhhcCCHHHHHhHHH
Q psy11591         68 FSDKSNLTVHIRTHTDEKKYMCELCGAEFAQWATLYNHKF  107 (220)
Q Consensus        68 ~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~  107 (220)
                      |..+-.|..|+++|.|++||.|+.|++.|.....+..|+.
T Consensus       291 FKfKHHLKEHlRIHSGEKPfeCpnCkKRFSHSGSySSHmS  330 (1007)
T KOG3623|consen  291 FKFKHHLKEHLRIHSGEKPFECPNCKKRFSHSGSYSSHMS  330 (1007)
T ss_pred             hhhHHHHHhhheeecCCCCcCCcccccccccCCccccccc
Confidence            9999999999999999999999999999998888888853


No 6  
>KOG3608|consensus
Probab=99.89  E-value=1.2e-22  Score=150.80  Aligned_cols=187  Identities=26%  Similarity=0.565  Sum_probs=165.7

Q ss_pred             CccchhhhcCHHHHHHHHHHhhCC------------CC-ccc--ccchhhcCChhHHHHHHhhhcCCCCccccccccccc
Q psy11591          4 CPQCGALLKNIWSLREHIMIHTGE------------RP-HVC--HVCSKSFRNRGKLNVHYKRVHERIRTHQCNHCGRAF   68 (220)
Q Consensus         4 C~~C~~~f~~~~~l~~H~~~~~~~------------~~-~~C--~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~~~   68 (220)
                      +..|++.|.+...+..|+..|.--            +| +.|  ..|-+.+.++..|+.|. +.|++++-.-|+.|+.-|
T Consensus       139 WedCe~~F~s~~ef~dHV~~H~l~ceyd~~~~~~D~~pv~~C~W~~Ct~~~~~k~~LreH~-r~Hs~eKvvACp~Cg~~F  217 (467)
T KOG3608|consen  139 WEDCEREFVSIVEFQDHVVKHALFCEYDIQKTPEDERPVTMCNWAMCTKHMGNKYRLREHI-RTHSNEKVVACPHCGELF  217 (467)
T ss_pred             hhhcCCcccCHHHHHHHHHHhhhhhhhhhhhCCCCCCceeeccchhhhhhhccHHHHHHHH-HhcCCCeEEecchHHHHh
Confidence            367999999999999998776432            12 334  45899999999999997 899999999999999999


Q ss_pred             CChhHHHHHHhhcC--CCCcccCchhhhhcCCHHHHHhHHHHhCCcceecCcCccccCChhhHHHHHhh-hcCCCceeCC
Q psy11591         69 SDKSNLTVHIRTHT--DEKKYMCELCGAEFAQWATLYNHKFTHNDIKFKCNYCEKVYNNPSNLQRHIKT-HTDNSLYICE  145 (220)
Q Consensus        69 ~~~~~l~~h~~~~~--~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~-h~~~~~~~C~  145 (220)
                      .+...|..|++..+  ...+|.|..|.+.|..+..|..|+..|- .-|.|+.|+-.....++|..|++. |...+||+|+
T Consensus       218 ~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHv-n~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd  296 (467)
T KOG3608|consen  218 RTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHV-NCYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCD  296 (467)
T ss_pred             ccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhh-hcccccccccCCCChHHHHHHHHhhhccCCCcccc
Confidence            99999999987654  4678999999999999999999998883 358999999999999999999995 6789999999


Q ss_pred             ccccccCCHHHHHHHHHHcCCCCcccccc--cccccCchhHHHHHhhhcc
Q psy11591        146 ICGKDFGTARYLKRHKDTHNSVNTFVCEV--CNTGFKVKKHLTQHYKSHS  193 (220)
Q Consensus       146 ~C~~~f~~~~~l~~H~~~h~~~~~~~C~~--C~~~f~~~~~l~~H~~~h~  193 (220)
                      .|++.+...+.|.+|...|. +-.|+|..  |.++|.++.+|++|++.++
T Consensus       297 ~Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~~q~~~H~~evh  345 (467)
T KOG3608|consen  297 ECDTRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTYTQMRRHFLEVH  345 (467)
T ss_pred             chhhhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHHHHHHHHHHHHhc
Confidence            99999999999999999888 67899987  9999999999999987766


No 7  
>KOG3623|consensus
Probab=99.85  E-value=8.2e-22  Score=158.39  Aligned_cols=77  Identities=26%  Similarity=0.608  Sum_probs=70.5

Q ss_pred             CCCccchhhhcCHHHHHHHHHHhhCC-------------CCcccccchhhcCChhHHHHHHhhhcCCCCccccccccccc
Q psy11591          2 FKCPQCGALLKNIWSLREHIMIHTGE-------------RPHVCHVCSKSFRNRGKLNVHYKRVHERIRTHQCNHCGRAF   68 (220)
Q Consensus         2 ~~C~~C~~~f~~~~~l~~H~~~~~~~-------------~~~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~~~   68 (220)
                      |.|..|...|..+..|.+|+..|...             +.|+|..|++.|..+-.|..|+ +.|.|++||.|+.|++.|
T Consensus       241 fsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgKAFKfKHHLKEHl-RIHSGEKPfeCpnCkKRF  319 (1007)
T KOG3623|consen  241 FSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECGKAFKFKHHLKEHL-RIHSGEKPFECPNCKKRF  319 (1007)
T ss_pred             CcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccchhhhhHHHHHhhh-eeecCCCCcCCccccccc
Confidence            67999999999999999999988643             4599999999999999999997 899999999999999999


Q ss_pred             CChhHHHHHHh
Q psy11591         69 SDKSNLTVHIR   79 (220)
Q Consensus        69 ~~~~~l~~h~~   79 (220)
                      ...+++..|+.
T Consensus       320 SHSGSySSHmS  330 (1007)
T KOG3623|consen  320 SHSGSYSSHMS  330 (1007)
T ss_pred             ccCCccccccc
Confidence            99988888864


No 8  
>KOG1074|consensus
Probab=99.81  E-value=1e-20  Score=154.23  Aligned_cols=170  Identities=29%  Similarity=0.545  Sum_probs=142.5

Q ss_pred             CCCCccchhhhcCHHHHHHHHHHhhCCCCcccccchhhcCChhHHHHHHhhhcCCC----Cccccc---ccccccCChhH
Q psy11591          1 MFKCPQCGALLKNIWSLREHIMIHTGERPHVCHVCSKSFRNRGKLNVHYKRVHERI----RTHQCN---HCGRAFSDKSN   73 (220)
Q Consensus         1 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~~h~~~----~~~~C~---~C~~~~~~~~~   73 (220)
                      |-+|-.|-+.......|+.|.+.|++++||+|.+||+.|.++++|+.|| ..|...    ..+.|+   +|.+.|.+.-.
T Consensus       605 PNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~-~vHka~p~~R~q~ScP~~~ic~~kftn~V~  683 (958)
T KOG1074|consen  605 PNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHM-SVHKAKPPARVQFSCPSTFICQKKFTNAVT  683 (958)
T ss_pred             ccceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcc-cccccCccccccccCCchhhhccccccccc
Confidence            3468899999999999999999999999999999999999999999998 666543    458899   99999999999


Q ss_pred             HHHHHhhcCCC-C------------cccCchhhhhcCCHHHHHhHHHHhC-Cc---------------------------
Q psy11591         74 LTVHIRTHTDE-K------------KYMCELCGAEFAQWATLYNHKFTHN-DI---------------------------  112 (220)
Q Consensus        74 l~~h~~~~~~~-~------------~~~C~~C~~~f~~~~~l~~h~~~~~-~~---------------------------  112 (220)
                      +..|++.|.+. .            .-+|..|.+.|.+...+..++..+. ..                           
T Consensus       684 lpQhIriH~~~~~s~g~~a~e~~~~adq~~~~qk~~~~a~~f~~~~se~~~~~s~~~~~~~~~t~t~~~~~tp~~~e~~~  763 (958)
T KOG1074|consen  684 LPQHIRIHLGGQISNGGTAAEGILAADQCSSCQKTFSDARSFSQQISEQPSPESEPDEQMDERTETEELDVTPPPPENSC  763 (958)
T ss_pred             ccceEEeecCCCCCCCcccccccchhcccchhhhcccccccchhhhhccCCcccCCcccccccccccccccCCCcccccc
Confidence            99999998732 1            1356667777755555555443330 00                           


Q ss_pred             --------------------------------------------------------------------------------
Q psy11591        113 --------------------------------------------------------------------------------  112 (220)
Q Consensus       113 --------------------------------------------------------------------------------  112 (220)
                                                                                                      
T Consensus       764 ~~~~~~e~~i~~~g~te~asa~~~~vg~~s~~~~~~~~~~T~~k~~~~~~~~~~~~~~~v~~~pvl~~~~~~~l~eg~~t  843 (958)
T KOG1074|consen  764 GRELEGEMAISVRGSTEEASANLDEVGTVSAAGEAGEEDDTSEKPTQASSFPGEILAPSVNMDPVLWNQETSMLNEGLAT  843 (958)
T ss_pred             ccccCcccccccccchhhhhcChhhhcCccccchhhhhcccCCCCcccccCCCcCCccccccCchhhccccccccccccc
Confidence                                                                                            


Q ss_pred             -----------------------------------ceecCcCccccCChhhHHHHHhhhcCCCceeCCccccccCCHHHH
Q psy11591        113 -----------------------------------KFKCNYCEKVYNNPSNLQRHIKTHTDNSLYICEICGKDFGTARYL  157 (220)
Q Consensus       113 -----------------------------------~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l  157 (220)
                                                         ...|..||+.|.+.+.|..|+++|++++||.|.+|+++|....+|
T Consensus       844 ~~n~~t~~~~~~sv~qs~~~p~l~p~l~~~~pvnn~h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnL  923 (958)
T KOG1074|consen  844 KTNEITPEGPADSVIQSGGVPTLEPSLGRPGPVNNAHVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNL  923 (958)
T ss_pred             ccccccCCCcchhhhhhccccccCCCCCCCCcccchhhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhh
Confidence                                               145999999999999999999999999999999999999999999


Q ss_pred             HHHHHHcCCCCccc
Q psy11591        158 KRHKDTHNSVNTFV  171 (220)
Q Consensus       158 ~~H~~~h~~~~~~~  171 (220)
                      +.|+.+|.+..++.
T Consensus       924 KvHMgtH~w~q~~s  937 (958)
T KOG1074|consen  924 KVHMGTHMWVQPPS  937 (958)
T ss_pred             hhhhccccccCCCc
Confidence            99999999887653


No 9  
>KOG3576|consensus
Probab=99.70  E-value=1.1e-17  Score=115.66  Aligned_cols=125  Identities=30%  Similarity=0.608  Sum_probs=90.3

Q ss_pred             CCCcccccchhhcCChhHHHHHHhhhcCCCCcccccccccccCChhHHHHHHhhcCCCCcccCchhhhhcCCHHHHHhHH
Q psy11591         27 ERPHVCHVCSKSFRNRGKLNVHYKRVHERIRTHQCNHCGRAFSDKSNLTVHIRTHTDEKKYMCELCGAEFAQWATLYNHK  106 (220)
Q Consensus        27 ~~~~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~h~  106 (220)
                      ...+.|..|++.|.....|..|+ ..|...+.+.|..||++|.+...|..|.++|+|.+||+|+.|+++|..+-.|..|+
T Consensus       115 ~d~ftCrvCgK~F~lQRmlnrh~-kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl  193 (267)
T KOG3576|consen  115 QDSFTCRVCGKKFGLQRMLNRHL-KCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHL  193 (267)
T ss_pred             CCeeeeehhhhhhhHHHHHHHHh-hhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHH
Confidence            34588999999999999999997 78888888999999999999999999999999999999999999999998888887


Q ss_pred             HHhCCcceecCcCccccCChhhHHHHHhhhcCCCceeCCccccccCCHHHHHHHHHHcCCCC
Q psy11591        107 FTHNDIKFKCNYCEKVYNNPSNLQRHIKTHTDNSLYICEICGKDFGTARYLKRHKDTHNSVN  168 (220)
Q Consensus       107 ~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~  168 (220)
                      +.-...+.           ...++     ....+.|.|..||..-.....+..|++.|+...
T Consensus       194 ~kvhgv~~-----------~yayk-----err~kl~vcedcg~t~~~~e~~~~h~~~~hp~S  239 (267)
T KOG3576|consen  194 KKVHGVQH-----------QYAYK-----ERRAKLYVCEDCGYTSERPEVYYLHLKLHHPFS  239 (267)
T ss_pred             HHHcCchH-----------HHHHH-----HhhhheeeecccCCCCCChhHHHHHHHhcCCCC
Confidence            53311110           00000     123344555555555555555555555555443


No 10 
>KOG3576|consensus
Probab=99.70  E-value=5.9e-18  Score=116.95  Aligned_cols=115  Identities=30%  Similarity=0.591  Sum_probs=102.8

Q ss_pred             CCCcccCchhhhhcCCHHHHHhHHHHh-CCcceecCcCccccCChhhHHHHHhhhcCCCceeCCccccccCCHHHHHHHH
Q psy11591         83 DEKKYMCELCGAEFAQWATLYNHKFTH-NDIKFKCNYCEKVYNNPSNLQRHIKTHTDNSLYICEICGKDFGTARYLKRHK  161 (220)
Q Consensus        83 ~~~~~~C~~C~~~f~~~~~l~~h~~~~-~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~  161 (220)
                      +...|.|.+|++.|....-|..|+.-| .-+.+-|..||+.|.+.-.|.+|+++|+|-+||+|..|+++|...-.|..|.
T Consensus       114 d~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl  193 (267)
T KOG3576|consen  114 DQDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHL  193 (267)
T ss_pred             CCCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHH
Confidence            345589999999999999999999998 4567899999999999999999999999999999999999999999999998


Q ss_pred             HHcCC-----------CCcccccccccccCchhHHHHHhhhcccccC
Q psy11591        162 DTHNS-----------VNTFVCEVCNTGFKVKKHLTQHYKSHSMFIP  197 (220)
Q Consensus       162 ~~h~~-----------~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~  197 (220)
                      +..+|           ++.|.|..||++-........|++.|+...|
T Consensus       194 ~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp~Sp  240 (267)
T KOG3576|consen  194 KKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHPFSP  240 (267)
T ss_pred             HHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCCCCH
Confidence            76665           3569999999999999999999999886543


No 11 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.47  E-value=1.6e-13  Score=111.08  Aligned_cols=145  Identities=20%  Similarity=0.411  Sum_probs=113.4

Q ss_pred             cccccchhhcCChhHHHHHHhhhcCCCCcccccc--cccccCChhHHHHHHhhcCCCCcccCchhhhhcCCHHHHHhHHH
Q psy11591         30 HVCHVCSKSFRNRGKLNVHYKRVHERIRTHQCNH--CGRAFSDKSNLTVHIRTHTDEKKYMCELCGAEFAQWATLYNHKF  107 (220)
Q Consensus        30 ~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~--C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~  107 (220)
                      ..|+.|.... ....|..|.  .+-......|+.  |+..|.. ..+..|         +.|+.|++.|. ...+..|+.
T Consensus       408 V~C~NC~~~i-~l~~l~lHe--~~C~r~~V~Cp~~~Cg~v~~r-~el~~H---------~~C~~Cgk~f~-~s~LekH~~  473 (567)
T PLN03086        408 VECRNCKHYI-PSRSIALHE--AYCSRHNVVCPHDGCGIVLRV-EEAKNH---------VHCEKCGQAFQ-QGEMEKHMK  473 (567)
T ss_pred             EECCCCCCcc-chhHHHHHH--hhCCCcceeCCcccccceeec-cccccC---------ccCCCCCCccc-hHHHHHHHH
Confidence            5698888854 456677885  334445677885  9888743 333333         58999999996 677899999


Q ss_pred             HhCCcceecCcCccccCChhhHHHHHhhhcCCCceeCCccccccC----------CHHHHHHHHHHcCCCCccccccccc
Q psy11591        108 THNDIKFKCNYCEKVYNNPSNLQRHIKTHTDNSLYICEICGKDFG----------TARYLKRHKDTHNSVNTFVCEVCNT  177 (220)
Q Consensus       108 ~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~----------~~~~l~~H~~~h~~~~~~~C~~C~~  177 (220)
                      .+ ..++.|+ |+..+ ....|..|+..|.+++++.|++|++.+.          ..+.|..|..++ |.+++.|..||+
T Consensus       474 ~~-Hkpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G~rt~~C~~Cgk  549 (567)
T PLN03086        474 VF-HEPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC-GSRTAPCDSCGR  549 (567)
T ss_pred             hc-CCCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHhc-CCcceEccccCC
Confidence            87 4889999 99765 5689999999999999999999999985          246899999885 889999999999


Q ss_pred             ccCchhHHHHHhhhcc
Q psy11591        178 GFKVKKHLTQHYKSHS  193 (220)
Q Consensus       178 ~f~~~~~l~~H~~~h~  193 (220)
                      .+ ...+|..|+...|
T Consensus       550 ~V-rlrdm~~H~~~~h  564 (567)
T PLN03086        550 SV-MLKEMDIHQIAVH  564 (567)
T ss_pred             ee-eehhHHHHHHHhh
Confidence            87 5667888876544


No 12 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.39  E-value=1.4e-12  Score=105.80  Aligned_cols=144  Identities=17%  Similarity=0.438  Sum_probs=111.8

Q ss_pred             CCccchhhhcCHHHHHHHHHHhhCCCCccccc--chhhcCChhHHHHHHhhhcCCCCcccccccccccCChhHHHHHHhh
Q psy11591          3 KCPQCGALLKNIWSLREHIMIHTGERPHVCHV--CSKSFRNRGKLNVHYKRVHERIRTHQCNHCGRAFSDKSNLTVHIRT   80 (220)
Q Consensus         3 ~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~--C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~   80 (220)
                      .|+.|.+..+. ..|..|...... ....|+.  |+..|. ...+..          .+.|+.|++.|. ...+..|+..
T Consensus       409 ~C~NC~~~i~l-~~l~lHe~~C~r-~~V~Cp~~~Cg~v~~-r~el~~----------H~~C~~Cgk~f~-~s~LekH~~~  474 (567)
T PLN03086        409 ECRNCKHYIPS-RSIALHEAYCSR-HNVVCPHDGCGIVLR-VEEAKN----------HVHCEKCGQAFQ-QGEMEKHMKV  474 (567)
T ss_pred             ECCCCCCccch-hHHHHHHhhCCC-cceeCCcccccceee-cccccc----------CccCCCCCCccc-hHHHHHHHHh
Confidence            48888887544 567788865433 4467985  999873 232333          368999999996 5789999999


Q ss_pred             cCCCCcccCchhhhhcCCHHHHHhHHHHh-CCcceecCcCccccC----------ChhhHHHHHhhhcCCCceeCCcccc
Q psy11591         81 HTDEKKYMCELCGAEFAQWATLYNHKFTH-NDIKFKCNYCEKVYN----------NPSNLQRHIKTHTDNSLYICEICGK  149 (220)
Q Consensus        81 ~~~~~~~~C~~C~~~f~~~~~l~~h~~~~-~~~~~~C~~C~~~f~----------~~~~l~~H~~~h~~~~~~~C~~C~~  149 (220)
                      ++  .++.|+ ||..+ .+..|..|+..+ ..+++.|+.|++.+.          ..+.|..|... .|.+++.|..||+
T Consensus       475 ~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~-CG~rt~~C~~Cgk  549 (567)
T PLN03086        475 FH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESI-CGSRTAPCDSCGR  549 (567)
T ss_pred             cC--CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHh-cCCcceEccccCC
Confidence            75  889999 99755 678999999888 789999999999985          24589999888 4999999999999


Q ss_pred             ccCCHHHHHHHHHHcCC
Q psy11591        150 DFGTARYLKRHKDTHNS  166 (220)
Q Consensus       150 ~f~~~~~l~~H~~~h~~  166 (220)
                      .+... .+..|+...|.
T Consensus       550 ~Vrlr-dm~~H~~~~h~  565 (567)
T PLN03086        550 SVMLK-EMDIHQIAVHQ  565 (567)
T ss_pred             eeeeh-hHHHHHHHhhc
Confidence            98776 56788765543


No 13 
>PHA00733 hypothetical protein
Probab=99.19  E-value=4.5e-11  Score=79.70  Aligned_cols=55  Identities=25%  Similarity=0.464  Sum_probs=36.9

Q ss_pred             CCCceeCCccccccCCHHHHHHHHHHcCCCCcccccccccccCchhHHHHHhhhccc
Q psy11591        138 DNSLYICEICGKDFGTARYLKRHKDTHNSVNTFVCEVCNTGFKVKKHLTQHYKSHSM  194 (220)
Q Consensus       138 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~  194 (220)
                      +.+||.|+.|++.|.+.+.|..|++.+  ..+|.|..|++.|.....|..|+...|+
T Consensus        70 ~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         70 AVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             CCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCHHHHHHHHHHhcC
Confidence            356677777777777777777776654  2356777777777777777777665554


No 14 
>PHA00733 hypothetical protein
Probab=99.19  E-value=2.5e-11  Score=80.92  Aligned_cols=93  Identities=15%  Similarity=0.289  Sum_probs=74.3

Q ss_pred             hHHHHHHhhcCCCCcccCchhhhhcCCHHHHHhH--H----HHhCCcceecCcCccccCChhhHHHHHhhhcCCCceeCC
Q psy11591         72 SNLTVHIRTHTDEKKYMCELCGAEFAQWATLYNH--K----FTHNDIKFKCNYCEKVYNNPSNLQRHIKTHTDNSLYICE  145 (220)
Q Consensus        72 ~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~h--~----~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~  145 (220)
                      .+|..+-..-...+++.|.+|+..|.....+..+  +    ..++..||.|+.|++.|.+...|..|++.+  +.+|.|+
T Consensus        26 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~  103 (128)
T PHA00733         26 EELKRYHSLTPEQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCP  103 (128)
T ss_pred             HHhhhhhcCChhhhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCC
Confidence            3444433333346779999999998887777666  2    233678999999999999999999999976  3579999


Q ss_pred             ccccccCCHHHHHHHHHHcCC
Q psy11591        146 ICGKDFGTARYLKRHKDTHNS  166 (220)
Q Consensus       146 ~C~~~f~~~~~l~~H~~~h~~  166 (220)
                      .|++.|.....|..|+...|+
T Consensus       104 ~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733        104 VCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             CCCCccCCHHHHHHHHHHhcC
Confidence            999999999999999988775


No 15 
>PHA02768 hypothetical protein; Provisional
Probab=99.04  E-value=1.2e-10  Score=64.23  Aligned_cols=43  Identities=21%  Similarity=0.372  Sum_probs=32.2

Q ss_pred             eeCCccccccCCHHHHHHHHHHcCCCCcccccccccccCchhHHH
Q psy11591        142 YICEICGKDFGTARYLKRHKDTHNSVNTFVCEVCNTGFKVKKHLT  186 (220)
Q Consensus       142 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~  186 (220)
                      |.|+.||+.|+..+.|..|+++|+  ++|.|..|++.|...+.|.
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceecccceeE
Confidence            677778888888888888887777  5777777877777665554


No 16 
>KOG3993|consensus
Probab=99.00  E-value=2.1e-11  Score=93.51  Aligned_cols=193  Identities=17%  Similarity=0.229  Sum_probs=115.6

Q ss_pred             CCCccchhhhcCHHHHHHHHHHhhCCCCcccccchhhcCChhHHHHHHhhhcCCCCcccc---cccccccCChhHHHHHH
Q psy11591          2 FKCPQCGALLKNIWSLREHIMIHTGERPHVCHVCSKSFRNRGKLNVHYKRVHERIRTHQC---NHCGRAFSDKSNLTVHI   78 (220)
Q Consensus         2 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~~C---~~C~~~~~~~~~l~~h~   78 (220)
                      |.|..|...|.+...|.+|.-.-..--.|+|++|+|+|....+|..|. +.|......-=   +-=.+...+....+.--
T Consensus       268 yiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHR-RWHKPR~eaa~a~~~P~k~~~~~rae~~ea~  346 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHR-RWHKPRPEAAKAGSPPPKQAVETRAEVQEAE  346 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhh-cccCCchhhhhcCCCChhhhhhhhhhhhhcc
Confidence            678888888888888888865444444588999999998888888884 67743321000   00000000111111000


Q ss_pred             h--hcCCCCcccCchhhhhcCCHHHHHhHHHHhCCcc------------------eecCcCccccCChhhHHHHHhhhcC
Q psy11591         79 R--THTDEKKYMCELCGAEFAQWATLYNHKFTHNDIK------------------FKCNYCEKVYNNPSNLQRHIKTHTD  138 (220)
Q Consensus        79 ~--~~~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~------------------~~C~~C~~~f~~~~~l~~H~~~h~~  138 (220)
                      +  .-..+..|.|..|++.|....-|+.|+..|...+                  +.+..++-.+...+.-..+...+.+
T Consensus       347 rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~~~k~~a~~f~~s~~~~l~~~~~~~a~h~~a~~~~g~~vl~~a~  426 (500)
T KOG3993|consen  347 RSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAPLAKEKAPKFLLSRVIPLMHFNQAVATHSSASDSHGDEVLYVAG  426 (500)
T ss_pred             ccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccccchhcccCcchhhcccccccccccccccccccccccceeeeec
Confidence            0  0022346999999999999999999987773211                  2334444333333221112111111


Q ss_pred             -CCceeCCccccccCCHHHHHHHHHHcCCCCcccccccccccCchhHHHHHhhhcccc
Q psy11591        139 -NSLYICEICGKDFGTARYLKRHKDTHNSVNTFVCEVCNTGFKVKKHLTQHYKSHSMF  195 (220)
Q Consensus       139 -~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~  195 (220)
                       .....+++++..+.++..--.+.+.-..+..|.|.+|.-+|.+...|.+|+...|..
T Consensus       427 sael~~pp~~~~ppsss~~sgg~~rlg~~~q~f~~ky~~atfyss~~ltrhin~~Hps  484 (500)
T KOG3993|consen  427 SAELELPPYDGSPPSSSGSSGGYGRLGIAEQGFTCKYCPATFYSSPGLTRHINKCHPS  484 (500)
T ss_pred             cccccCCCCCCCCcccCCCCCccccccchhhccccccchHhhhcCcchHhHhhhcChH
Confidence             122357788877776665545555555567799999999999999999998776543


No 17 
>KOG3993|consensus
Probab=98.95  E-value=7.2e-11  Score=90.68  Aligned_cols=171  Identities=13%  Similarity=0.106  Sum_probs=90.1

Q ss_pred             cccccchhhcCChhHHHHHHhhhcCCCCcccccccccccCChhHHHHHHhhcCCCCccc---CchhhhhcCCHHHHHhHH
Q psy11591         30 HVCHVCSKSFRNRGKLNVHYKRVHERIRTHQCNHCGRAFSDKSNLTVHIRTHTDEKKYM---CELCGAEFAQWATLYNHK  106 (220)
Q Consensus        30 ~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~---C~~C~~~f~~~~~l~~h~  106 (220)
                      |.|.+|...|.+...|..|. =.-.....|.|++|++.|.-..+|..|.+.|-....-.   -+.-..........+.-.
T Consensus       268 yiCqLCK~kYeD~F~LAQHr-C~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~  346 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQHR-CPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAE  346 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhcc-CCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhcc
Confidence            77888888888888888883 22333345888888888888888888887774432111   000000000000000000


Q ss_pred             HH---hCCcceecCcCccccCChhhHHHHHhhhcCCCc-----------------eeCCccccccCCHHHHHHHHHHcCC
Q psy11591        107 FT---HNDIKFKCNYCEKVYNNPSNLQRHIKTHTDNSL-----------------YICEICGKDFGTARYLKRHKDTHNS  166 (220)
Q Consensus       107 ~~---~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~-----------------~~C~~C~~~f~~~~~l~~H~~~h~~  166 (220)
                      +.   ....-|.|.+|++.|.+...|++|+-+|.....                 +.+..+...+.....--.+.-.+.+
T Consensus       347 rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~~~k~~a~~f~~s~~~~l~~~~~~~a~h~~a~~~~g~~vl~~a~  426 (500)
T KOG3993|consen  347 RSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAPLAKEKAPKFLLSRVIPLMHFNQAVATHSSASDSHGDEVLYVAG  426 (500)
T ss_pred             ccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccccchhcccCcchhhcccccccccccccccccccccccceeeeec
Confidence            00   012258888899999888888888777653211                 1222222222211111111111111


Q ss_pred             -CCcccccccccccCchhHHHHHhhhcccccCCCCC
Q psy11591        167 -VNTFVCEVCNTGFKVKKHLTQHYKSHSMFIPPEQF  201 (220)
Q Consensus       167 -~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~  201 (220)
                       .....|.+++-.+.+...-.-+.+.-+.+.-|.|.
T Consensus       427 sael~~pp~~~~ppsss~~sgg~~rlg~~~q~f~~k  462 (500)
T KOG3993|consen  427 SAELELPPYDGSPPSSSGSSGGYGRLGIAEQGFTCK  462 (500)
T ss_pred             cccccCCCCCCCCcccCCCCCccccccchhhccccc
Confidence             12345677777676666655565555555555554


No 18 
>PHA02768 hypothetical protein; Provisional
Probab=98.91  E-value=5.3e-10  Score=61.69  Aligned_cols=42  Identities=14%  Similarity=0.374  Sum_probs=34.5

Q ss_pred             eecCcCccccCChhhHHHHHhhhcCCCceeCCccccccCCHHHH
Q psy11591        114 FKCNYCEKVYNNPSNLQRHIKTHTDNSLYICEICGKDFGTARYL  157 (220)
Q Consensus       114 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l  157 (220)
                      |.|+.||+.|...++|..|+++|+  ++|+|..|++.|...+.|
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceeccccee
Confidence            678888888888888888888888  578888888888876655


No 19 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.77  E-value=4e-09  Score=49.81  Aligned_cols=24  Identities=33%  Similarity=0.790  Sum_probs=13.4

Q ss_pred             HHHHHHHcCCCCcccccccccccC
Q psy11591        157 LKRHKDTHNSVNTFVCEVCNTGFK  180 (220)
Q Consensus       157 l~~H~~~h~~~~~~~C~~C~~~f~  180 (220)
                      |.+|+++|++++||.|+.|+++|.
T Consensus         2 l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    2 LRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHSSSSSEEESSSSEEES
T ss_pred             HHHHhhhcCCCCCCCCCCCcCeeC
Confidence            455555555555555555555553


No 20 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.72  E-value=9.6e-09  Score=48.49  Aligned_cols=26  Identities=50%  Similarity=1.034  Sum_probs=23.2

Q ss_pred             hHHHHHhhhcCCCceeCCccccccCC
Q psy11591        128 NLQRHIKTHTDNSLYICEICGKDFGT  153 (220)
Q Consensus       128 ~l~~H~~~h~~~~~~~C~~C~~~f~~  153 (220)
                      +|..|+++|++++||.|+.|++.|.+
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeCc
Confidence            47899999999999999999999864


No 21 
>PHA00616 hypothetical protein
Probab=98.72  E-value=4.2e-09  Score=55.31  Aligned_cols=32  Identities=25%  Similarity=0.401  Sum_probs=16.1

Q ss_pred             eeCCccccccCCHHHHHHHHHHcCCCCccccc
Q psy11591        142 YICEICGKDFGTARYLKRHKDTHNSVNTFVCE  173 (220)
Q Consensus       142 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~  173 (220)
                      |.|+.||+.|...+.|..|++.|+|++++.|+
T Consensus         2 YqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~   33 (44)
T PHA00616          2 YQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLE   33 (44)
T ss_pred             CccchhhHHHhhHHHHHHHHHHhcCCCcccee
Confidence            44555555555555555555555555544443


No 22 
>PHA00616 hypothetical protein
Probab=98.58  E-value=4.8e-08  Score=51.34  Aligned_cols=35  Identities=17%  Similarity=0.468  Sum_probs=30.1

Q ss_pred             CCCCccchhhhcCHHHHHHHHHHhhCCCCcccccc
Q psy11591          1 MFKCPQCGALLKNIWSLREHIMIHTGERPHVCHVC   35 (220)
Q Consensus         1 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C   35 (220)
                      ||+|+.||+.|...+.|..|++.|++++++.|+.-
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~~   35 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEYF   35 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccceeEE
Confidence            78899999999999999999999888888887654


No 23 
>PHA00732 hypothetical protein
Probab=98.47  E-value=1.3e-07  Score=57.38  Aligned_cols=44  Identities=30%  Similarity=0.557  Sum_probs=22.7

Q ss_pred             eecCcCccccCChhhHHHHHhh-hcCCCceeCCccccccCCHHHHHHHHHH
Q psy11591        114 FKCNYCEKVYNNPSNLQRHIKT-HTDNSLYICEICGKDFGTARYLKRHKDT  163 (220)
Q Consensus       114 ~~C~~C~~~f~~~~~l~~H~~~-h~~~~~~~C~~C~~~f~~~~~l~~H~~~  163 (220)
                      |.|..|++.|.+.+.|..|++. |.+   +.|+.|++.|.   .+..|..+
T Consensus         2 y~C~~Cgk~F~s~s~Lk~H~r~~H~~---~~C~~CgKsF~---~l~~H~~~   46 (79)
T PHA00732          2 FKCPICGFTTVTLFALKQHARRNHTL---TKCPVCNKSYR---RLNQHFYS   46 (79)
T ss_pred             ccCCCCCCccCCHHHHHHHhhcccCC---CccCCCCCEeC---Chhhhhcc
Confidence            4555555555555555555553 322   35555555555   24445433


No 24 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.36  E-value=7e-07  Score=50.29  Aligned_cols=51  Identities=24%  Similarity=0.516  Sum_probs=33.1

Q ss_pred             ceeCCccccccCCHHHHHHHHHHcCCC--CcccccccccccCchhHHHHHhhhccc
Q psy11591        141 LYICEICGKDFGTARYLKRHKDTHNSV--NTFVCEVCNTGFKVKKHLTQHYKSHSM  194 (220)
Q Consensus       141 ~~~C~~C~~~f~~~~~l~~H~~~h~~~--~~~~C~~C~~~f~~~~~l~~H~~~h~~  194 (220)
                      .|.||+|++ ..+...|..|....|..  +.+.|++|...+.  ..|..|+..+|+
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H~   54 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQHR   54 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhcC
Confidence            367777877 45566777776654332  4577888877544  377778776653


No 25 
>PHA00732 hypothetical protein
Probab=98.29  E-value=5.4e-07  Score=54.61  Aligned_cols=45  Identities=38%  Similarity=0.727  Sum_probs=32.2

Q ss_pred             ceeCCccccccCCHHHHHHHHHH-cCCCCcccccccccccCchhHHHHHhhh
Q psy11591        141 LYICEICGKDFGTARYLKRHKDT-HNSVNTFVCEVCNTGFKVKKHLTQHYKS  191 (220)
Q Consensus       141 ~~~C~~C~~~f~~~~~l~~H~~~-h~~~~~~~C~~C~~~f~~~~~l~~H~~~  191 (220)
                      ||.|+.|++.|.+.+.|..|++. |.   ++.|+.|+++|.   .|..|..+
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~---~l~~H~~~   46 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYR---RLNQHFYS   46 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeC---Chhhhhcc
Confidence            46788888888888888888774 44   247888888776   46666644


No 26 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.19  E-value=3.2e-06  Score=47.56  Aligned_cols=49  Identities=22%  Similarity=0.436  Sum_probs=23.6

Q ss_pred             cccccchhhcCChhHHHHHHhhhcCCC-CcccccccccccCChhHHHHHHhhc
Q psy11591         30 HVCHVCSKSFRNRGKLNVHYKRVHERI-RTHQCNHCGRAFSDKSNLTVHIRTH   81 (220)
Q Consensus        30 ~~C~~C~~~~~~~~~l~~H~~~~h~~~-~~~~C~~C~~~~~~~~~l~~h~~~~   81 (220)
                      |.|+.|++ ..+...|..|....|..+ +.+.||.|...+.  ..|..|+..+
T Consensus         3 f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~   52 (54)
T PF05605_consen    3 FTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQ   52 (54)
T ss_pred             cCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHh
Confidence            45555555 334455555555555443 2355555554332  2455554443


No 27 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.02  E-value=2.4e-06  Score=39.03  Aligned_cols=22  Identities=50%  Similarity=0.990  Sum_probs=10.6

Q ss_pred             eeCCccccccCCHHHHHHHHHH
Q psy11591        142 YICEICGKDFGTARYLKRHKDT  163 (220)
Q Consensus       142 ~~C~~C~~~f~~~~~l~~H~~~  163 (220)
                      |.|+.|++.|.+.+.|.+|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            3444555555555555554443


No 28 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.97  E-value=5.9e-06  Score=37.66  Aligned_cols=22  Identities=27%  Similarity=0.824  Sum_probs=13.8

Q ss_pred             ccccccccccCchhHHHHHhhh
Q psy11591        170 FVCEVCNTGFKVKKHLTQHYKS  191 (220)
Q Consensus       170 ~~C~~C~~~f~~~~~l~~H~~~  191 (220)
                      |.|+.|++.|.+...|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            4566666666666666666654


No 29 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.95  E-value=4.6e-06  Score=38.37  Aligned_cols=23  Identities=39%  Similarity=0.969  Sum_probs=12.2

Q ss_pred             ccccccccccCchhHHHHHhhhc
Q psy11591        170 FVCEVCNTGFKVKKHLTQHYKSH  192 (220)
Q Consensus       170 ~~C~~C~~~f~~~~~l~~H~~~h  192 (220)
                      |.|++|++.|.+...|..|+++|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            45566666666666666665554


No 30 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.92  E-value=5.1e-06  Score=39.54  Aligned_cols=25  Identities=32%  Similarity=0.695  Sum_probs=18.3

Q ss_pred             cccccccccccCchhHHHHHhhhcc
Q psy11591        169 TFVCEVCNTGFKVKKHLTQHYKSHS  193 (220)
Q Consensus       169 ~~~C~~C~~~f~~~~~l~~H~~~h~  193 (220)
                      +|.|..|++.|.+...|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            4677777777777777777777665


No 31 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.79  E-value=1.4e-05  Score=51.24  Aligned_cols=73  Identities=21%  Similarity=0.453  Sum_probs=19.1

Q ss_pred             ecCcCccccCChhhHHHHHhhhcCCCceeCCccccccCCHHHHHHHHHHcCCCCcccccccccccCchhHHHHHhhhc
Q psy11591        115 KCNYCEKVYNNPSNLQRHIKTHTDNSLYICEICGKDFGTARYLKRHKDTHNSVNTFVCEVCNTGFKVKKHLTQHYKSH  192 (220)
Q Consensus       115 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h  192 (220)
                      .|..|+..|.+...|..|+...++-..-    ....+.....+..+....- ...+.|..|++.|.+...|..|++.+
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~----~~~~l~~~~~~~~~~~~~~-~~~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIP----DQKYLVDPNRLLNYLRKKV-KESFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             -----------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             Cccccccccccccccccccccccccccc----ccccccccccccccccccc-CCCCCCCccCCCCcCHHHHHHHHcCc
Confidence            3777888888888888888665543211    1112223334444433221 22578888888888888888888765


No 32 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.77  E-value=2.7e-05  Score=35.65  Aligned_cols=23  Identities=43%  Similarity=0.944  Sum_probs=13.1

Q ss_pred             eeCCccccccCCHHHHHHHHHHc
Q psy11591        142 YICEICGKDFGTARYLKRHKDTH  164 (220)
Q Consensus       142 ~~C~~C~~~f~~~~~l~~H~~~h  164 (220)
                      |.|++|++.|.+...|..|+.++
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            45666666666666666666554


No 33 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.69  E-value=1.3e-05  Score=60.12  Aligned_cols=51  Identities=27%  Similarity=0.538  Sum_probs=43.3

Q ss_pred             CCceeCCc--cccccCCHHHHHHHHHHcC-------------------CCCcccccccccccCchhHHHHHh
Q psy11591        139 NSLYICEI--CGKDFGTARYLKRHKDTHN-------------------SVNTFVCEVCNTGFKVKKHLTQHY  189 (220)
Q Consensus       139 ~~~~~C~~--C~~~f~~~~~l~~H~~~h~-------------------~~~~~~C~~C~~~f~~~~~l~~H~  189 (220)
                      ++||+|++  |+|.|+...+|.=|+.--|                   ..+||+|++|+|+|.....|.-|.
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr  418 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHR  418 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceecc
Confidence            58999988  9999999999988875322                   348999999999999999999885


No 34 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.61  E-value=4.1e-05  Score=36.33  Aligned_cols=25  Identities=36%  Similarity=0.798  Sum_probs=16.2

Q ss_pred             ceeCCccccccCCHHHHHHHHHHcC
Q psy11591        141 LYICEICGKDFGTARYLKRHKDTHN  165 (220)
Q Consensus       141 ~~~C~~C~~~f~~~~~l~~H~~~h~  165 (220)
                      ||.|..|++.|.+...|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            4666666666666666666666554


No 35 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.58  E-value=5.4e-05  Score=48.42  Aligned_cols=22  Identities=36%  Similarity=0.711  Sum_probs=0.0

Q ss_pred             cccchhhcCChhHHHHHHhhhc
Q psy11591         32 CHVCSKSFRNRGKLNVHYKRVH   53 (220)
Q Consensus        32 C~~C~~~~~~~~~l~~H~~~~h   53 (220)
                      |..|+..|.+...|..||...|
T Consensus         2 C~~C~~~f~~~~~l~~H~~~~H   23 (100)
T PF12756_consen    2 CLFCDESFSSVDDLLQHMKKKH   23 (100)
T ss_dssp             ----------------------
T ss_pred             cccccccccccccccccccccc
Confidence            4444444444444444443333


No 36 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.42  E-value=0.00011  Score=39.54  Aligned_cols=31  Identities=16%  Similarity=0.442  Sum_probs=12.8

Q ss_pred             CCcccccccccccCchhHHHHHhhhcccccC
Q psy11591        167 VNTFVCEVCNTGFKVKKHLTQHYKSHSMFIP  197 (220)
Q Consensus       167 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~  197 (220)
                      +.|..|++|+..+.+..+|++|+++.|+.+|
T Consensus        22 ~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   22 EQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             S--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             CCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            3445555555555555555555555554443


No 37 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.33  E-value=0.00026  Score=38.13  Aligned_cols=33  Identities=24%  Similarity=0.469  Sum_probs=20.3

Q ss_pred             cCCCceeCCccccccCCHHHHHHHHHHcCCCCc
Q psy11591        137 TDNSLYICEICGKDFGTARYLKRHKDTHNSVNT  169 (220)
Q Consensus       137 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~  169 (220)
                      ..+.|-.|++|+..+.+..+|++|+.+.|+.+|
T Consensus        20 ~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   20 QSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             ccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            345677888888888888888888877777664


No 38 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.31  E-value=0.00011  Score=33.68  Aligned_cols=23  Identities=30%  Similarity=0.668  Sum_probs=13.7

Q ss_pred             ccccccccccCchhHHHHHhhhcc
Q psy11591        170 FVCEVCNTGFKVKKHLTQHYKSHS  193 (220)
Q Consensus       170 ~~C~~C~~~f~~~~~l~~H~~~h~  193 (220)
                      |+|+.|++... ...|..|++.++
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            56667776665 666777766654


No 39 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.29  E-value=0.00019  Score=33.29  Aligned_cols=23  Identities=35%  Similarity=0.788  Sum_probs=13.5

Q ss_pred             ccccccccccCchhHHHHHhhhc
Q psy11591        170 FVCEVCNTGFKVKKHLTQHYKSH  192 (220)
Q Consensus       170 ~~C~~C~~~f~~~~~l~~H~~~h  192 (220)
                      |.|..|++.|.+...|..|++.|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            35566666666666666665544


No 40 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.22  E-value=0.0001  Score=55.53  Aligned_cols=53  Identities=30%  Similarity=0.665  Sum_probs=42.3

Q ss_pred             CCcceecCc--CccccCChhhHHHHHhhhc-------------------CCCceeCCccccccCCHHHHHHHHH
Q psy11591        110 NDIKFKCNY--CEKVYNNPSNLQRHIKTHT-------------------DNSLYICEICGKDFGTARYLKRHKD  162 (220)
Q Consensus       110 ~~~~~~C~~--C~~~f~~~~~l~~H~~~h~-------------------~~~~~~C~~C~~~f~~~~~l~~H~~  162 (220)
                      .++||.|++  |.+.+.+...|+-|+.--+                   ..+||.|++|+|.|+...+|.=|..
T Consensus       346 d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             cCceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            347888976  8899998888888875322                   3589999999999999999876653


No 41 
>PRK04860 hypothetical protein; Provisional
Probab=97.06  E-value=0.00031  Score=48.73  Aligned_cols=40  Identities=20%  Similarity=0.488  Sum_probs=31.9

Q ss_pred             CceeCCccccccCCHHHHHHHHHHcCCCCcccccccccccCchh
Q psy11591        140 SLYICEICGKDFGTARYLKRHKDTHNSVNTFVCEVCNTGFKVKK  183 (220)
Q Consensus       140 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~  183 (220)
                      -+|.|. |+.   ....+++|.+++.++++|.|..|+..|....
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~~  157 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFKG  157 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEec
Confidence            368887 887   6667788999999989999999988776543


No 42 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.99  E-value=0.00034  Score=32.36  Aligned_cols=23  Identities=39%  Similarity=0.940  Sum_probs=15.8

Q ss_pred             ccccccccccCchhHHHHHhhhc
Q psy11591        170 FVCEVCNTGFKVKKHLTQHYKSH  192 (220)
Q Consensus       170 ~~C~~C~~~f~~~~~l~~H~~~h  192 (220)
                      |.|.+|+..|.+...|..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            45777777777777777776553


No 43 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.94  E-value=0.0012  Score=30.48  Aligned_cols=23  Identities=39%  Similarity=1.048  Sum_probs=14.7

Q ss_pred             CCCccchhhhcCHHHHHHHHHHh
Q psy11591          2 FKCPQCGALLKNIWSLREHIMIH   24 (220)
Q Consensus         2 ~~C~~C~~~f~~~~~l~~H~~~~   24 (220)
                      |.|+.|++.|.....|..|++.|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            45666666666666666666644


No 44 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.75  E-value=0.0012  Score=30.12  Aligned_cols=23  Identities=35%  Similarity=0.642  Sum_probs=12.3

Q ss_pred             eeCCccccccCCHHHHHHHHHHcC
Q psy11591        142 YICEICGKDFGTARYLKRHKDTHN  165 (220)
Q Consensus       142 ~~C~~C~~~f~~~~~l~~H~~~h~  165 (220)
                      |.|+.|+.... ...|.+|++.++
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            45666666655 556666665543


No 45 
>KOG2785|consensus
Probab=96.74  E-value=0.0072  Score=47.09  Aligned_cols=163  Identities=17%  Similarity=0.286  Sum_probs=96.7

Q ss_pred             CcccccchhhcCChhHHHHHHhhhcCCC----Cccccccc-ccccCChhHH-HHHH--hhcCCCCcccCchhhhhcCCHH
Q psy11591         29 PHVCHVCSKSFRNRGKLNVHYKRVHERI----RTHQCNHC-GRAFSDKSNL-TVHI--RTHTDEKKYMCELCGAEFAQWA  100 (220)
Q Consensus        29 ~~~C~~C~~~~~~~~~l~~H~~~~h~~~----~~~~C~~C-~~~~~~~~~l-~~h~--~~~~~~~~~~C~~C~~~f~~~~  100 (220)
                      .|.|..|...|.+...-+.|+.+.....    +...-|-- -..|...... ..-.  ....++.++.|.+|.+.|.+..
T Consensus         3 ~ftC~tC~v~F~~ad~Qr~HyKSdWHRYNLKRkVA~lPPItaE~F~~k~~s~~~~~~~~~e~~~~~~~c~~c~k~~~s~~   82 (390)
T KOG2785|consen    3 GFTCNTCNVEFDDADEQRAHYKSDWHRYNLKRKVASLPPITAEEFNEKVLSDDSEKEENLEEAESVVYCEACNKSFASPK   82 (390)
T ss_pred             cceeeceeeeeccHHHHHHHhhhhHHHhhHHhHhhcCCCcCHHHHhHHHhhhhhhhhhhhhhcccceehHHhhccccChh
Confidence            4789999999999988888886543221    11111111 1122211111 1111  1234567789999999999998


Q ss_pred             HHHhHHHHhCCc------------------ceec-------------CcCccccCChhhHHHHHhh------------hc
Q psy11591        101 TLYNHKFTHNDI------------------KFKC-------------NYCEKVYNNPSNLQRHIKT------------HT  137 (220)
Q Consensus       101 ~l~~h~~~~~~~------------------~~~C-------------~~C~~~f~~~~~l~~H~~~------------h~  137 (220)
                      ....|+..-..+                  .+.+             ..+............+...            ..
T Consensus        83 a~~~hl~Sk~h~~~~~~~~r~~e~d~a~~~q~~~~~p~~l~~~~e~e~~~~E~~~~~d~~~e~~~dd~~Edi~~d~~~e~  162 (390)
T KOG2785|consen   83 AHENHLKSKKHVENLSNHQRSEEGDSAKISQLPSRRPSNLQNKGESELKWYEVDSDEDSSEEEEEDDEEEDIEEDGDDED  162 (390)
T ss_pred             hHHHHHHHhhcchhhhhhhccccccchhhhhccccCccccccCCCcccchhhcccccccchhhccCcchhhhhhccchhc
Confidence            888886543110                  0111             1111111111111111110            11


Q ss_pred             CCCceeCCccccccCCHHHHHHHHHHcCCC-----------------------Ccccccccc---cccCchhHHHHHhhh
Q psy11591        138 DNSLYICEICGKDFGTARYLKRHKDTHNSV-----------------------NTFVCEVCN---TGFKVKKHLTQHYKS  191 (220)
Q Consensus       138 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~-----------------------~~~~C~~C~---~~f~~~~~l~~H~~~  191 (220)
                      ...|-.|-+|++.+++...-..|+..+||.                       .-+.|-.|+   +.|.+..+.+.||+.
T Consensus       163 e~~Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  163 ELIPTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             ccCCcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            123568999999999999999999988863                       237888898   999999999999954


No 46 
>KOG1146|consensus
Probab=96.63  E-value=0.00051  Score=61.13  Aligned_cols=51  Identities=18%  Similarity=0.334  Sum_probs=32.0

Q ss_pred             cccchhhcCChhHHHHHHhhhcCCCCcccccccccccCChhHHHHHHhhcC
Q psy11591         32 CHVCSKSFRNRGKLNVHYKRVHERIRTHQCNHCGRAFSDKSNLTVHIRTHT   82 (220)
Q Consensus        32 C~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~~~   82 (220)
                      +..++..+.....+..|+...+...+.+.|+.|+..+.....|..|++..+
T Consensus       439 ~~~~e~~~~s~r~~~~~t~~L~S~~kt~~cpkc~~~yk~a~~L~vhmRskh  489 (1406)
T KOG1146|consen  439 LTKAEPLLESKRSLEGQTVVLHSFFKTLKCPKCNWHYKLAQTLGVHMRSKH  489 (1406)
T ss_pred             ccchhhhhhhhcccccceeeeecccccccCCccchhhhhHHHhhhcccccc
Confidence            334445555555555555555555666777777777777777777776633


No 47 
>PRK04860 hypothetical protein; Provisional
Probab=96.54  E-value=0.0022  Score=44.54  Aligned_cols=38  Identities=21%  Similarity=0.695  Sum_probs=33.7

Q ss_pred             ceecCcCccccCChhhHHHHHhhhcCCCceeCCccccccCCH
Q psy11591        113 KFKCNYCEKVYNNPSNLQRHIKTHTDNSLYICEICGKDFGTA  154 (220)
Q Consensus       113 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~  154 (220)
                      +|.|. |+.   ....++.|.+++.++++|.|..|+..|...
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEe
Confidence            69998 987   678899999999999999999999988654


No 48 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.53  E-value=0.0017  Score=29.96  Aligned_cols=22  Identities=32%  Similarity=0.890  Sum_probs=13.8

Q ss_pred             eeCCccccccCCHHHHHHHHHH
Q psy11591        142 YICEICGKDFGTARYLKRHKDT  163 (220)
Q Consensus       142 ~~C~~C~~~f~~~~~l~~H~~~  163 (220)
                      |.|..|++.|.+...|..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            4566666666666666666543


No 49 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.44  E-value=0.0014  Score=30.89  Aligned_cols=22  Identities=41%  Similarity=0.868  Sum_probs=18.3

Q ss_pred             ccccccccccCchhHHHHHhhh
Q psy11591        170 FVCEVCNTGFKVKKHLTQHYKS  191 (220)
Q Consensus       170 ~~C~~C~~~f~~~~~l~~H~~~  191 (220)
                      |.|..|++.|.+...|..|+++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            6788888888888888888765


No 50 
>KOG2231|consensus
Probab=95.90  E-value=0.04  Score=46.72  Aligned_cols=94  Identities=20%  Similarity=0.443  Sum_probs=49.7

Q ss_pred             ChhHHHHHHhhhcCCCCcccccc------cccccCChhHHHHHHhhcCC-CCc----ccCchhhhhcCCHHHHHhHHHHh
Q psy11591         41 NRGKLNVHYKRVHERIRTHQCNH------CGRAFSDKSNLTVHIRTHTD-EKK----YMCELCGAEFAQWATLYNHKFTH  109 (220)
Q Consensus        41 ~~~~l~~H~~~~h~~~~~~~C~~------C~~~~~~~~~l~~h~~~~~~-~~~----~~C~~C~~~f~~~~~l~~h~~~~  109 (220)
                      +...|..|+...|..-..-.|-.      +.....+...|..|++.--. +..    -.|..|...|.....+..|++.+
T Consensus       126 s~~~Lk~H~~~~H~~~~c~lC~~~~kif~~e~k~Yt~~el~~h~~~gd~d~~s~rGhp~C~~C~~~fld~~el~rH~~~~  205 (669)
T KOG2231|consen  126 SVENLKNHMRDQHKLHLCSLCLQNLKIFINERKLYTRAELNLHLMFGDPDDESCRGHPLCKFCHERFLDDDELYRHLRFD  205 (669)
T ss_pred             HHHHHHHHHHHhhhhhccccccccceeeeeeeehehHHHHHHHHhcCCCccccccCCccchhhhhhhccHHHHHHhhccc
Confidence            66777777766664433222211      12233445666666654222 111    34666777777777777776654


Q ss_pred             CCcceecCcC------ccccCChhhHHHHHhhhc
Q psy11591        110 NDIKFKCNYC------EKVYNNPSNLQRHIKTHT  137 (220)
Q Consensus       110 ~~~~~~C~~C------~~~f~~~~~l~~H~~~h~  137 (220)
                      .   |.|..|      +.-|.....|..|.+.+|
T Consensus       206 h---~~chfC~~~~~~neyy~~~~dLe~HfR~~H  236 (669)
T KOG2231|consen  206 H---EFCHFCDYKTGQNEYYNDYDDLEEHFRKGH  236 (669)
T ss_pred             e---eheeecCcccccchhcccchHHHHHhhhcC
Confidence            3   233333      334555566776666555


No 51 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=95.47  E-value=0.0029  Score=29.80  Aligned_cols=21  Identities=33%  Similarity=0.811  Sum_probs=13.9

Q ss_pred             eeCCccccccCCHHHHHHHHH
Q psy11591        142 YICEICGKDFGTARYLKRHKD  162 (220)
Q Consensus       142 ~~C~~C~~~f~~~~~l~~H~~  162 (220)
                      |.|..|++.|.+...+..|++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~   22 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMK   22 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTT
T ss_pred             CCcccCCCCcCCHHHHHHHHc
Confidence            556677777777766666654


No 52 
>KOG2482|consensus
Probab=95.36  E-value=0.078  Score=40.90  Aligned_cols=106  Identities=18%  Similarity=0.288  Sum_probs=67.6

Q ss_pred             cccCchhhhhcCCHHHHHhHHHHhCCcc-----------ee--cCcCccccCCh-hhHHHHHh-h------------hcC
Q psy11591         86 KYMCELCGAEFAQWATLYNHKFTHNDIK-----------FK--CNYCEKVYNNP-SNLQRHIK-T------------HTD  138 (220)
Q Consensus        86 ~~~C~~C~~~f~~~~~l~~h~~~~~~~~-----------~~--C~~C~~~f~~~-~~l~~H~~-~------------h~~  138 (220)
                      .++|--|.+.|+++..|..||+..+.+.           |.  -..-|++.... +.+..-.. .            ..+
T Consensus       195 r~~CLyCekifrdkntLkeHMrkK~HrrinPknreYDkfyiINY~ev~ks~t~~~~e~dret~~d~~E~D~~wsDw~ed~  274 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRKKRHRRINPKNREYDKFYIINYLEVGKSWTIVHSEDDRETNEDINETDDTWSDWNEDD  274 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHhccCcccCCCccccceEEEEeHhhcCCccchhhhhhhhhhhccccccccchhhhhcCC
Confidence            3789999999999999999998663221           10  11122222211 11100000 0            011


Q ss_pred             CCc--eeCCccccccCCHHHHHHHHHHcCC---------------------------CCcccccccccccCchhHHHHHh
Q psy11591        139 NSL--YICEICGKDFGTARYLKRHKDTHNS---------------------------VNTFVCEVCNTGFKVKKHLTQHY  189 (220)
Q Consensus       139 ~~~--~~C~~C~~~f~~~~~l~~H~~~h~~---------------------------~~~~~C~~C~~~f~~~~~l~~H~  189 (220)
                      ..+  .+|-.|.....+...|..|+++.|.                           ...-.|-.|...|.....|..||
T Consensus       275 a~a~~v~CLfC~~~~en~~~l~eHmk~vHe~Dl~Ki~sd~~Ln~YqrvrviNyiRkq~~~~~c~~cd~~F~~e~~l~~hm  354 (423)
T KOG2482|consen  275 AEALSVVCLFCTNFYENPVFLFEHMKIVHEFDLLKIQSDYSLNFYQRVRVINYIRKQKKKSRCAECDLSFWKEPGLLIHM  354 (423)
T ss_pred             CCccceEEEeeccchhhHHHHHHHHHHHHHhhHHhhccccccchhhhhhHHHHHHHHhhccccccccccccCcchhhhhc
Confidence            222  5899999999999999999986542                           12356889999999999999998


Q ss_pred             hh
Q psy11591        190 KS  191 (220)
Q Consensus       190 ~~  191 (220)
                      ..
T Consensus       355 ~e  356 (423)
T KOG2482|consen  355 VE  356 (423)
T ss_pred             cc
Confidence            54


No 53 
>KOG2785|consensus
Probab=95.33  E-value=0.041  Score=43.03  Aligned_cols=53  Identities=19%  Similarity=0.471  Sum_probs=44.7

Q ss_pred             cceecCcCccccCChhhHHHHHhhhcC-----------------------CCceeCCccc---cccCCHHHHHHHHHHc
Q psy11591        112 IKFKCNYCEKVYNNPSNLQRHIKTHTD-----------------------NSLYICEICG---KDFGTARYLKRHKDTH  164 (220)
Q Consensus       112 ~~~~C~~C~~~f~~~~~l~~H~~~h~~-----------------------~~~~~C~~C~---~~f~~~~~l~~H~~~h  164 (220)
                      .|-.|..|+..+.+......||..+++                       ..-+.|-.|+   +.|.+....+.|+...
T Consensus       165 ~Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~K  243 (390)
T KOG2785|consen  165 IPTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRDK  243 (390)
T ss_pred             CCcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhhc
Confidence            357899999999999999999998876                       2337899998   9999999999999753


No 54 
>KOG2893|consensus
Probab=95.10  E-value=0.0054  Score=44.59  Aligned_cols=41  Identities=24%  Similarity=0.635  Sum_probs=19.4

Q ss_pred             cccchhhcCChhHHHHHHhhhcCCCCcccccccccccCChhHHHHH
Q psy11591         32 CHVCSKSFRNRGKLNVHYKRVHERIRTHQCNHCGRAFSDKSNLTVH   77 (220)
Q Consensus        32 C~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~~~~~~~~l~~h   77 (220)
                      |.+|++.|.+...|+.|++     .+-|+|.+|.+.+.+.-.|..|
T Consensus        13 cwycnrefddekiliqhqk-----akhfkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQK-----AKHFKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             eeecccccchhhhhhhhhh-----hccceeeeehhhhccCCCceee
Confidence            4455555555555554432     2234555555554444444444


No 55 
>KOG1146|consensus
Probab=94.96  E-value=0.0091  Score=53.66  Aligned_cols=53  Identities=21%  Similarity=0.402  Sum_probs=37.8

Q ss_pred             CCceeCCccccccCCHHHHHHHHHHcC-------------------------CCCcccccccccccCchhHHHHHhhh
Q psy11591        139 NSLYICEICGKDFGTARYLKRHKDTHN-------------------------SVNTFVCEVCNTGFKVKKHLTQHYKS  191 (220)
Q Consensus       139 ~~~~~C~~C~~~f~~~~~l~~H~~~h~-------------------------~~~~~~C~~C~~~f~~~~~l~~H~~~  191 (220)
                      .+.+.|+.|+-.|++...|-.|++..+                         +.++|.|..|.+++.....|.+|+..
T Consensus       463 ~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~LsihlqS  540 (1406)
T KOG1146|consen  463 FKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLSIHLQS  540 (1406)
T ss_pred             cccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCcccceeeeeeeecchHHHHHHHH
Confidence            355566666666666666666655421                         34689999999999999999999854


No 56 
>KOG4173|consensus
Probab=94.56  E-value=0.016  Score=41.20  Aligned_cols=73  Identities=27%  Similarity=0.632  Sum_probs=43.2

Q ss_pred             eecCc--CccccCChhhHHHHHhhhcCCCceeCCccccccCCHHHHHHHHHH-c---------CCCCcccc--ccccccc
Q psy11591        114 FKCNY--CEKVYNNPSNLQRHIKTHTDNSLYICEICGKDFGTARYLKRHKDT-H---------NSVNTFVC--EVCNTGF  179 (220)
Q Consensus       114 ~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~-h---------~~~~~~~C--~~C~~~f  179 (220)
                      +.|++  |...|.+...+..|..+-++.   .|.+|.++|.+.--|..|+.. |         -|.-.|+|  ..|+.+|
T Consensus        80 ~~cqvagc~~~~d~lD~~E~hY~~~h~~---sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KF  156 (253)
T KOG4173|consen   80 FACQVAGCCQVFDALDDYEHHYHTLHGN---SCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKF  156 (253)
T ss_pred             ccccccchHHHHhhhhhHHHhhhhcccc---hhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhh
Confidence            45544  555666666666665544443   566666666666666666432 2         23445777  3477777


Q ss_pred             CchhHHHHHh
Q psy11591        180 KVKKHLTQHY  189 (220)
Q Consensus       180 ~~~~~l~~H~  189 (220)
                      .+..+-..|+
T Consensus       157 kT~r~RkdH~  166 (253)
T KOG4173|consen  157 KTSRDRKDHM  166 (253)
T ss_pred             hhhhhhhhHH
Confidence            7777777775


No 57 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=94.43  E-value=0.045  Score=25.20  Aligned_cols=18  Identities=39%  Similarity=0.717  Sum_probs=8.7

Q ss_pred             CCccchhhhcCHHHHHHHH
Q psy11591          3 KCPQCGALLKNIWSLREHI   21 (220)
Q Consensus         3 ~C~~C~~~f~~~~~l~~H~   21 (220)
                      .|+.|++.| ....|..|+
T Consensus         4 ~C~~CgR~F-~~~~l~~H~   21 (25)
T PF13913_consen    4 PCPICGRKF-NPDRLEKHE   21 (25)
T ss_pred             cCCCCCCEE-CHHHHHHHH
Confidence            455555555 334444444


No 58 
>KOG2231|consensus
Probab=94.38  E-value=0.098  Score=44.47  Aligned_cols=119  Identities=28%  Similarity=0.559  Sum_probs=72.4

Q ss_pred             ccccccccCChhHHHHHHhhcCCCCcccCchhh---hhcC------CHHHHHhHHHHh-C-Cc----ceecCcCccccCC
Q psy11591         61 CNHCGRAFSDKSNLTVHIRTHTDEKKYMCELCG---AEFA------QWATLYNHKFTH-N-DI----KFKCNYCEKVYNN  125 (220)
Q Consensus        61 C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~---~~f~------~~~~l~~h~~~~-~-~~----~~~C~~C~~~f~~  125 (220)
                      |..| ..|.....|+.|+...|+  .+.|..|-   +.|.      ....|..|++.- . ++    --.|..|...|..
T Consensus       118 ~~~c-~~~~s~~~Lk~H~~~~H~--~~~c~lC~~~~kif~~e~k~Yt~~el~~h~~~gd~d~~s~rGhp~C~~C~~~fld  194 (669)
T KOG2231|consen  118 CLHC-TEFKSVENLKNHMRDQHK--LHLCSLCLQNLKIFINERKLYTRAELNLHLMFGDPDDESCRGHPLCKFCHERFLD  194 (669)
T ss_pred             Cccc-cchhHHHHHHHHHHHhhh--hhccccccccceeeeeeeehehHHHHHHHHhcCCCccccccCCccchhhhhhhcc
Confidence            4444 344477889999865443  23444443   3333      244556665543 1 11    1468889999999


Q ss_pred             hhhHHHHHhhhcCCCceeCCcc------ccccCCHHHHHHHHHHcCCCCccccc--ccc-cccCchhHHHHHhh
Q psy11591        126 PSNLQRHIKTHTDNSLYICEIC------GKDFGTARYLKRHKDTHNSVNTFVCE--VCN-TGFKVKKHLTQHYK  190 (220)
Q Consensus       126 ~~~l~~H~~~h~~~~~~~C~~C------~~~f~~~~~l~~H~~~h~~~~~~~C~--~C~-~~f~~~~~l~~H~~  190 (220)
                      ...|..|++.++    |.|-+|      +.-|..-..|..|.+.+|    |.|.  .|. +.|.....+..+++
T Consensus       195 ~~el~rH~~~~h----~~chfC~~~~~~neyy~~~~dLe~HfR~~H----flCE~~~C~~~~f~~~~~~ei~lk  260 (669)
T KOG2231|consen  195 DDELYRHLRFDH----EFCHFCDYKTGQNEYYNDYDDLEEHFRKGH----FLCEEEFCRTKKFYVAFELEIELK  260 (669)
T ss_pred             HHHHHHhhccce----eheeecCcccccchhcccchHHHHHhhhcC----ccccccccccceeeehhHHHHHHH
Confidence            999999998766    455555      345677788888888776    4565  454 23444434555554


No 59 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=94.19  E-value=0.037  Score=27.65  Aligned_cols=23  Identities=30%  Similarity=0.691  Sum_probs=16.5

Q ss_pred             cccccccccccCchhHHHHHhhh
Q psy11591        169 TFVCEVCNTGFKVKKHLTQHYKS  191 (220)
Q Consensus       169 ~~~C~~C~~~f~~~~~l~~H~~~  191 (220)
                      +|.|.+|+..|.+...+..|+..
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            46777777777777777777643


No 60 
>KOG2482|consensus
Probab=94.05  E-value=0.19  Score=38.91  Aligned_cols=148  Identities=22%  Similarity=0.339  Sum_probs=90.9

Q ss_pred             HHHHHHHHh-hCCCCcccccchh-hcCChhHHHHHHhhhcCCC---------------------CcccccccccccCChh
Q psy11591         16 SLREHIMIH-TGERPHVCHVCSK-SFRNRGKLNVHYKRVHERI---------------------RTHQCNHCGRAFSDKS   72 (220)
Q Consensus        16 ~l~~H~~~~-~~~~~~~C~~C~~-~~~~~~~l~~H~~~~h~~~---------------------~~~~C~~C~~~~~~~~   72 (220)
                      .|+++|+.- ......+|-.|.. ...+++.+..|+-..|.-.                     ..+.|-+|.+.|.++.
T Consensus       130 aLeqqQ~Eredt~fslqClFCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLehLkekL~r~~CLyCekifrdkn  209 (423)
T KOG2482|consen  130 ALEQQQKEREDTIFSLQCLFCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEHLKEKLERLRCLYCEKIFRDKN  209 (423)
T ss_pred             HHHHHHHHhcCCeeeeEEEEecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHHHHHHHhhheeeeeccccCCcH
Confidence            345555432 2234467999965 5568888888887666321                     2378999999999999


Q ss_pred             HHHHHHhhcC--CCCc--------ccCc--hhhhhcCC------HHHHHhH---------HHHhCCcc--eecCcCcccc
Q psy11591         73 NLTVHIRTHT--DEKK--------YMCE--LCGAEFAQ------WATLYNH---------KFTHNDIK--FKCNYCEKVY  123 (220)
Q Consensus        73 ~l~~h~~~~~--~~~~--------~~C~--~C~~~f~~------~~~l~~h---------~~~~~~~~--~~C~~C~~~f  123 (220)
                      .|..||+...  ...|        |.-+  .-|++...      ......+         ...++..+  ..|-.|....
T Consensus       210 tLkeHMrkK~HrrinPknreYDkfyiINY~ev~ks~t~~~~e~dret~~d~~E~D~~wsDw~ed~a~a~~v~CLfC~~~~  289 (423)
T KOG2482|consen  210 TLKEHMRKKRHRRINPKNREYDKFYIINYLEVGKSWTIVHSEDDRETNEDINETDDTWSDWNEDDAEALSVVCLFCTNFY  289 (423)
T ss_pred             HHHHHHHhccCcccCCCccccceEEEEeHhhcCCccchhhhhhhhhhhccccccccchhhhhcCCCCccceEEEeeccch
Confidence            9999997532  1111        1110  01111100      0000000         11111222  5899999999


Q ss_pred             CChhhHHHHHhhhcC---------------------------CCceeCCccccccCCHHHHHHHHHH
Q psy11591        124 NNPSNLQRHIKTHTD---------------------------NSLYICEICGKDFGTARYLKRHKDT  163 (220)
Q Consensus       124 ~~~~~l~~H~~~h~~---------------------------~~~~~C~~C~~~f~~~~~l~~H~~~  163 (220)
                      .+...|..|+...+.                           ...-.|-.|...|-....|..|+..
T Consensus       290 en~~~l~eHmk~vHe~Dl~Ki~sd~~Ln~YqrvrviNyiRkq~~~~~c~~cd~~F~~e~~l~~hm~e  356 (423)
T KOG2482|consen  290 ENPVFLFEHMKIVHEFDLLKIQSDYSLNFYQRVRVINYIRKQKKKSRCAECDLSFWKEPGLLIHMVE  356 (423)
T ss_pred             hhHHHHHHHHHHHHHhhHHhhccccccchhhhhhHHHHHHHHhhccccccccccccCcchhhhhccc
Confidence            999999999986442                           1124677888999999999999864


No 61 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=94.03  E-value=0.16  Score=33.06  Aligned_cols=25  Identities=20%  Similarity=0.493  Sum_probs=21.0

Q ss_pred             ccc----cccccccCchhHHHHHhhhccc
Q psy11591        170 FVC----EVCNTGFKVKKHLTQHYKSHSM  194 (220)
Q Consensus       170 ~~C----~~C~~~f~~~~~l~~H~~~h~~  194 (220)
                      |.|    ..|++.+.+...|+.|++.+||
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            788    8888888888888888887765


No 62 
>KOG2893|consensus
Probab=93.94  E-value=0.014  Score=42.55  Aligned_cols=48  Identities=25%  Similarity=0.466  Sum_probs=35.0

Q ss_pred             CCccchhhhcCHHHHHHHHHHhhCCCCcccccchhhcCChhHHHHHHhhhcC
Q psy11591          3 KCPQCGALLKNIWSLREHIMIHTGERPHVCHVCSKSFRNRGKLNVHYKRVHE   54 (220)
Q Consensus         3 ~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~~h~   54 (220)
                      +|.+|++.|..+..|-+|+++    +.|+|.+|.+.+-+--.|..|-.+.|.
T Consensus        12 wcwycnrefddekiliqhqka----khfkchichkkl~sgpglsihcmqvhk   59 (341)
T KOG2893|consen   12 WCWYCNREFDDEKILIQHQKA----KHFKCHICHKKLFSGPGLSIHCMQVHK   59 (341)
T ss_pred             eeeecccccchhhhhhhhhhh----ccceeeeehhhhccCCCceeehhhhhh
Confidence            688888888888888877765    348888887776666667777655553


No 63 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=93.92  E-value=0.14  Score=39.59  Aligned_cols=24  Identities=29%  Similarity=0.580  Sum_probs=13.7

Q ss_pred             ccccc--chhhcCChhHHHHHHhhhc
Q psy11591         30 HVCHV--CSKSFRNRGKLNVHYKRVH   53 (220)
Q Consensus        30 ~~C~~--C~~~~~~~~~l~~H~~~~h   53 (220)
                      |.|+.  |..++.....|..|....|
T Consensus       152 F~CP~skc~~~C~~~k~lk~H~K~~H  177 (493)
T COG5236         152 FKCPKSKCHRRCGSLKELKKHYKAQH  177 (493)
T ss_pred             hcCCchhhhhhhhhHHHHHHHHHhhc
Confidence            45653  5555555666666665444


No 64 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=93.60  E-value=0.068  Score=34.55  Aligned_cols=48  Identities=25%  Similarity=0.402  Sum_probs=26.5

Q ss_pred             CCccccccCCHHHHHHHHHHcCCCCcccccccccccCchhHHHHHhhhcc
Q psy11591        144 CEICGKDFGTARYLKRHKDTHNSVNTFVCEVCNTGFKVKKHLTQHYKSHS  193 (220)
Q Consensus       144 C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~  193 (220)
                      |--|...|.......  ...-.....|+|+.|...|-..-++-.|...|.
T Consensus        58 C~~C~~~f~~~~~~~--~~~~~~~~~y~C~~C~~~FC~dCD~fiHe~Lh~  105 (112)
T TIGR00622        58 CFGCQGPFPKPPVSP--FDELKDSHRYVCAVCKNVFCVDCDVFVHESLHC  105 (112)
T ss_pred             ccCcCCCCCCccccc--ccccccccceeCCCCCCccccccchhhhhhccC
Confidence            666666665432110  000122345777777777777777777766654


No 65 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=93.44  E-value=0.2  Score=38.87  Aligned_cols=125  Identities=22%  Similarity=0.489  Sum_probs=79.3

Q ss_pred             ccccc--cccccCChhHHHHHHhhcCCCCcccCchhh---hhcCCH------HHHHhHHHHh-CCc----ceecCcCccc
Q psy11591         59 HQCNH--CGRAFSDKSNLTVHIRTHTDEKKYMCELCG---AEFAQW------ATLYNHKFTH-NDI----KFKCNYCEKV  122 (220)
Q Consensus        59 ~~C~~--C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~---~~f~~~------~~l~~h~~~~-~~~----~~~C~~C~~~  122 (220)
                      |.||.  |......-..|..|....++.  +.|.+|-   ++|+..      ..|..|...- .+.    --.|..|...
T Consensus       152 F~CP~skc~~~C~~~k~lk~H~K~~H~~--~~C~~C~~nKk~F~~E~~lF~~~~Lr~H~~~G~~e~GFKGHP~C~FC~~~  229 (493)
T COG5236         152 FKCPKSKCHRRCGSLKELKKHYKAQHGF--VLCSECIGNKKDFWNEIRLFRSSTLRDHKNGGLEEEGFKGHPLCIFCKIY  229 (493)
T ss_pred             hcCCchhhhhhhhhHHHHHHHHHhhcCc--EEhHhhhcCcccCccceeeeecccccccccCCccccCcCCCchhhhccce
Confidence            67775  555555456788888876553  5566665   345433      3444443322 111    1368999999


Q ss_pred             cCChhhHHHHHhhhcCCCceeCCccccc-------cCCHHHHHHHHHHcCCCCcccccc--cc----cccCchhHHHHHh
Q psy11591        123 YNNPSNLQRHIKTHTDNSLYICEICGKD-------FGTARYLKRHKDTHNSVNTFVCEV--CN----TGFKVKKHLTQHY  189 (220)
Q Consensus       123 f~~~~~l~~H~~~h~~~~~~~C~~C~~~-------f~~~~~l~~H~~~h~~~~~~~C~~--C~----~~f~~~~~l~~H~  189 (220)
                      |.+-..|..|++..+.    .|-.|++.       |++...|..|.+.-|    |.|.+  |-    +.|.+...|+.|+
T Consensus       230 FYdDDEL~~HcR~~HE----~ChICD~v~p~~~QYFK~Y~~Le~HF~~~h----y~ct~qtc~~~k~~vf~~~~el~~h~  301 (493)
T COG5236         230 FYDDDELRRHCRLRHE----ACHICDMVGPIRYQYFKSYEDLEAHFRNAH----YCCTFQTCRVGKCYVFPYHTELLEHL  301 (493)
T ss_pred             ecChHHHHHHHHhhhh----hhhhhhccCccchhhhhCHHHHHHHhhcCc----eEEEEEEEecCcEEEeccHHHHHHHH
Confidence            9999999999997653    45555443       667777777766433    55543  32    4688899999997


Q ss_pred             hhcc
Q psy11591        190 KSHS  193 (220)
Q Consensus       190 ~~h~  193 (220)
                      ..-|
T Consensus       302 ~~~h  305 (493)
T COG5236         302 TRFH  305 (493)
T ss_pred             HHHh
Confidence            5433


No 66 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=93.39  E-value=0.083  Score=26.31  Aligned_cols=22  Identities=18%  Similarity=0.517  Sum_probs=17.4

Q ss_pred             ceeCCccccccCCHHHHHHHHH
Q psy11591        141 LYICEICGKDFGTARYLKRHKD  162 (220)
Q Consensus       141 ~~~C~~C~~~f~~~~~l~~H~~  162 (220)
                      +|.|.+|+..|.....+..|+.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHC
Confidence            4778888888888888888865


No 67 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=93.32  E-value=0.057  Score=26.73  Aligned_cols=9  Identities=22%  Similarity=0.910  Sum_probs=3.8

Q ss_pred             eecCcCccc
Q psy11591        114 FKCNYCEKV  122 (220)
Q Consensus       114 ~~C~~C~~~  122 (220)
                      |.|..||..
T Consensus         2 ~~C~~CGy~   10 (33)
T cd00350           2 YVCPVCGYI   10 (33)
T ss_pred             EECCCCCCE
Confidence            344444444


No 68 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=92.92  E-value=0.029  Score=45.56  Aligned_cols=67  Identities=21%  Similarity=0.347  Sum_probs=58.8

Q ss_pred             CceeCCccccccCCHHHHHHHHH--HcCCC--Cccccc--ccccccCchhHHHHHhhhcccccCCCCCCCCCC
Q psy11591        140 SLYICEICGKDFGTARYLKRHKD--THNSV--NTFVCE--VCNTGFKVKKHLTQHYKSHSMFIPPEQFPGLDP  206 (220)
Q Consensus       140 ~~~~C~~C~~~f~~~~~l~~H~~--~h~~~--~~~~C~--~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~~  206 (220)
                      .++.|..|...|.....|..|.+  .|.++  +++.|+  .|++.|.....+..|..+|.+..+..+......
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  360 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKLLNSS  360 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCccccccccCc
Confidence            36889999999999999999999  89999  999999  799999999999999999999887776555443


No 69 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=92.90  E-value=0.017  Score=46.91  Aligned_cols=150  Identities=25%  Similarity=0.362  Sum_probs=100.5

Q ss_pred             CCcccccchhhcCChhHHHHHHhh-hcCCC--Cccccc--ccccccCChhHHHHHHhhcCCCCcccCchh--hhhcCCHH
Q psy11591         28 RPHVCHVCSKSFRNRGKLNVHYKR-VHERI--RTHQCN--HCGRAFSDKSNLTVHIRTHTDEKKYMCELC--GAEFAQWA  100 (220)
Q Consensus        28 ~~~~C~~C~~~~~~~~~l~~H~~~-~h~~~--~~~~C~--~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C--~~~f~~~~  100 (220)
                      .++.|..|...|.....|..|... .|.++  +++.|+  .|++.|.....+..|...+.+..++.+..-  ...+....
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  367 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKLLNSSSKFSPLL  367 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCccccccccCcccccccc
Confidence            467888888888888888888743 78888  888898  799999888888888888888777666442  22222222


Q ss_pred             HHHhHH------HHhCCcceecC--cCccccCChhhHHHHHhhhcCCC--ceeCCccccccCCHHHHHHHHHHcCCCCcc
Q psy11591        101 TLYNHK------FTHNDIKFKCN--YCEKVYNNPSNLQRHIKTHTDNS--LYICEICGKDFGTARYLKRHKDTHNSVNTF  170 (220)
Q Consensus       101 ~l~~h~------~~~~~~~~~C~--~C~~~f~~~~~l~~H~~~h~~~~--~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~  170 (220)
                      ....+.      .......+.+.  .|...+.....+..|...+...+  .+.+..|.+.+.....+..|.+.+....+.
T Consensus       368 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  447 (467)
T COG5048         368 NNEPPQSLQQYKDLKNDKKSETLSNSCIRNFKRDSNLSLHIITHLSFRPYNCKNPPCSKSFNRHYNLIPHKKIHTNHAPL  447 (467)
T ss_pred             CCCCccchhhccCccCCccccccccchhhhhccccccccccccccccCCcCCCCCcchhhccCcccccccccccccCCce
Confidence            111111      11122233332  25566666667777766666555  456677899999998998988888877766


Q ss_pred             ccccccc
Q psy11591        171 VCEVCNT  177 (220)
Q Consensus       171 ~C~~C~~  177 (220)
                      .|..+..
T Consensus       448 ~~~~~~~  454 (467)
T COG5048         448 LCSILKS  454 (467)
T ss_pred             eeccccc
Confidence            6655443


No 70 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=92.57  E-value=0.3  Score=31.68  Aligned_cols=54  Identities=17%  Similarity=0.413  Sum_probs=42.5

Q ss_pred             cceecCcCccccCChhhHHHHHhhhcC------------------------------------------CCceeC----C
Q psy11591        112 IKFKCNYCEKVYNNPSNLQRHIKTHTD------------------------------------------NSLYIC----E  145 (220)
Q Consensus       112 ~~~~C~~C~~~f~~~~~l~~H~~~h~~------------------------------------------~~~~~C----~  145 (220)
                      +.+.|..|+..+.. +.+..|++..+.                                          -.-|.|    .
T Consensus        10 ~vlIC~~C~~av~~-~~v~~HL~~~H~~~~~~~~~~i~~~~~~~~~l~~~~~~~~~p~~~~~Pi~gLp~~~G~~C~~~~~   88 (109)
T PF12013_consen   10 RVLICRQCQYAVQP-SEVESHLRKRHHILKSQERQRIVEAIRQWPDLLPDPDDLQIPPDPSPPIPGLPVYDGYRCQCDPP   88 (109)
T ss_pred             CEEEeCCCCcccCc-hHHHHHHHHhcccccHHHHHHHHHHHHhhhhcccCccccCCCCCCCCcCCCCCCCCCeeeecCCC
Confidence            45789999988765 788888884332                                          011899    9


Q ss_pred             ccccccCCHHHHHHHHHHcCC
Q psy11591        146 ICGKDFGTARYLKRHKDTHNS  166 (220)
Q Consensus       146 ~C~~~f~~~~~l~~H~~~h~~  166 (220)
                      .|+..+.+...+.+|++.+||
T Consensus        89 ~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   89 HCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CCCcEeccHHHHHHHHHHhcC
Confidence            999999999999999998775


No 71 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=91.76  E-value=0.27  Score=31.88  Aligned_cols=21  Identities=19%  Similarity=0.377  Sum_probs=15.2

Q ss_pred             CCcccccchhhcCChhHHHHH
Q psy11591         28 RPHVCHVCSKSFRNRGKLNVH   48 (220)
Q Consensus        28 ~~~~C~~C~~~~~~~~~l~~H   48 (220)
                      -|..|+.|+-++.+...|.+-
T Consensus        14 LP~~CpiCgLtLVss~HLARS   34 (112)
T TIGR00622        14 LPVECPICGLTLILSTHLARS   34 (112)
T ss_pred             CCCcCCcCCCEEeccchHHHh
Confidence            467788888877777777764


No 72 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=90.74  E-value=0.14  Score=23.83  Aligned_cols=9  Identities=33%  Similarity=0.969  Sum_probs=5.3

Q ss_pred             ccccccccc
Q psy11591        171 VCEVCNTGF  179 (220)
Q Consensus       171 ~C~~C~~~f  179 (220)
                      .|+.||+.|
T Consensus        16 ~Cp~CG~~F   24 (26)
T PF10571_consen   16 FCPHCGYDF   24 (26)
T ss_pred             cCCCCCCCC
Confidence            556666655


No 73 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=90.29  E-value=0.2  Score=32.39  Aligned_cols=30  Identities=20%  Similarity=0.630  Sum_probs=18.2

Q ss_pred             eecCcCccccCChhhHHHHHhhhcCCCceeCCccccccCCH
Q psy11591        114 FKCNYCEKVYNNPSNLQRHIKTHTDNSLYICEICGKDFGTA  154 (220)
Q Consensus       114 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~  154 (220)
                      ..|+.||..|...           ++.|..||+||..|.-.
T Consensus        10 R~Cp~CG~kFYDL-----------nk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCPSCGAKFYDL-----------NKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCcchhccC-----------CCCCccCCCCCCccCcc
Confidence            4566677666544           23566677777666544


No 74 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=90.21  E-value=0.18  Score=27.82  Aligned_cols=30  Identities=30%  Similarity=0.510  Sum_probs=22.0

Q ss_pred             hCCCCcccccchhhcCChhHHHHHHhhhcC
Q psy11591         25 TGERPHVCHVCSKSFRNRGKLNVHYKRVHE   54 (220)
Q Consensus        25 ~~~~~~~C~~C~~~~~~~~~l~~H~~~~h~   54 (220)
                      .++.-+.|+-|+..|........|.+..|.
T Consensus        13 DGE~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          13 DGEEFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             CCceeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            345557788888888888888888776663


No 75 
>PHA00626 hypothetical protein
Probab=89.02  E-value=0.13  Score=28.41  Aligned_cols=13  Identities=23%  Similarity=0.572  Sum_probs=7.6

Q ss_pred             CcccccccccccC
Q psy11591        168 NTFVCEVCNTGFK  180 (220)
Q Consensus       168 ~~~~C~~C~~~f~  180 (220)
                      ..|.|+.||+.|+
T Consensus        22 nrYkCkdCGY~ft   34 (59)
T PHA00626         22 DDYVCCDCGYNDS   34 (59)
T ss_pred             cceEcCCCCCeec
Confidence            4566666666553


No 76 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=88.23  E-value=0.26  Score=27.23  Aligned_cols=28  Identities=21%  Similarity=0.452  Sum_probs=17.8

Q ss_pred             CCCceeCCccccccCCHHHHHHHHHHcC
Q psy11591        138 DNSLYICEICGKDFGTARYLKRHKDTHN  165 (220)
Q Consensus       138 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~  165 (220)
                      |+.-+.||.||..|.......+|....|
T Consensus        14 GE~~lrCPRC~~~FR~~K~Y~RHVNKaH   41 (65)
T COG4049          14 GEEFLRCPRCGMVFRRRKDYIRHVNKAH   41 (65)
T ss_pred             CceeeeCCchhHHHHHhHHHHHHhhHHh
Confidence            4555667777777766666666665444


No 77 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=87.71  E-value=0.32  Score=24.21  Aligned_cols=9  Identities=22%  Similarity=0.855  Sum_probs=4.4

Q ss_pred             eecCcCccc
Q psy11591        114 FKCNYCEKV  122 (220)
Q Consensus       114 ~~C~~C~~~  122 (220)
                      |.|..||..
T Consensus         3 ~~C~~CG~i   11 (34)
T cd00729           3 WVCPVCGYI   11 (34)
T ss_pred             EECCCCCCE
Confidence            445555544


No 78 
>KOG4173|consensus
Probab=87.67  E-value=0.34  Score=34.75  Aligned_cols=77  Identities=23%  Similarity=0.537  Sum_probs=42.7

Q ss_pred             ccCch--hhhhcCCHHHHHhHHHHhCCcceecCcCccccCChhhHHHHHhhh----------cCCCceeCCc--cccccC
Q psy11591         87 YMCEL--CGAEFAQWATLYNHKFTHNDIKFKCNYCEKVYNNPSNLQRHIKTH----------TDNSLYICEI--CGKDFG  152 (220)
Q Consensus        87 ~~C~~--C~~~f~~~~~l~~h~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h----------~~~~~~~C~~--C~~~f~  152 (220)
                      +.|++  |-..|........|......  -.|..|.+.|++...|..|+...          .|..-|.|-+  |+..|.
T Consensus        80 ~~cqvagc~~~~d~lD~~E~hY~~~h~--~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KFk  157 (253)
T KOG4173|consen   80 FACQVAGCCQVFDALDDYEHHYHTLHG--NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKFK  157 (253)
T ss_pred             ccccccchHHHHhhhhhHHHhhhhccc--chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhhh
Confidence            44543  44555555555554322211  14666666666666666665432          2445567744  777777


Q ss_pred             CHHHHHHHHHHcC
Q psy11591        153 TARYLKRHKDTHN  165 (220)
Q Consensus       153 ~~~~l~~H~~~h~  165 (220)
                      +...-..|+..-|
T Consensus       158 T~r~RkdH~I~~H  170 (253)
T KOG4173|consen  158 TSRDRKDHMIRMH  170 (253)
T ss_pred             hhhhhhhHHHHhc
Confidence            7777777765433


No 79 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=87.59  E-value=0.6  Score=23.70  Aligned_cols=9  Identities=22%  Similarity=0.582  Sum_probs=3.7

Q ss_pred             ccccccccc
Q psy11591        170 FVCEVCNTG  178 (220)
Q Consensus       170 ~~C~~C~~~  178 (220)
                      .+|+.|+..
T Consensus        26 vrC~~C~~~   34 (37)
T PF13719_consen   26 VRCPKCGHV   34 (37)
T ss_pred             EECCCCCcE
Confidence            344444433


No 80 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=86.43  E-value=0.98  Score=31.65  Aligned_cols=12  Identities=25%  Similarity=0.686  Sum_probs=6.7

Q ss_pred             CCCCcccccccc
Q psy11591        165 NSVNTFVCEVCN  176 (220)
Q Consensus       165 ~~~~~~~C~~C~  176 (220)
                      .|+.|-+|++||
T Consensus       145 ~ge~P~~CPiCg  156 (166)
T COG1592         145 EGEAPEVCPICG  156 (166)
T ss_pred             cCCCCCcCCCCC
Confidence            345556666665


No 81 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=86.42  E-value=0.46  Score=33.24  Aligned_cols=25  Identities=28%  Similarity=0.733  Sum_probs=19.9

Q ss_pred             cceecCcCccccCChhhHHHHHhhhcCCCceeCCcccc
Q psy11591        112 IKFKCNYCEKVYNNPSNLQRHIKTHTDNSLYICEICGK  149 (220)
Q Consensus       112 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~  149 (220)
                      ..|.|++||..             +.++.|..||.||.
T Consensus       133 ~~~vC~vCGy~-------------~~ge~P~~CPiCga  157 (166)
T COG1592         133 KVWVCPVCGYT-------------HEGEAPEVCPICGA  157 (166)
T ss_pred             CEEEcCCCCCc-------------ccCCCCCcCCCCCC
Confidence            36999999876             45678889999984


No 82 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=85.85  E-value=0.085  Score=36.48  Aligned_cols=17  Identities=18%  Similarity=0.432  Sum_probs=10.7

Q ss_pred             ccccccccccCchhHHH
Q psy11591        170 FVCEVCNTGFKVKKHLT  186 (220)
Q Consensus       170 ~~C~~C~~~f~~~~~l~  186 (220)
                      ++|+.||++|.....+.
T Consensus        29 ~~c~~c~~~f~~~e~~~   45 (154)
T PRK00464         29 RECLACGKRFTTFERVE   45 (154)
T ss_pred             eeccccCCcceEeEecc
Confidence            66777777766655443


No 83 
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=85.61  E-value=0.35  Score=32.17  Aligned_cols=58  Identities=26%  Similarity=0.505  Sum_probs=29.8

Q ss_pred             CCCCcccCchhhhhcCCHHHHHhHHHHhCCcceecCcCccccCC--hhhHHHHHhhhcCCCceeCCccccccCCHH
Q psy11591         82 TDEKKYMCELCGAEFAQWATLYNHKFTHNDIKFKCNYCEKVYNN--PSNLQRHIKTHTDNSLYICEICGKDFGTAR  155 (220)
Q Consensus        82 ~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~C~~C~~~f~~--~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~  155 (220)
                      .+.+.|+|++|..+..++.-|+         |=.|  ||+..-+  ...|.+|...+.     .||+|..+|++++
T Consensus        76 ~d~~lYeCnIC~etS~ee~FLK---------PneC--CgY~iCn~Cya~LWK~~~~yp-----vCPvCkTSFKss~  135 (140)
T PF05290_consen   76 LDPKLYECNICKETSAEERFLK---------PNEC--CGYSICNACYANLWKFCNLYP-----VCPVCKTSFKSSS  135 (140)
T ss_pred             cCCCceeccCcccccchhhcCC---------cccc--cchHHHHHHHHHHHHHcccCC-----CCCcccccccccc
Confidence            3446677777776665553221         2233  4433222  234555544332     6777777777654


No 84 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=85.48  E-value=0.15  Score=37.55  Aligned_cols=13  Identities=23%  Similarity=0.519  Sum_probs=9.4

Q ss_pred             ccccccccccCch
Q psy11591        170 FVCEVCNTGFKVK  182 (220)
Q Consensus       170 ~~C~~C~~~f~~~  182 (220)
                      ..|+.||++|...
T Consensus        49 ~vCP~CgyA~~~~   61 (214)
T PF09986_consen   49 WVCPHCGYAAFEE   61 (214)
T ss_pred             EECCCCCCccccc
Confidence            5689999876643


No 85 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=85.18  E-value=0.8  Score=23.25  Aligned_cols=10  Identities=30%  Similarity=0.776  Sum_probs=4.7

Q ss_pred             eCCccccccC
Q psy11591        143 ICEICGKDFG  152 (220)
Q Consensus       143 ~C~~C~~~f~  152 (220)
                      .|+.|+..|.
T Consensus         4 ~CP~C~~~~~   13 (38)
T TIGR02098         4 QCPNCKTSFR   13 (38)
T ss_pred             ECCCCCCEEE
Confidence            4444544443


No 86 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=84.52  E-value=1.2  Score=22.44  Aligned_cols=12  Identities=17%  Similarity=0.600  Sum_probs=5.1

Q ss_pred             eCCccccccCCH
Q psy11591        143 ICEICGKDFGTA  154 (220)
Q Consensus       143 ~C~~C~~~f~~~  154 (220)
                      .|+.|+..|.-.
T Consensus         4 ~Cp~C~~~y~i~   15 (36)
T PF13717_consen    4 TCPNCQAKYEID   15 (36)
T ss_pred             ECCCCCCEEeCC
Confidence            344444444433


No 87 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=83.26  E-value=1.1  Score=23.82  Aligned_cols=10  Identities=20%  Similarity=0.743  Sum_probs=4.9

Q ss_pred             eecCcCcccc
Q psy11591        114 FKCNYCEKVY  123 (220)
Q Consensus       114 ~~C~~C~~~f  123 (220)
                      |.|..||..|
T Consensus         3 Y~C~~Cg~~~   12 (44)
T smart00659        3 YICGECGREN   12 (44)
T ss_pred             EECCCCCCEe
Confidence            4455555444


No 88 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=82.76  E-value=0.93  Score=29.99  Aligned_cols=30  Identities=10%  Similarity=0.203  Sum_probs=19.0

Q ss_pred             eecCcCccccCChhhHHHHHhhhcCCCceeCCccccccCCH
Q psy11591        114 FKCNYCEKVYNNPSNLQRHIKTHTDNSLYICEICGKDFGTA  154 (220)
Q Consensus       114 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~  154 (220)
                      ..|+.||+.|...           ++.|..|++||..|...
T Consensus        10 r~Cp~cg~kFYDL-----------nk~p~vcP~cg~~~~~~   39 (129)
T TIGR02300        10 RICPNTGSKFYDL-----------NRRPAVSPYTGEQFPPE   39 (129)
T ss_pred             ccCCCcCcccccc-----------CCCCccCCCcCCccCcc
Confidence            4677777776543           33566777777776554


No 89 
>KOG2186|consensus
Probab=82.08  E-value=1  Score=33.48  Aligned_cols=46  Identities=28%  Similarity=0.719  Sum_probs=30.0

Q ss_pred             eecCcCccccCChhhHHHHHhhhcCCCceeCCccccccCCHHHHHHHHH
Q psy11591        114 FKCNYCEKVYNNPSNLQRHIKTHTDNSLYICEICGKDFGTARYLKRHKD  162 (220)
Q Consensus       114 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~  162 (220)
                      |.|..||....-+ .+.+|+...++ .-|.|-.|++.|-. .....|..
T Consensus         4 FtCnvCgEsvKKp-~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    4 FTCNVCGESVKKP-QVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             Eehhhhhhhcccc-chHHHHHhccC-CeeEEeeccccccc-chhhhhhh
Confidence            5677777776544 45557766666 45777778877776 44556654


No 90 
>KOG2186|consensus
Probab=81.71  E-value=1.4  Score=32.89  Aligned_cols=45  Identities=24%  Similarity=0.622  Sum_probs=30.3

Q ss_pred             ccccccccccCChhHHHHHHhhcCCCCcccCchhhhhcCCHHHHHhHH
Q psy11591         59 HQCNHCGRAFSDKSNLTVHIRTHTDEKKYMCELCGAEFAQWATLYNHK  106 (220)
Q Consensus        59 ~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~h~  106 (220)
                      |.|..||...... .+..|+...++ .-|.|.-|+++|.. .....|.
T Consensus         4 FtCnvCgEsvKKp-~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~   48 (276)
T KOG2186|consen    4 FTCNVCGESVKKP-QVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHT   48 (276)
T ss_pred             Eehhhhhhhcccc-chHHHHHhccC-CeeEEeeccccccc-chhhhhh
Confidence            6777777776644 45557776666 56777778877777 4555654


No 91 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=81.15  E-value=2.2  Score=29.78  Aligned_cols=34  Identities=24%  Similarity=0.491  Sum_probs=22.2

Q ss_pred             hcCCCceeCCccccccCCHHHHHHHHHHcCCCCcccccccccc
Q psy11591        136 HTDNSLYICEICGKDFGTARYLKRHKDTHNSVNTFVCEVCNTG  178 (220)
Q Consensus       136 h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~  178 (220)
                      .....-|.|+.|+..|+....+.         .-|.|+.||..
T Consensus       104 e~~~~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~  137 (158)
T TIGR00373       104 ETNNMFFICPNMCVRFTFNEAME---------LNFTCPRCGAM  137 (158)
T ss_pred             ccCCCeEECCCCCcEeeHHHHHH---------cCCcCCCCCCE
Confidence            34455677777777777766663         24777777753


No 92 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=80.83  E-value=0.81  Score=25.77  Aligned_cols=11  Identities=18%  Similarity=0.618  Sum_probs=6.2

Q ss_pred             CcceecCcCcc
Q psy11591        111 DIKFKCNYCEK  121 (220)
Q Consensus       111 ~~~~~C~~C~~  121 (220)
                      ..+|.|+.||+
T Consensus        48 g~~Y~Cp~CGF   58 (61)
T COG2888          48 GNPYRCPKCGF   58 (61)
T ss_pred             CCceECCCcCc
Confidence            44566666654


No 93 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=78.69  E-value=0.36  Score=35.54  Aligned_cols=44  Identities=23%  Similarity=0.542  Sum_probs=24.2

Q ss_pred             CCcccccchhhcCChhHHHHHHhhh---------cCCCCc-----ccccccccccCCh
Q psy11591         28 RPHVCHVCSKSFRNRGKLNVHYKRV---------HERIRT-----HQCNHCGRAFSDK   71 (220)
Q Consensus        28 ~~~~C~~C~~~~~~~~~l~~H~~~~---------h~~~~~-----~~C~~C~~~~~~~   71 (220)
                      +.+.||.|+..|..........+..         ..+..|     +.||.||.++...
T Consensus         4 k~~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    4 KKITCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             CceECCCCCCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCCCccccc
Confidence            4567888887777664433332111         122222     5788888776543


No 94 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=78.21  E-value=2.2  Score=29.34  Aligned_cols=37  Identities=16%  Similarity=0.336  Sum_probs=19.3

Q ss_pred             CCCcccccchhhcCChhHHHHHHhhhcCCCCccccccccccc
Q psy11591         27 ERPHVCHVCSKSFRNRGKLNVHYKRVHERIRTHQCNHCGRAF   68 (220)
Q Consensus        27 ~~~~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~~~   68 (220)
                      ..-|.|+.|+..|.....+..-    .. ...|.|+.||..+
T Consensus        97 ~~~Y~Cp~C~~~y~~~ea~~~~----d~-~~~f~Cp~Cg~~l  133 (147)
T smart00531       97 NAYYKCPNCQSKYTFLEANQLL----DM-DGTFTCPRCGEEL  133 (147)
T ss_pred             CcEEECcCCCCEeeHHHHHHhc----CC-CCcEECCCCCCEE
Confidence            3446777777666644332220    11 2237777777654


No 95 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=78.05  E-value=1.8  Score=23.06  Aligned_cols=7  Identities=43%  Similarity=1.184  Sum_probs=3.1

Q ss_pred             eeCCccc
Q psy11591        142 YICEICG  148 (220)
Q Consensus       142 ~~C~~C~  148 (220)
                      ..|+.||
T Consensus        22 ~~Cp~CG   28 (46)
T PRK00398         22 VRCPYCG   28 (46)
T ss_pred             eECCCCC
Confidence            3444444


No 96 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=77.94  E-value=2.3  Score=29.66  Aligned_cols=30  Identities=17%  Similarity=0.398  Sum_probs=15.6

Q ss_pred             CCcccccchhhcCChhHHHHHHhhhcCCCCcccccccccc
Q psy11591         28 RPHVCHVCSKSFRNRGKLNVHYKRVHERIRTHQCNHCGRA   67 (220)
Q Consensus        28 ~~~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~~   67 (220)
                      .-|.|+.|+..|+...++.          ..|.|+.||..
T Consensus       108 ~~Y~Cp~c~~r~tf~eA~~----------~~F~Cp~Cg~~  137 (158)
T TIGR00373       108 MFFICPNMCVRFTFNEAME----------LNFTCPRCGAM  137 (158)
T ss_pred             CeEECCCCCcEeeHHHHHH----------cCCcCCCCCCE
Confidence            3455666665555444432          13566666654


No 97 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=77.73  E-value=0.29  Score=26.93  Aligned_cols=29  Identities=24%  Similarity=0.602  Sum_probs=16.0

Q ss_pred             cccccchhhcCChhHHHHHHhhhcCCCCccccccccc
Q psy11591         30 HVCHVCSKSFRNRGKLNVHYKRVHERIRTHQCNHCGR   66 (220)
Q Consensus        30 ~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~   66 (220)
                      |.|..|+..|.....+.       . .....|+.|+.
T Consensus         6 y~C~~Cg~~fe~~~~~~-------~-~~~~~CP~Cg~   34 (52)
T TIGR02605         6 YRCTACGHRFEVLQKMS-------D-DPLATCPECGG   34 (52)
T ss_pred             EEeCCCCCEeEEEEecC-------C-CCCCCCCCCCC
Confidence            66777777666443211       1 23456777775


No 98 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=77.52  E-value=0.83  Score=34.10  Aligned_cols=29  Identities=21%  Similarity=0.343  Sum_probs=22.4

Q ss_pred             CCCcccccccccccCchhHHHHHhhhccc
Q psy11591        166 SVNTFVCEVCNTGFKVKKHLTQHYKSHSM  194 (220)
Q Consensus       166 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~  194 (220)
                      ..+++.|+.|++....-..|.+-.++|.=
T Consensus       206 k~k~~PCPKCg~et~eTkdLSmStR~hky  234 (314)
T PF06524_consen  206 KGKPIPCPKCGYETQETKDLSMSTRSHKY  234 (314)
T ss_pred             cCCCCCCCCCCCcccccccceeeeecchh
Confidence            44788999999988888888777777643


No 99 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=76.88  E-value=4.1  Score=28.05  Aligned_cols=16  Identities=25%  Similarity=0.636  Sum_probs=8.8

Q ss_pred             CCceeCCccccccCCH
Q psy11591        139 NSLYICEICGKDFGTA  154 (220)
Q Consensus       139 ~~~~~C~~C~~~f~~~  154 (220)
                      ..-|.|+.|+..|...
T Consensus        97 ~~~Y~Cp~C~~~y~~~  112 (147)
T smart00531       97 NAYYKCPNCQSKYTFL  112 (147)
T ss_pred             CcEEECcCCCCEeeHH
Confidence            3445666666555543


No 100
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=76.84  E-value=2.8  Score=29.91  Aligned_cols=32  Identities=22%  Similarity=0.568  Sum_probs=20.7

Q ss_pred             CCCceeCCccccccCCHHHHHHHHHHcCCCCcccccccccc
Q psy11591        138 DNSLYICEICGKDFGTARYLKRHKDTHNSVNTFVCEVCNTG  178 (220)
Q Consensus       138 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~  178 (220)
                      ...-|.|+.|+..|+....+.         .-|.|+.||..
T Consensus       114 ~~~~Y~Cp~C~~rytf~eA~~---------~~F~Cp~Cg~~  145 (178)
T PRK06266        114 NNMFFFCPNCHIRFTFDEAME---------YGFRCPQCGEM  145 (178)
T ss_pred             CCCEEECCCCCcEEeHHHHhh---------cCCcCCCCCCC
Confidence            445577777777777666542         24777777753


No 101
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=76.51  E-value=1  Score=32.11  Aligned_cols=40  Identities=15%  Similarity=0.420  Sum_probs=28.0

Q ss_pred             HHHhhCCCCcccccchhhcCChhHHHHHHhhhcCCCCcccccccccccCC
Q psy11591         21 IMIHTGERPHVCHVCSKSFRNRGKLNVHYKRVHERIRTHQCNHCGRAFSD   70 (220)
Q Consensus        21 ~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~~~~~   70 (220)
                      +..-....-|.|+.|+..|+...++.          ..|.|+.||..+..
T Consensus       109 l~~e~~~~~Y~Cp~C~~rytf~eA~~----------~~F~Cp~Cg~~L~~  148 (178)
T PRK06266        109 LEEEENNMFFFCPNCHIRFTFDEAME----------YGFRCPQCGEMLEE  148 (178)
T ss_pred             hhhccCCCEEECCCCCcEEeHHHHhh----------cCCcCCCCCCCCee
Confidence            33333445689999998887776542          26999999987553


No 102
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=76.32  E-value=0.82  Score=35.04  Aligned_cols=49  Identities=22%  Similarity=0.396  Sum_probs=32.1

Q ss_pred             eCCccccccCCHHHHHHHHHHcCCCCcccccccccccCchhHHHHHhhhcc
Q psy11591        143 ICEICGKDFGTARYLKRHKDTHNSVNTFVCEVCNTGFKVKKHLTQHYKSHS  193 (220)
Q Consensus       143 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~  193 (220)
                      .|-.|...|.....-..  ..-+....|+|+.|...|-...+.-.|...|.
T Consensus       364 ~Cf~CQ~~fp~~~~~~~--~~~~ss~rY~Ce~CK~~FC~dCdvfiHe~Lh~  412 (421)
T COG5151         364 HCFVCQGPFPKPPVSPF--DESTSSGRYQCELCKSTFCSDCDVFIHETLHF  412 (421)
T ss_pred             cceeccCCCCCCCCCcc--cccccccceechhhhhhhhhhhHHHHHHHHhh
Confidence            36667666654432111  11223457999999999999999999987764


No 103
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=76.31  E-value=3.4  Score=21.70  Aligned_cols=22  Identities=36%  Similarity=0.567  Sum_probs=8.8

Q ss_pred             CceeCCccccccCCH----HHHHHHH
Q psy11591        140 SLYICEICGKDFGTA----RYLKRHK  161 (220)
Q Consensus       140 ~~~~C~~C~~~f~~~----~~l~~H~  161 (220)
                      ....|.+|++.+...    +.|.+|+
T Consensus        15 ~~a~C~~C~~~~~~~~~~ts~l~~HL   40 (45)
T PF02892_consen   15 KKAKCKYCGKVIKYSSGGTSNLKRHL   40 (45)
T ss_dssp             S-EEETTTTEE-----SSTHHHHHHH
T ss_pred             CeEEeCCCCeEEeeCCCcHHHHHHhh
Confidence            334555555554442    4555555


No 104
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=76.22  E-value=0.32  Score=25.14  Aligned_cols=29  Identities=24%  Similarity=0.560  Sum_probs=16.2

Q ss_pred             cccccchhhcCChhHHHHHHhhhcCCCCccccccccc
Q psy11591         30 HVCHVCSKSFRNRGKLNVHYKRVHERIRTHQCNHCGR   66 (220)
Q Consensus        30 ~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~   66 (220)
                      |.|..||..|.......        ......|+.|+.
T Consensus         6 y~C~~Cg~~fe~~~~~~--------~~~~~~CP~Cg~   34 (41)
T smart00834        6 YRCEDCGHTFEVLQKIS--------DDPLATCPECGG   34 (41)
T ss_pred             EEcCCCCCEEEEEEecC--------CCCCCCCCCCCC
Confidence            66777777665443211        123456777765


No 105
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=74.68  E-value=3.5  Score=19.01  Aligned_cols=19  Identities=21%  Similarity=0.639  Sum_probs=10.2

Q ss_pred             eCCccccccCCHHHHHHHHH
Q psy11591        143 ICEICGKDFGTARYLKRHKD  162 (220)
Q Consensus       143 ~C~~C~~~f~~~~~l~~H~~  162 (220)
                      .||.|++.+ ....+..|..
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            456666655 3445555544


No 106
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=74.45  E-value=0.9  Score=23.79  Aligned_cols=29  Identities=24%  Similarity=0.582  Sum_probs=15.0

Q ss_pred             cccccchhhcCChhHHHHHHhhhcCCCCccccccccc
Q psy11591         30 HVCHVCSKSFRNRGKLNVHYKRVHERIRTHQCNHCGR   66 (220)
Q Consensus        30 ~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~   66 (220)
                      |.|..||..|.....+.       . .....|+.|+.
T Consensus         6 y~C~~Cg~~fe~~~~~~-------~-~~~~~CP~Cg~   34 (42)
T PF09723_consen    6 YRCEECGHEFEVLQSIS-------E-DDPVPCPECGS   34 (42)
T ss_pred             EEeCCCCCEEEEEEEcC-------C-CCCCcCCCCCC
Confidence            56666666665443211       1 23456666665


No 107
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=73.21  E-value=2  Score=22.91  Aligned_cols=11  Identities=18%  Similarity=0.788  Sum_probs=6.3

Q ss_pred             CCccccccccc
Q psy11591        167 VNTFVCEVCNT  177 (220)
Q Consensus       167 ~~~~~C~~C~~  177 (220)
                      ...|+|..|++
T Consensus        35 ~~~~~C~~C~~   45 (46)
T PF12760_consen   35 RGRYRCKACRK   45 (46)
T ss_pred             CCeEECCCCCC
Confidence            45566666654


No 108
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=72.59  E-value=0.62  Score=27.67  Aligned_cols=42  Identities=12%  Similarity=0.306  Sum_probs=24.8

Q ss_pred             eeCCccccccCCHHHHHHHHHHcCCCCccccc--ccccccCchhHH
Q psy11591        142 YICEICGKDFGTARYLKRHKDTHNSVNTFVCE--VCNTGFKVKKHL  185 (220)
Q Consensus       142 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~--~C~~~f~~~~~l  185 (220)
                      +.|+.||.......+-...  ....+.-++|.  .||.+|.....+
T Consensus         2 m~CP~Cg~~a~irtSr~~s--~~~~~~Y~qC~N~eCg~tF~t~es~   45 (72)
T PRK09678          2 FHCPLCQHAAHARTSRYIT--DTTKERYHQCQNVNCSATFITYESV   45 (72)
T ss_pred             ccCCCCCCccEEEEChhcC--hhhheeeeecCCCCCCCEEEEEEEE
Confidence            4688888765322221111  12445668897  899998776544


No 109
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=72.54  E-value=3.5  Score=22.42  Aligned_cols=21  Identities=33%  Similarity=0.733  Sum_probs=12.3

Q ss_pred             eeCCccccccCCH-----HHHHHHHH
Q psy11591        142 YICEICGKDFGTA-----RYLKRHKD  162 (220)
Q Consensus       142 ~~C~~C~~~f~~~-----~~l~~H~~  162 (220)
                      -.|..|++.++..     +.|.+|+.
T Consensus        19 a~C~~C~~~l~~~~~~gTs~L~rHl~   44 (50)
T smart00614       19 AKCKYCGKKLSRSSKGGTSNLRRHLR   44 (50)
T ss_pred             EEecCCCCEeeeCCCCCcHHHHHHHH
Confidence            4566666665443     46666665


No 110
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=71.71  E-value=1.7  Score=29.21  Aligned_cols=22  Identities=55%  Similarity=0.907  Sum_probs=9.1

Q ss_pred             eeCCccccccCCHHHHHHHHHHcCC
Q psy11591        142 YICEICGKDFGTARYLKRHKDTHNS  166 (220)
Q Consensus       142 ~~C~~C~~~f~~~~~l~~H~~~h~~  166 (220)
                      ..|-+||+.|...   .+|+..|+|
T Consensus        73 i~clecGk~~k~L---krHL~~~~g   94 (132)
T PF05443_consen   73 IICLECGKKFKTL---KRHLRTHHG   94 (132)
T ss_dssp             EE-TBT--EESBH---HHHHHHTT-
T ss_pred             eEEccCCcccchH---HHHHHHccC
Confidence            4455555555533   455555544


No 111
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=70.77  E-value=1.3  Score=21.28  Aligned_cols=9  Identities=33%  Similarity=0.918  Sum_probs=4.4

Q ss_pred             ccccccccc
Q psy11591        169 TFVCEVCNT  177 (220)
Q Consensus       169 ~~~C~~C~~  177 (220)
                      .|.|+.|+.
T Consensus        19 ~~vCp~C~~   27 (30)
T PF08274_consen   19 LLVCPECGH   27 (30)
T ss_dssp             SEEETTTTE
T ss_pred             EEeCCcccc
Confidence            355555543


No 112
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=70.23  E-value=2.8  Score=23.63  Aligned_cols=21  Identities=14%  Similarity=0.308  Sum_probs=10.6

Q ss_pred             hhhHHHHHhhhcCCCceeCCc
Q psy11591        126 PSNLQRHIKTHTDNSLYICEI  146 (220)
Q Consensus       126 ~~~l~~H~~~h~~~~~~~C~~  146 (220)
                      ...|..|+...-..++..|++
T Consensus        23 r~~l~~H~~~~C~~~~v~C~~   43 (60)
T PF02176_consen   23 RKELDDHLENECPKRPVPCPY   43 (60)
T ss_dssp             CCCHHHHHHTTSTTSEEE-SS
T ss_pred             HHHHHHHHHccCCCCcEECCC
Confidence            335555555444555555555


No 113
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=68.48  E-value=2.4  Score=23.99  Aligned_cols=10  Identities=20%  Similarity=0.590  Sum_probs=5.6

Q ss_pred             cceecCcCcc
Q psy11591        112 IKFKCNYCEK  121 (220)
Q Consensus       112 ~~~~C~~C~~  121 (220)
                      .+|.|+.||+
T Consensus        47 ~~Y~CP~CGF   56 (59)
T PRK14890         47 NPYTCPKCGF   56 (59)
T ss_pred             CceECCCCCC
Confidence            4556666654


No 114
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=68.14  E-value=3.1  Score=22.60  Aligned_cols=10  Identities=40%  Similarity=1.278  Sum_probs=4.7

Q ss_pred             eeCCcccccc
Q psy11591        142 YICEICGKDF  151 (220)
Q Consensus       142 ~~C~~C~~~f  151 (220)
                      |.|..||+.|
T Consensus         7 Y~C~~Cg~~~   16 (49)
T COG1996           7 YKCARCGREV   16 (49)
T ss_pred             EEhhhcCCee
Confidence            4444444444


No 115
>KOG4124|consensus
Probab=67.92  E-value=0.59  Score=36.39  Aligned_cols=68  Identities=24%  Similarity=0.399  Sum_probs=46.3

Q ss_pred             CCceeCCc--cccccCCHHHHHHHHHHcC-------------------CCCcccccccccccCchhHHHHHhhhcccccC
Q psy11591        139 NSLYICEI--CGKDFGTARYLKRHKDTHN-------------------SVNTFVCEVCNTGFKVKKHLTQHYKSHSMFIP  197 (220)
Q Consensus       139 ~~~~~C~~--C~~~f~~~~~l~~H~~~h~-------------------~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~  197 (220)
                      .++|+|++  |++.++...+|..|...-|                   ..|+|+|++|.+++.....|.-|...-+.+..
T Consensus       347 ~~~~~~~vp~~~~~~~n~ng~~~~~~~~h~s~i~~~s~~~~ph~~~~~~nk~~r~~i~~~~~k~~~~l~~~~~~~~~~~s  426 (442)
T KOG4124|consen  347 DKPYKCPVPNCDKAYKNQNGLKYHKLHGHCSPITTPTPAPIPHQGFVVENKPYRCEVCSKRYKNLNGLKYHRTHSHLQVS  426 (442)
T ss_pred             cCCCCCCCCcchhhcccCcceeeccccCcCCCCCCCCCCCCCcceeeeccCcccChhhhhhhccCCCCCceeehhhhhhh
Confidence            56788865  9999888888877754322                   24789999999998887777766555444444


Q ss_pred             CCCCCCCCC
Q psy11591        198 PEQFPGLDP  206 (220)
Q Consensus       198 ~~~~~~~~~  206 (220)
                      |-.+..++|
T Consensus       427 ~~~~~~~~~  435 (442)
T KOG4124|consen  427 MAQAQREVQ  435 (442)
T ss_pred             hhhhhhhcc
Confidence            444444443


No 116
>KOG2807|consensus
Probab=66.93  E-value=4.7  Score=31.35  Aligned_cols=26  Identities=23%  Similarity=0.474  Sum_probs=21.6

Q ss_pred             CcccccccccccCchhHHHHHhhhcc
Q psy11591        168 NTFVCEVCNTGFKVKKHLTQHYKSHS  193 (220)
Q Consensus       168 ~~~~C~~C~~~f~~~~~l~~H~~~h~  193 (220)
                      ..|+|..|...|-...+.-.|-..|.
T Consensus       344 ~~y~C~~Ck~~FCldCDv~iHesLh~  369 (378)
T KOG2807|consen  344 GRYRCESCKNVFCLDCDVFIHESLHN  369 (378)
T ss_pred             CcEEchhccceeeccchHHHHhhhhc
Confidence            45999999999988888888877764


No 117
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=64.68  E-value=5.5  Score=26.86  Aligned_cols=25  Identities=28%  Similarity=0.576  Sum_probs=11.3

Q ss_pred             eecCcCccccCChhhHHHHHhhhcCCCc
Q psy11591        114 FKCNYCEKVYNNPSNLQRHIKTHTDNSL  141 (220)
Q Consensus       114 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~  141 (220)
                      ..|-+||+.|...   .+|++.|+|-.|
T Consensus        73 i~clecGk~~k~L---krHL~~~~gltp   97 (132)
T PF05443_consen   73 IICLECGKKFKTL---KRHLRTHHGLTP   97 (132)
T ss_dssp             EE-TBT--EESBH---HHHHHHTT-S-H
T ss_pred             eEEccCCcccchH---HHHHHHccCCCH
Confidence            5566666665432   666666655443


No 118
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=63.45  E-value=3.3  Score=30.41  Aligned_cols=28  Identities=25%  Similarity=0.721  Sum_probs=14.9

Q ss_pred             ceecCcCccccCChhhHHHHHhhhcCCC
Q psy11591        113 KFKCNYCEKVYNNPSNLQRHIKTHTDNS  140 (220)
Q Consensus       113 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~  140 (220)
                      .|.|+.|++.|....-+++|+...|.++
T Consensus        77 K~~C~lc~KlFkg~eFV~KHI~nKH~e~  104 (214)
T PF04959_consen   77 KWRCPLCGKLFKGPEFVRKHIFNKHPEK  104 (214)
T ss_dssp             EEEE-SSS-EESSHHHHHHHHHHH-HHH
T ss_pred             EECCCCCCcccCChHHHHHHHhhcCHHH
Confidence            4666666666666666666666555543


No 119
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=62.48  E-value=3.2  Score=30.49  Aligned_cols=31  Identities=23%  Similarity=0.589  Sum_probs=20.4

Q ss_pred             cCCCceeCCccccccCCHHHHHHHHHHcCCC
Q psy11591        137 TDNSLYICEICGKDFGTARYLKRHKDTHNSV  167 (220)
Q Consensus       137 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~  167 (220)
                      ..+..|.|+.|+|.|.-...+++|+...|.+
T Consensus        73 ~~~~K~~C~lc~KlFkg~eFV~KHI~nKH~e  103 (214)
T PF04959_consen   73 EDEDKWRCPLCGKLFKGPEFVRKHIFNKHPE  103 (214)
T ss_dssp             SSSEEEEE-SSS-EESSHHHHHHHHHHH-HH
T ss_pred             HcCCEECCCCCCcccCChHHHHHHHhhcCHH
Confidence            3455688888888888888888887765543


No 120
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=61.75  E-value=5.3  Score=25.66  Aligned_cols=30  Identities=10%  Similarity=0.090  Sum_probs=20.6

Q ss_pred             eecCcCccccCChhhHHHHHhhhcCCCceeCCccccccCCH
Q psy11591        114 FKCNYCEKVYNNPSNLQRHIKTHTDNSLYICEICGKDFGTA  154 (220)
Q Consensus       114 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~  154 (220)
                      ..|+.|++.|...           +..|..|++||++|..+
T Consensus        10 ridPetg~KFYDL-----------NrdPiVsPytG~s~P~s   39 (129)
T COG4530          10 RIDPETGKKFYDL-----------NRDPIVSPYTGKSYPRS   39 (129)
T ss_pred             ccCccccchhhcc-----------CCCccccCcccccchHH
Confidence            3577777777543           34678888888888433


No 121
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=61.51  E-value=1.6  Score=22.02  Aligned_cols=30  Identities=17%  Similarity=0.503  Sum_probs=15.0

Q ss_pred             eeCCccccccCCHHHHHHHHHHcCCCCccccccc
Q psy11591        142 YICEICGKDFGTARYLKRHKDTHNSVNTFVCEVC  175 (220)
Q Consensus       142 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C  175 (220)
                      ..||.|+..    ..+.+|-....|...|.|..|
T Consensus         6 v~CP~C~s~----~~v~k~G~~~~G~qryrC~~C   35 (36)
T PF03811_consen    6 VHCPRCQST----EGVKKNGKSPSGHQRYRCKDC   35 (36)
T ss_pred             eeCCCCCCC----CcceeCCCCCCCCEeEecCcC
Confidence            356666543    113344444455556666655


No 122
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=61.27  E-value=3.8  Score=27.40  Aligned_cols=13  Identities=31%  Similarity=0.657  Sum_probs=6.4

Q ss_pred             ccCchhhhhcCCH
Q psy11591         87 YMCELCGAEFAQW   99 (220)
Q Consensus        87 ~~C~~C~~~f~~~   99 (220)
                      .+|..||+.|.+.
T Consensus         2 H~Ct~Cg~~f~dg   14 (131)
T PF09845_consen    2 HQCTKCGRVFEDG   14 (131)
T ss_pred             cccCcCCCCcCCC
Confidence            3455555555543


No 123
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=60.47  E-value=6.1  Score=24.30  Aligned_cols=11  Identities=36%  Similarity=1.204  Sum_probs=5.5

Q ss_pred             ceeCCcccccc
Q psy11591        141 LYICEICGKDF  151 (220)
Q Consensus       141 ~~~C~~C~~~f  151 (220)
                      .+.|..||..|
T Consensus        53 IW~C~kCg~~f   63 (89)
T COG1997          53 IWKCRKCGAKF   63 (89)
T ss_pred             eEEcCCCCCee
Confidence            34555555444


No 124
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=60.30  E-value=3.5  Score=20.18  Aligned_cols=8  Identities=38%  Similarity=0.995  Sum_probs=3.4

Q ss_pred             eeCCcccc
Q psy11591        142 YICEICGK  149 (220)
Q Consensus       142 ~~C~~C~~  149 (220)
                      ..|+.||.
T Consensus        18 irC~~CG~   25 (32)
T PF03604_consen   18 IRCPECGH   25 (32)
T ss_dssp             SSBSSSS-
T ss_pred             EECCcCCC
Confidence            44555543


No 125
>PRK04023 DNA polymerase II large subunit; Validated
Probab=59.02  E-value=8.8  Score=34.86  Aligned_cols=8  Identities=38%  Similarity=0.779  Sum_probs=4.8

Q ss_pred             cccccccc
Q psy11591        170 FVCEVCNT  177 (220)
Q Consensus       170 ~~C~~C~~  177 (220)
                      +.|+.|+.
T Consensus       664 y~CPKCG~  671 (1121)
T PRK04023        664 DECEKCGR  671 (1121)
T ss_pred             CcCCCCCC
Confidence            55666664


No 126
>KOG2593|consensus
Probab=58.43  E-value=11  Score=30.76  Aligned_cols=40  Identities=23%  Similarity=0.528  Sum_probs=27.1

Q ss_pred             hCCCCcccccchhhcCChhHHHHHHhhhcCCCCccccccccccc
Q psy11591         25 TGERPHVCHVCSKSFRNRGKLNVHYKRVHERIRTHQCNHCGRAF   68 (220)
Q Consensus        25 ~~~~~~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~~~   68 (220)
                      +....|.|+.|+++|.....+..-  .  ...-.|.|..|+..+
T Consensus       124 t~~~~Y~Cp~C~kkyt~Lea~~L~--~--~~~~~F~C~~C~gel  163 (436)
T KOG2593|consen  124 TNVAGYVCPNCQKKYTSLEALQLL--D--NETGEFHCENCGGEL  163 (436)
T ss_pred             cccccccCCccccchhhhHHHHhh--c--ccCceEEEecCCCch
Confidence            445669999999998887776643  1  222358888888643


No 127
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=58.33  E-value=3.5  Score=18.71  Aligned_cols=7  Identities=71%  Similarity=2.105  Sum_probs=4.1

Q ss_pred             CCCccch
Q psy11591          2 FKCPQCG    8 (220)
Q Consensus         2 ~~C~~C~    8 (220)
                      |.||.||
T Consensus        17 f~CPnCG   23 (24)
T PF07754_consen   17 FPCPNCG   23 (24)
T ss_pred             EeCCCCC
Confidence            5566665


No 128
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=58.10  E-value=4.4  Score=22.16  Aligned_cols=12  Identities=17%  Similarity=0.490  Sum_probs=7.6

Q ss_pred             Cccccccccccc
Q psy11591        168 NTFVCEVCNTGF  179 (220)
Q Consensus       168 ~~~~C~~C~~~f  179 (220)
                      ..+.|..|++++
T Consensus        36 ~r~~C~~Cgyt~   47 (50)
T PRK00432         36 DRWHCGKCGYTE   47 (50)
T ss_pred             CcEECCCcCCEE
Confidence            456777777654


No 129
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=57.18  E-value=4.1  Score=22.04  Aligned_cols=10  Identities=20%  Similarity=0.713  Sum_probs=6.9

Q ss_pred             cccccccccc
Q psy11591        169 TFVCEVCNTG  178 (220)
Q Consensus       169 ~~~C~~C~~~  178 (220)
                      ++.|..||++
T Consensus        37 R~~CGkCgyT   46 (51)
T COG1998          37 RWACGKCGYT   46 (51)
T ss_pred             eeEeccccce
Confidence            5677777765


No 130
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=55.01  E-value=5.1  Score=20.72  Aligned_cols=18  Identities=28%  Similarity=0.654  Sum_probs=10.1

Q ss_pred             cccccccccccCChhHHH
Q psy11591         58 THQCNHCGRAFSDKSNLT   75 (220)
Q Consensus        58 ~~~C~~C~~~~~~~~~l~   75 (220)
                      ...|+.|+..+.+...+.
T Consensus        19 id~C~~C~G~W~d~~el~   36 (41)
T PF13453_consen   19 IDVCPSCGGIWFDAGELE   36 (41)
T ss_pred             EEECCCCCeEEccHHHHH
Confidence            345666666665555544


No 131
>KOG3408|consensus
Probab=54.16  E-value=9  Score=25.18  Aligned_cols=25  Identities=28%  Similarity=0.640  Sum_probs=19.8

Q ss_pred             CCCCcccccchhhcCChhHHHHHHh
Q psy11591         26 GERPHVCHVCSKSFRNRGKLNVHYK   50 (220)
Q Consensus        26 ~~~~~~C~~C~~~~~~~~~l~~H~~   50 (220)
                      |...|.|-.|.+-|.+...|..|.+
T Consensus        54 G~GqfyCi~CaRyFi~~~~l~~H~k   78 (129)
T KOG3408|consen   54 GGGQFYCIECARYFIDAKALKTHFK   78 (129)
T ss_pred             CCceeehhhhhhhhcchHHHHHHHh
Confidence            3455788889888888888888874


No 132
>PF12907 zf-met2:  Zinc-binding
Probab=53.26  E-value=12  Score=19.35  Aligned_cols=11  Identities=27%  Similarity=0.410  Sum_probs=4.4

Q ss_pred             HHHHHHhhhcC
Q psy11591         44 KLNVHYKRVHE   54 (220)
Q Consensus        44 ~l~~H~~~~h~   54 (220)
                      .|..|...-|+
T Consensus        19 ~L~eH~enKHp   29 (40)
T PF12907_consen   19 QLKEHAENKHP   29 (40)
T ss_pred             HHHHHHHccCC
Confidence            34444433333


No 133
>PF14353 CpXC:  CpXC protein
Probab=52.82  E-value=13  Score=24.85  Aligned_cols=10  Identities=50%  Similarity=1.414  Sum_probs=5.3

Q ss_pred             cccccccccC
Q psy11591         60 QCNHCGRAFS   69 (220)
Q Consensus        60 ~C~~C~~~~~   69 (220)
                      +||.|+..|.
T Consensus         3 tCP~C~~~~~   12 (128)
T PF14353_consen    3 TCPHCGHEFE   12 (128)
T ss_pred             CCCCCCCeeE
Confidence            4555555443


No 134
>KOG2593|consensus
Probab=52.76  E-value=14  Score=30.14  Aligned_cols=35  Identities=29%  Similarity=0.688  Sum_probs=17.8

Q ss_pred             ceecCcCccccCChhhHHHHHhhhcCCCceeCCccccc
Q psy11591        113 KFKCNYCEKVYNNPSNLQRHIKTHTDNSLYICEICGKD  150 (220)
Q Consensus       113 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~  150 (220)
                      -|.|+.|.+.|.+...++.-   -...-.|.|..|+-.
T Consensus       128 ~Y~Cp~C~kkyt~Lea~~L~---~~~~~~F~C~~C~ge  162 (436)
T KOG2593|consen  128 GYVCPNCQKKYTSLEALQLL---DNETGEFHCENCGGE  162 (436)
T ss_pred             cccCCccccchhhhHHHHhh---cccCceEEEecCCCc
Confidence            36666666666655444322   112234666666543


No 135
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=52.55  E-value=2.3  Score=26.82  Aligned_cols=13  Identities=23%  Similarity=0.746  Sum_probs=7.2

Q ss_pred             CCceeCCcccccc
Q psy11591        139 NSLYICEICGKDF  151 (220)
Q Consensus       139 ~~~~~C~~C~~~f  151 (220)
                      ++.|.|+.||..-
T Consensus        20 ~k~FtCp~Cghe~   32 (104)
T COG4888          20 PKTFTCPRCGHEK   32 (104)
T ss_pred             CceEecCccCCee
Confidence            3446666666543


No 136
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=52.25  E-value=10  Score=20.00  Aligned_cols=21  Identities=33%  Similarity=0.567  Sum_probs=16.8

Q ss_pred             ccccccccccCchhHHHHHhh
Q psy11591        170 FVCEVCNTGFKVKKHLTQHYK  190 (220)
Q Consensus       170 ~~C~~C~~~f~~~~~l~~H~~  190 (220)
                      |+|=.|..+...++.|-.||+
T Consensus        21 ykcfqcpftc~~kshl~nhmk   41 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMK   41 (54)
T ss_pred             ceeecCCcccchHHHHHHHHH
Confidence            778888888888888888875


No 137
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=51.97  E-value=7.4  Score=26.76  Aligned_cols=36  Identities=19%  Similarity=0.578  Sum_probs=22.5

Q ss_pred             CCCceeCCccccccCCHHHHHHHHHHcCCCCcccccccccc
Q psy11591        138 DNSLYICEICGKDFGTARYLKRHKDTHNSVNTFVCEVCNTG  178 (220)
Q Consensus       138 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~  178 (220)
                      ..-+|.|. |+..|.+.   ++|-..-.|+ .|.|..|+-.
T Consensus       114 ~~~~Y~C~-C~q~~l~~---RRhn~~~~g~-~YrC~~C~gk  149 (156)
T COG3091         114 TTYPYRCQ-CQQHYLRI---RRHNTVRRGE-VYRCGKCGGK  149 (156)
T ss_pred             cceeEEee-cCCccchh---hhcccccccc-eEEeccCCce
Confidence            34467887 87775543   4555555555 6888888743


No 138
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=51.84  E-value=14  Score=19.11  Aligned_cols=23  Identities=30%  Similarity=0.528  Sum_probs=14.5

Q ss_pred             CCccchhhhcCH--HHHHHHHHHhh
Q psy11591          3 KCPQCGALLKNI--WSLREHIMIHT   25 (220)
Q Consensus         3 ~C~~C~~~f~~~--~~l~~H~~~~~   25 (220)
                      .|+.|++.|...  .+-..|.+.|.
T Consensus        15 ~C~~CgM~Y~~~~~eD~~~H~~yH~   39 (41)
T PF13878_consen   15 TCPTCGMLYSPGSPEDEKLHKKYHD   39 (41)
T ss_pred             CCCCCCCEECCCCHHHHHHHHHHHh
Confidence            588888765543  45666766654


No 139
>KOG3408|consensus
Probab=51.63  E-value=8.5  Score=25.28  Aligned_cols=25  Identities=32%  Similarity=0.545  Sum_probs=20.1

Q ss_pred             CCcccccccccccCchhHHHHHhhh
Q psy11591        167 VNTFVCEVCNTGFKVKKHLTQHYKS  191 (220)
Q Consensus       167 ~~~~~C~~C~~~f~~~~~l~~H~~~  191 (220)
                      ...|.|-.|.+-|.+...|..|.++
T Consensus        55 ~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   55 GGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CceeehhhhhhhhcchHHHHHHHhc
Confidence            3458888898888888888888754


No 140
>KOG2907|consensus
Probab=51.18  E-value=7.4  Score=25.18  Aligned_cols=11  Identities=36%  Similarity=0.933  Sum_probs=5.5

Q ss_pred             eeCCccccccC
Q psy11591        142 YICEICGKDFG  152 (220)
Q Consensus       142 ~~C~~C~~~f~  152 (220)
                      |.|+.|++.|+
T Consensus       103 YTC~kC~~k~~  113 (116)
T KOG2907|consen  103 YTCPKCKYKFT  113 (116)
T ss_pred             EEcCccceeee
Confidence            45555554443


No 141
>KOG4167|consensus
Probab=51.02  E-value=5.8  Score=34.44  Aligned_cols=25  Identities=32%  Similarity=0.664  Sum_probs=20.8

Q ss_pred             CCCccchhhhcCHHHHHHHHHHhhC
Q psy11591          2 FKCPQCGALLKNIWSLREHIMIHTG   26 (220)
Q Consensus         2 ~~C~~C~~~f~~~~~l~~H~~~~~~   26 (220)
                      |.|.+|++.|.....+.+||+.|.-
T Consensus       793 FpCreC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  793 FPCRECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             eehHHHHHHHHHHhhhhHHHHHHHH
Confidence            7788888888888888888888753


No 142
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=50.91  E-value=14  Score=34.48  Aligned_cols=11  Identities=36%  Similarity=1.223  Sum_probs=6.7

Q ss_pred             ceeCCcccccc
Q psy11591        141 LYICEICGKDF  151 (220)
Q Consensus       141 ~~~C~~C~~~f  151 (220)
                      +|.|+.||...
T Consensus       692 vy~CPsCGaev  702 (1337)
T PRK14714        692 VYVCPDCGAEV  702 (1337)
T ss_pred             ceeCccCCCcc
Confidence            46666666543


No 143
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=49.82  E-value=14  Score=20.16  Aligned_cols=18  Identities=22%  Similarity=0.412  Sum_probs=9.3

Q ss_pred             CceeCCccccccCCHHHH
Q psy11591        140 SLYICEICGKDFGTARYL  157 (220)
Q Consensus       140 ~~~~C~~C~~~f~~~~~l  157 (220)
                      +++.|..||..|.-...=
T Consensus         3 k~l~C~dCg~~FvfTa~E   20 (49)
T PF13451_consen    3 KTLTCKDCGAEFVFTAGE   20 (49)
T ss_pred             eeEEcccCCCeEEEehhH
Confidence            345566666555544433


No 144
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=48.01  E-value=12  Score=20.66  Aligned_cols=13  Identities=23%  Similarity=0.761  Sum_probs=6.8

Q ss_pred             eecCcCccccCCh
Q psy11591        114 FKCNYCEKVYNNP  126 (220)
Q Consensus       114 ~~C~~C~~~f~~~  126 (220)
                      |.|+.||..|...
T Consensus        29 W~C~~Cgh~w~~~   41 (55)
T PF14311_consen   29 WKCPKCGHEWKAS   41 (55)
T ss_pred             EECCCCCCeeEcc
Confidence            5555555554443


No 145
>PF07800 DUF1644:  Protein of unknown function (DUF1644);  InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function. The region of interest contains nine highly conserved cysteine residues and is approximately 160 amino acids in length, which probably represent a zinc-binding domain. 
Probab=47.98  E-value=62  Score=22.61  Aligned_cols=61  Identities=18%  Similarity=0.307  Sum_probs=35.3

Q ss_pred             CceeCCccccccCCHHHHHHHHHHcCCCCccccc--ccccccCchhHHHHHhhh-cccccCCCCCC
Q psy11591        140 SLYICEICGKDFGTARYLKRHKDTHNSVNTFVCE--VCNTGFKVKKHLTQHYKS-HSMFIPPEQFP  202 (220)
Q Consensus       140 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~--~C~~~f~~~~~l~~H~~~-h~~~~~~~~~~  202 (220)
                      ....||.|.-...-.. +....+.+-..|+-.|.  .|.+. +++..|+.|.+. |-..+|.+.++
T Consensus        79 ~~L~CPLCRG~V~GWt-vve~AR~~LN~K~RsC~~e~C~F~-GtY~eLrKHar~~HP~~rP~~vDP  142 (162)
T PF07800_consen   79 PELACPLCRGEVKGWT-VVEPARRFLNAKKRSCSQESCSFS-GTYSELRKHARSEHPSARPSEVDP  142 (162)
T ss_pred             ccccCccccCceeceE-EchHHHHHhccCCccCcccccccc-cCHHHHHHHHHhhCCCCCCccCCH
Confidence            3578999954332221 11223444445555664  47776 689999999866 44455555443


No 146
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=47.07  E-value=14  Score=24.76  Aligned_cols=24  Identities=46%  Similarity=0.639  Sum_probs=15.4

Q ss_pred             eeCCccccccCCHHHHHHHHHHcCCCC
Q psy11591        142 YICEICGKDFGTARYLKRHKDTHNSVN  168 (220)
Q Consensus       142 ~~C~~C~~~f~~~~~l~~H~~~h~~~~  168 (220)
                      ..|-++|+.|+   +|.+|+.+|.+--
T Consensus        77 IicLEDGkkfK---SLKRHL~t~~gmT  100 (148)
T COG4957          77 IICLEDGKKFK---SLKRHLTTHYGLT  100 (148)
T ss_pred             EEEeccCcchH---HHHHHHhcccCCC
Confidence            45667777766   4567777766543


No 147
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=45.73  E-value=14  Score=20.59  Aligned_cols=8  Identities=50%  Similarity=1.335  Sum_probs=3.4

Q ss_pred             eeCCcccc
Q psy11591        142 YICEICGK  149 (220)
Q Consensus       142 ~~C~~C~~  149 (220)
                      ..|+.||.
T Consensus        23 V~Cp~CGa   30 (54)
T TIGR01206        23 VICDECGA   30 (54)
T ss_pred             EeCCCCCC
Confidence            34444443


No 148
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=45.34  E-value=14  Score=23.09  Aligned_cols=11  Identities=27%  Similarity=0.800  Sum_probs=5.5

Q ss_pred             ceeCCcccccc
Q psy11591        141 LYICEICGKDF  151 (220)
Q Consensus       141 ~~~C~~C~~~f  151 (220)
                      .+.|..|++.|
T Consensus        54 IW~C~~C~~~~   64 (90)
T PTZ00255         54 IWRCKGCKKTV   64 (90)
T ss_pred             EEEcCCCCCEE
Confidence            35555555544


No 149
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=44.93  E-value=10  Score=33.43  Aligned_cols=49  Identities=18%  Similarity=0.476  Sum_probs=27.9

Q ss_pred             eecCcCccccCChhhHHHHHhhhcCCCceeCCccccccCCHHHHHHHHHHcCCCCcccccccccc
Q psy11591        114 FKCNYCEKVYNNPSNLQRHIKTHTDNSLYICEICGKDFGTARYLKRHKDTHNSVNTFVCEVCNTG  178 (220)
Q Consensus       114 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~  178 (220)
                      ..|..||..+.=+.. ..-+..|...+...|.+||.               ....|..|+.||..
T Consensus       436 l~C~~Cg~v~~Cp~C-d~~lt~H~~~~~L~CH~Cg~---------------~~~~p~~Cp~Cgs~  484 (730)
T COG1198         436 LLCRDCGYIAECPNC-DSPLTLHKATGQLRCHYCGY---------------QEPIPQSCPECGSE  484 (730)
T ss_pred             eecccCCCcccCCCC-CcceEEecCCCeeEeCCCCC---------------CCCCCCCCCCCCCC
Confidence            456666665432211 11123455556677888873               34567889888854


No 150
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=44.51  E-value=9  Score=21.32  Aligned_cols=9  Identities=44%  Similarity=1.416  Sum_probs=4.0

Q ss_pred             CchhhhhcC
Q psy11591         89 CELCGAEFA   97 (220)
Q Consensus        89 C~~C~~~f~   97 (220)
                      |+.||+.|.
T Consensus         8 C~~Cg~~~~   16 (54)
T PF14446_consen    8 CPVCGKKFK   16 (54)
T ss_pred             ChhhCCccc
Confidence            444444443


No 151
>PF07800 DUF1644:  Protein of unknown function (DUF1644);  InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function. The region of interest contains nine highly conserved cysteine residues and is approximately 160 amino acids in length, which probably represent a zinc-binding domain. 
Probab=44.19  E-value=29  Score=24.17  Aligned_cols=11  Identities=36%  Similarity=0.453  Sum_probs=6.8

Q ss_pred             hhHHHHHHhhc
Q psy11591         71 KSNLTVHIRTH   81 (220)
Q Consensus        71 ~~~l~~h~~~~   81 (220)
                      ...|..|.+..
T Consensus       121 Y~eLrKHar~~  131 (162)
T PF07800_consen  121 YSELRKHARSE  131 (162)
T ss_pred             HHHHHHHHHhh
Confidence            45677776653


No 152
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=43.01  E-value=22  Score=19.19  Aligned_cols=11  Identities=36%  Similarity=0.779  Sum_probs=5.5

Q ss_pred             ccccccccccc
Q psy11591        169 TFVCEVCNTGF  179 (220)
Q Consensus       169 ~~~C~~C~~~f  179 (220)
                      .+.|+.||+.+
T Consensus        20 ~~vC~~Cg~~~   30 (52)
T smart00661       20 RFVCRKCGYEE   30 (52)
T ss_pred             EEECCcCCCeE
Confidence            45555555443


No 153
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=42.17  E-value=3.9  Score=27.96  Aligned_cols=13  Identities=23%  Similarity=0.552  Sum_probs=6.2

Q ss_pred             cccccccccCchh
Q psy11591        171 VCEVCNTGFKVKK  183 (220)
Q Consensus       171 ~C~~C~~~f~~~~  183 (220)
                      .|..|++.|+++.
T Consensus        30 eC~~C~~RFTTyE   42 (147)
T TIGR00244        30 ECLECHERFTTFE   42 (147)
T ss_pred             cCCccCCccceee
Confidence            4444555544443


No 154
>KOG2071|consensus
Probab=41.82  E-value=17  Score=30.90  Aligned_cols=30  Identities=17%  Similarity=0.375  Sum_probs=25.0

Q ss_pred             CCCcccccccccccCchhHHHHHhhhcccc
Q psy11591        166 SVNTFVCEVCNTGFKVKKHLTQHYKSHSMF  195 (220)
Q Consensus       166 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~  195 (220)
                      ...+-+|..||.+|.+......||..|...
T Consensus       415 ~~~pnqC~~CG~R~~~~ee~sk~md~H~dw  444 (579)
T KOG2071|consen  415 KDSPNQCKSCGLRFDDSEERSKHMDIHDDW  444 (579)
T ss_pred             cCCcchhcccccccccchhhhhHhhhhhhh
Confidence            356789999999999999999998877433


No 155
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=41.69  E-value=9.6  Score=20.96  Aligned_cols=27  Identities=19%  Similarity=0.431  Sum_probs=12.5

Q ss_pred             CCcccccccccccCchhHHHHHhhhcc
Q psy11591        167 VNTFVCEVCNTGFKVKKHLTQHYKSHS  193 (220)
Q Consensus       167 ~~~~~C~~C~~~f~~~~~l~~H~~~h~  193 (220)
                      ...|+|+.|+..|=-.-++-.|...|.
T Consensus        19 ~~~y~C~~C~~~FC~dCD~fiHE~LH~   45 (51)
T PF07975_consen   19 SSRYRCPKCKNHFCIDCDVFIHETLHN   45 (51)
T ss_dssp             -EEE--TTTT--B-HHHHHTTTTTS-S
T ss_pred             CCeEECCCCCCccccCcChhhhccccC
Confidence            345677777766666666666655553


No 156
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=41.48  E-value=28  Score=26.19  Aligned_cols=59  Identities=20%  Similarity=0.566  Sum_probs=31.1

Q ss_pred             CCcccccchhhcCChhHHHHHHhhhcCCCCcccccccccccCChhHHHHHHhhcCCCCcccCchhhhhcCCHH
Q psy11591         28 RPHVCHVCSKSFRNRGKLNVHYKRVHERIRTHQCNHCGRAFSDKSNLTVHIRTHTDEKKYMCELCGAEFAQWA  100 (220)
Q Consensus        28 ~~~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~  100 (220)
                      ..|.|..|+...     .    ++.-....--.|..|.+.+.=.-     -...+|...|.|+.|+..|....
T Consensus       111 rqFaC~~Cd~~W-----w----Rrvp~rKeVSRCr~C~~rYDPVP-----~dkmwG~aef~C~~C~h~F~G~~  169 (278)
T PF15135_consen  111 RQFACSSCDHMW-----W----RRVPQRKEVSRCRKCRKRYDPVP-----CDKMWGIAEFHCPKCRHNFRGFA  169 (278)
T ss_pred             eeeeccccchHH-----H----hccCcccccccccccccccCCCc-----cccccceeeeecccccccchhhh
Confidence            557777775431     1    11222222345777766543211     12235666688888888777553


No 157
>KOG1280|consensus
Probab=41.30  E-value=22  Score=28.09  Aligned_cols=25  Identities=24%  Similarity=0.582  Sum_probs=13.1

Q ss_pred             CCCccchhhhcCHHHHHHHHHHhhC
Q psy11591          2 FKCPQCGALLKNIWSLREHIMIHTG   26 (220)
Q Consensus         2 ~~C~~C~~~f~~~~~l~~H~~~~~~   26 (220)
                      |.|++|+..=.+...+..|....+.
T Consensus        80 ftCPyC~~~Gfte~~f~~Hv~s~Hp  104 (381)
T KOG1280|consen   80 FTCPYCGIMGFTERQFGTHVLSQHP  104 (381)
T ss_pred             ccCCcccccccchhHHHHHhhhcCc
Confidence            5555555544455555555554333


No 158
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=41.16  E-value=5.6  Score=27.31  Aligned_cols=12  Identities=25%  Similarity=0.542  Sum_probs=5.7

Q ss_pred             cccccccccCch
Q psy11591        171 VCEVCNTGFKVK  182 (220)
Q Consensus       171 ~C~~C~~~f~~~  182 (220)
                      .|..|+..|+++
T Consensus        30 eC~~C~~RFTTf   41 (156)
T COG1327          30 ECLECGERFTTF   41 (156)
T ss_pred             cccccccccchh
Confidence            444555444443


No 159
>KOG1842|consensus
Probab=40.30  E-value=20  Score=29.43  Aligned_cols=26  Identities=27%  Similarity=0.459  Sum_probs=14.6

Q ss_pred             cccccchhhcCChhHHHHHHhhhcCC
Q psy11591         30 HVCHVCSKSFRNRGKLNVHYKRVHER   55 (220)
Q Consensus        30 ~~C~~C~~~~~~~~~l~~H~~~~h~~   55 (220)
                      |.|++|.+.|.+...|..|+...|..
T Consensus        16 flCPiC~~dl~~~~~L~~H~d~eH~~   41 (505)
T KOG1842|consen   16 FLCPICLLDLPNLSALNDHLDVEHFE   41 (505)
T ss_pred             ccCchHhhhhhhHHHHHHHHhhhccc
Confidence            55555555555555555555555543


No 160
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=39.82  E-value=20  Score=29.81  Aligned_cols=27  Identities=26%  Similarity=0.457  Sum_probs=24.0

Q ss_pred             cccccchhhcCChhHHHHHHhhhcCCC
Q psy11591         30 HVCHVCSKSFRNRGKLNVHYKRVHERI   56 (220)
Q Consensus        30 ~~C~~C~~~~~~~~~l~~H~~~~h~~~   56 (220)
                      +.|+.|++.|.+...+..|+...|.+.
T Consensus        58 WiCp~CskkF~d~~~~~~H~~~eH~~~   84 (466)
T PF04780_consen   58 WICPRCSKKFSDAESCLSHMEQEHPAG   84 (466)
T ss_pred             eeCCcccceeCCHHHHHHHHHHhhhhh
Confidence            579999999999999999998888664


No 161
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=39.58  E-value=4.3  Score=20.98  Aligned_cols=8  Identities=38%  Similarity=1.240  Sum_probs=3.3

Q ss_pred             cccccccc
Q psy11591        170 FVCEVCNT  177 (220)
Q Consensus       170 ~~C~~C~~  177 (220)
                      |.|..|++
T Consensus        29 y~C~~C~~   36 (40)
T smart00440       29 YVCTKCGH   36 (40)
T ss_pred             EEeCCCCC
Confidence            44444443


No 162
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=39.37  E-value=9.4  Score=24.46  Aligned_cols=7  Identities=43%  Similarity=1.512  Sum_probs=4.2

Q ss_pred             ccccccc
Q psy11591        170 FVCEVCN  176 (220)
Q Consensus       170 ~~C~~C~  176 (220)
                      |.|+.|+
T Consensus        32 y~C~~C~   38 (102)
T PF11672_consen   32 YVCTPCD   38 (102)
T ss_pred             EECCCCC
Confidence            5666655


No 163
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=39.28  E-value=8.3  Score=26.13  Aligned_cols=11  Identities=36%  Similarity=1.114  Sum_probs=6.1

Q ss_pred             ccccccccccC
Q psy11591         59 HQCNHCGRAFS   69 (220)
Q Consensus        59 ~~C~~C~~~~~   69 (220)
                      +.|..||..|.
T Consensus        71 ~~C~~CG~~~~   81 (135)
T PRK03824         71 LKCRNCGNEWS   81 (135)
T ss_pred             EECCCCCCEEe
Confidence            55666665543


No 164
>KOG1280|consensus
Probab=39.01  E-value=30  Score=27.41  Aligned_cols=36  Identities=22%  Similarity=0.623  Sum_probs=19.2

Q ss_pred             ceecCcCccccCChhhHHHHHhhhcCCCc--eeCCccc
Q psy11591        113 KFKCNYCEKVYNNPSNLQRHIKTHTDNSL--YICEICG  148 (220)
Q Consensus       113 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~--~~C~~C~  148 (220)
                      .|.|++|+..-.+...|..|....+.+-+  ..|++|.
T Consensus        79 SftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   79 SFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             cccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            46666666665555666666555443332  2445543


No 165
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=38.46  E-value=9.9  Score=28.66  Aligned_cols=82  Identities=18%  Similarity=0.430  Sum_probs=42.6

Q ss_pred             cCCCCcccCchhhhhcCCHHHHHhHHHHh---CCcceecCcCccccCChhhH-------HHHHhh----hcCCCceeCCc
Q psy11591         81 HTDEKKYMCELCGAEFAQWATLYNHKFTH---NDIKFKCNYCEKVYNNPSNL-------QRHIKT----HTDNSLYICEI  146 (220)
Q Consensus        81 ~~~~~~~~C~~C~~~f~~~~~l~~h~~~~---~~~~~~C~~C~~~f~~~~~l-------~~H~~~----h~~~~~~~C~~  146 (220)
                      .+|.+.|+|..|....-....+ .|+..-   ....|.|..|++.-. .+.|       -.|.+.    ....+++.||.
T Consensus       137 ~hGGrif~CsfC~~flCEDDQF-EHQAsCQvLe~E~~KC~SCNrlGq-~sCLRCK~cfCddHvrrKg~ky~k~k~~PCPK  214 (314)
T PF06524_consen  137 DHGGRIFKCSFCDNFLCEDDQF-EHQASCQVLESETFKCQSCNRLGQ-YSCLRCKICFCDDHVRRKGFKYEKGKPIPCPK  214 (314)
T ss_pred             cCCCeEEEeecCCCeeeccchh-hhhhhhhhhhcccccccccccccc-hhhhheeeeehhhhhhhcccccccCCCCCCCC
Confidence            3567777777777544333332 233222   334466665554422 2222       234443    23457888999


Q ss_pred             cccccCCHHHHHHHHHHc
Q psy11591        147 CGKDFGTARYLKRHKDTH  164 (220)
Q Consensus       147 C~~~f~~~~~l~~H~~~h  164 (220)
                      ||........|..-.++|
T Consensus       215 Cg~et~eTkdLSmStR~h  232 (314)
T PF06524_consen  215 CGYETQETKDLSMSTRSH  232 (314)
T ss_pred             CCCcccccccceeeeecc
Confidence            987766655554433333


No 166
>PF14369 zf-RING_3:  zinc-finger
Probab=38.01  E-value=12  Score=18.62  Aligned_cols=9  Identities=33%  Similarity=1.021  Sum_probs=4.5

Q ss_pred             ccccccccc
Q psy11591         60 QCNHCGRAF   68 (220)
Q Consensus        60 ~C~~C~~~~   68 (220)
                      .|+.|+..|
T Consensus        23 ~CP~C~~gF   31 (35)
T PF14369_consen   23 ACPRCHGGF   31 (35)
T ss_pred             CCcCCCCcE
Confidence            355555444


No 167
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=37.88  E-value=7.2  Score=19.40  Aligned_cols=12  Identities=42%  Similarity=0.960  Sum_probs=4.4

Q ss_pred             eCCccccccCCH
Q psy11591        143 ICEICGKDFGTA  154 (220)
Q Consensus       143 ~C~~C~~~f~~~  154 (220)
                      .|..|++.|..+
T Consensus         5 ~C~eC~~~f~dS   16 (34)
T PF01286_consen    5 KCDECGKPFMDS   16 (34)
T ss_dssp             E-TTT--EES-S
T ss_pred             hHhHhCCHHHHH
Confidence            455566655544


No 168
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=37.82  E-value=17  Score=22.75  Aligned_cols=11  Identities=36%  Similarity=1.250  Sum_probs=5.5

Q ss_pred             ceeCCcccccc
Q psy11591        141 LYICEICGKDF  151 (220)
Q Consensus       141 ~~~C~~C~~~f  151 (220)
                      .+.|..|++.|
T Consensus        53 IW~C~~C~~~~   63 (91)
T TIGR00280        53 IWTCRKCGAKF   63 (91)
T ss_pred             EEEcCCCCCEE
Confidence            35555555544


No 169
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=37.78  E-value=16  Score=22.74  Aligned_cols=14  Identities=21%  Similarity=0.543  Sum_probs=12.3

Q ss_pred             CcccccccccccCc
Q psy11591        168 NTFVCEVCNTGFKV  181 (220)
Q Consensus       168 ~~~~C~~C~~~f~~  181 (220)
                      .|-+|..||+.|.+
T Consensus        57 ~Pa~CkkCGfef~~   70 (97)
T COG3357          57 RPARCKKCGFEFRD   70 (97)
T ss_pred             cChhhcccCccccc
Confidence            68899999999875


No 170
>COG1773 Rubredoxin [Energy production and conversion]
Probab=37.40  E-value=14  Score=20.68  Aligned_cols=15  Identities=20%  Similarity=0.645  Sum_probs=11.1

Q ss_pred             CcccccccccccCch
Q psy11591        168 NTFVCEVCNTGFKVK  182 (220)
Q Consensus       168 ~~~~C~~C~~~f~~~  182 (220)
                      +.|+|+.||+-|.-.
T Consensus         2 ~~~~C~~CG~vYd~e   16 (55)
T COG1773           2 KRWRCSVCGYVYDPE   16 (55)
T ss_pred             CceEecCCceEeccc
Confidence            358899999887643


No 171
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=36.83  E-value=21  Score=22.68  Aligned_cols=15  Identities=27%  Similarity=0.587  Sum_probs=9.5

Q ss_pred             ceeCCccccccCCHH
Q psy11591        141 LYICEICGKDFGTAR  155 (220)
Q Consensus       141 ~~~C~~C~~~f~~~~  155 (220)
                      |..|..||..|...+
T Consensus         2 pH~CtrCG~vf~~g~   16 (112)
T COG3364           2 PHQCTRCGEVFDDGS   16 (112)
T ss_pred             Cceeccccccccccc
Confidence            456777777776543


No 172
>KOG1842|consensus
Probab=36.23  E-value=18  Score=29.62  Aligned_cols=24  Identities=29%  Similarity=0.620  Sum_probs=11.5

Q ss_pred             eeCCccccccCCHHHHHHHHHHcC
Q psy11591        142 YICEICGKDFGTARYLKRHKDTHN  165 (220)
Q Consensus       142 ~~C~~C~~~f~~~~~l~~H~~~h~  165 (220)
                      |.||.|...|.+.+.|..|...-|
T Consensus        16 flCPiC~~dl~~~~~L~~H~d~eH   39 (505)
T KOG1842|consen   16 FLCPICLLDLPNLSALNDHLDVEH   39 (505)
T ss_pred             ccCchHhhhhhhHHHHHHHHhhhc
Confidence            445555555555555544444333


No 173
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=36.19  E-value=11  Score=19.02  Aligned_cols=9  Identities=33%  Similarity=1.135  Sum_probs=4.1

Q ss_pred             ecCcCcccc
Q psy11591        115 KCNYCEKVY  123 (220)
Q Consensus       115 ~C~~C~~~f  123 (220)
                      .|+.||..|
T Consensus         3 ~C~~Cg~~Y   11 (36)
T PF05191_consen    3 ICPKCGRIY   11 (36)
T ss_dssp             EETTTTEEE
T ss_pred             CcCCCCCcc
Confidence            344444444


No 174
>KOG2807|consensus
Probab=35.48  E-value=47  Score=26.18  Aligned_cols=24  Identities=21%  Similarity=0.621  Sum_probs=15.8

Q ss_pred             ceecCcCccccCChhhHHHHHhhh
Q psy11591        113 KFKCNYCEKVYNNPSNLQRHIKTH  136 (220)
Q Consensus       113 ~~~C~~C~~~f~~~~~l~~H~~~h  136 (220)
                      .|.|+.|...|-..-....|-..|
T Consensus       345 ~y~C~~Ck~~FCldCDv~iHesLh  368 (378)
T KOG2807|consen  345 RYRCESCKNVFCLDCDVFIHESLH  368 (378)
T ss_pred             cEEchhccceeeccchHHHHhhhh
Confidence            478888887777665555555443


No 175
>PF10537 WAC_Acf1_DNA_bd:  ATP-utilising chromatin assembly and remodelling N-terminal;  InterPro: IPR013136 ACF (for ATP-utilising chromatin assembly and remodeling factor) is a chromatin-remodeling complex that catalyzes the ATP-dependent assembly of periodic nucleosome arrays. This reaction utilises the energy of ATP hydrolysis by ISWI, the smaller of the two subunits of ACF. Acf1, the large subunit of ACF, is essential for the full activity of the complex. The WAC (WSTF/Acf1/cbp146) domain is an ~110-residue module present at the N-termini of Acf1-related proteins in a variety of organisms. It is found in association with other domains such as the bromodomain, the PHD-type zinc finger, DDT or WAKS. The DNA-binding region of Acf1 includes the WAC domain, which is necessary for the efficient binding of ACF complex to DNA. It seems probable that the WAC domain will be involved in DNA binding in other related factors [, ].   Some proteins known to contain a WAC domain are the Drosophila melanogaster (Fruit fly) ATP-dependent chromatin assembly factor large subunit Acf1, human WSTF (Williams syndrome transcription factor), mouse cbp146, yeast imitation switch two complex protein 1 (ITC1 or YGL133w), and yeast protein YPL216w. 
Probab=35.48  E-value=45  Score=21.39  Aligned_cols=36  Identities=14%  Similarity=0.320  Sum_probs=22.0

Q ss_pred             ccCchhhhhcCCHHHHHhHHHHhCCcceecCcCccc
Q psy11591         87 YMCELCGAEFAQWATLYNHKFTHNDIKFKCNYCEKV  122 (220)
Q Consensus        87 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~C~~C~~~  122 (220)
                      |.|+.=|..|.+-......+.....+.|.|...|+.
T Consensus         4 f~i~~T~EiF~dYe~Y~~R~~~y~~~vwtC~~TGk~   39 (102)
T PF10537_consen    4 FYIPFTGEIFRDYEEYLKRMILYNQRVWTCEITGKS   39 (102)
T ss_pred             EEeCCCCcccCCHHHHHHHHHHHhCCeeEEecCCCC
Confidence            455555666666666666555556666666666654


No 176
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=35.28  E-value=27  Score=20.21  Aligned_cols=9  Identities=33%  Similarity=1.084  Sum_probs=3.9

Q ss_pred             ceeCCcccc
Q psy11591        141 LYICEICGK  149 (220)
Q Consensus       141 ~~~C~~C~~  149 (220)
                      .|.|+.||.
T Consensus        46 ~~~C~~Cg~   54 (69)
T PF07282_consen   46 VFTCPNCGF   54 (69)
T ss_pred             eEEcCCCCC
Confidence            344444443


No 177
>PF03833 PolC_DP2:  DNA polymerase II large subunit DP2;  InterPro: IPR016033 DP2 is the large subunit of a two-subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus. The structure of DP2 appears to be organised as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit. This entry represents the N-terminal ~950 residue component of DP2.; GO: 0003887 DNA-directed DNA polymerase activity; PDB: 3O59_X.
Probab=35.17  E-value=13  Score=33.21  Aligned_cols=10  Identities=40%  Similarity=1.285  Sum_probs=0.0

Q ss_pred             ceeCCccccc
Q psy11591        141 LYICEICGKD  150 (220)
Q Consensus       141 ~~~C~~C~~~  150 (220)
                      .|.|+.|+..
T Consensus       680 ~~~Cp~C~~~  689 (900)
T PF03833_consen  680 VYVCPDCGIE  689 (900)
T ss_dssp             ----------
T ss_pred             ceeccccccc
Confidence            3566666544


No 178
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=34.94  E-value=14  Score=18.95  Aligned_cols=10  Identities=30%  Similarity=0.863  Sum_probs=4.9

Q ss_pred             cccccchhhc
Q psy11591         30 HVCHVCSKSF   39 (220)
Q Consensus        30 ~~C~~C~~~~   39 (220)
                      +.|..|++.|
T Consensus        13 f~C~~C~~~F   22 (39)
T smart00154       13 FKCRHCGNLF   22 (39)
T ss_pred             eECCccCCcc
Confidence            4455555544


No 179
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=34.59  E-value=11  Score=24.66  Aligned_cols=11  Identities=36%  Similarity=1.090  Sum_probs=6.1

Q ss_pred             ceeCCcccccc
Q psy11591        141 LYICEICGKDF  151 (220)
Q Consensus       141 ~~~C~~C~~~f  151 (220)
                      -|.|..||..+
T Consensus       100 Fy~C~~Cg~~w  110 (113)
T COG1594         100 FYKCTRCGYRW  110 (113)
T ss_pred             EEEecccCCEe
Confidence            35666666554


No 180
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=34.21  E-value=48  Score=25.90  Aligned_cols=80  Identities=23%  Similarity=0.480  Sum_probs=46.5

Q ss_pred             CCcccccchhhcCChhHHHHHHhhhc-----------CCCCcccccccccccCChhHHHHHHhhcCCCCcccCchhhhhc
Q psy11591         28 RPHVCHVCSKSFRNRGKLNVHYKRVH-----------ERIRTHQCNHCGRAFSDKSNLTVHIRTHTDEKKYMCELCGAEF   96 (220)
Q Consensus        28 ~~~~C~~C~~~~~~~~~l~~H~~~~h-----------~~~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f   96 (220)
                      -|..|+.|+-.+.....|..-..-..           ...+.-.|-.|...|.....-..-  ..+....|+|+.|...|
T Consensus       321 LPi~CP~Csl~LilsthLarSyhhL~PLk~f~E~p~~~~~ks~~Cf~CQ~~fp~~~~~~~~--~~~ss~rY~Ce~CK~~F  398 (421)
T COG5151         321 LPISCPICSLQLILSTHLARSYHHLYPLKPFVEKPEGTNPKSTHCFVCQGPFPKPPVSPFD--ESTSSGRYQCELCKSTF  398 (421)
T ss_pred             CCccCcchhHHHHHHHHHHHHHHhhccCcccccccCCCCCCCccceeccCCCCCCCCCccc--ccccccceechhhhhhh
Confidence            36788888876665555554321100           111223477777766654321111  11234568999999999


Q ss_pred             CCHHHHHhHHHHh
Q psy11591         97 AQWATLYNHKFTH  109 (220)
Q Consensus        97 ~~~~~l~~h~~~~  109 (220)
                      -..-+.-.|...|
T Consensus       399 C~dCdvfiHe~Lh  411 (421)
T COG5151         399 CSDCDVFIHETLH  411 (421)
T ss_pred             hhhhHHHHHHHHh
Confidence            8887777777766


No 181
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=33.88  E-value=11  Score=23.40  Aligned_cols=10  Identities=50%  Similarity=1.378  Sum_probs=5.8

Q ss_pred             eeCCcccccc
Q psy11591        142 YICEICGKDF  151 (220)
Q Consensus       142 ~~C~~C~~~f  151 (220)
                      +.|..|++.|
T Consensus        54 W~C~~C~~~~   63 (90)
T PF01780_consen   54 WKCKKCGKKF   63 (90)
T ss_dssp             EEETTTTEEE
T ss_pred             eecCCCCCEE
Confidence            5666665554


No 182
>KOG4167|consensus
Probab=33.84  E-value=8.5  Score=33.52  Aligned_cols=27  Identities=30%  Similarity=0.458  Sum_probs=23.5

Q ss_pred             cccccccccccCchhHHHHHhhhcccc
Q psy11591        169 TFVCEVCNTGFKVKKHLTQHYKSHSMF  195 (220)
Q Consensus       169 ~~~C~~C~~~f~~~~~l~~H~~~h~~~  195 (220)
                      -|-|.+|++.|.-...+..||++|...
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr~q  818 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHRQQ  818 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHHHH
Confidence            489999999999999999999988543


No 183
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=33.81  E-value=36  Score=17.32  Aligned_cols=11  Identities=18%  Similarity=0.827  Sum_probs=4.4

Q ss_pred             ccccccccccc
Q psy11591        169 TFVCEVCNTGF  179 (220)
Q Consensus       169 ~~~C~~C~~~f  179 (220)
                      .|.|..|+..+
T Consensus         3 ryyCdyC~~~~   13 (38)
T PF06220_consen    3 RYYCDYCKKYL   13 (38)
T ss_dssp             S-B-TTT--B-
T ss_pred             Ceeccccccee
Confidence            47777787777


No 184
>PRK04023 DNA polymerase II large subunit; Validated
Probab=32.95  E-value=54  Score=30.22  Aligned_cols=20  Identities=15%  Similarity=-0.072  Sum_probs=10.0

Q ss_pred             CCCCCCCCCccccccccccC
Q psy11591        198 PEQFPGLDPTSCNMSRTLPL  217 (220)
Q Consensus       198 ~~~~~~~~~~~~~~~~~~~~  217 (220)
                      ..|+.+-....+.....+++
T Consensus       664 y~CPKCG~El~~~s~~~i~l  683 (1121)
T PRK04023        664 DECEKCGREPTPYSKRKIDL  683 (1121)
T ss_pred             CcCCCCCCCCCccceEEecH
Confidence            33555555555555444443


No 185
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=32.76  E-value=20  Score=20.79  Aligned_cols=9  Identities=33%  Similarity=0.988  Sum_probs=2.4

Q ss_pred             ecCcCcccc
Q psy11591        115 KCNYCEKVY  123 (220)
Q Consensus       115 ~C~~C~~~f  123 (220)
                      .|..|++.|
T Consensus        11 ~C~~C~~~F   19 (69)
T PF01363_consen   11 NCMICGKKF   19 (69)
T ss_dssp             B-TTT--B-
T ss_pred             cCcCcCCcC
Confidence            344455554


No 186
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=32.65  E-value=22  Score=22.21  Aligned_cols=10  Identities=40%  Similarity=1.212  Sum_probs=5.2

Q ss_pred             eeCCcccccc
Q psy11591        142 YICEICGKDF  151 (220)
Q Consensus       142 ~~C~~C~~~f  151 (220)
                      +.|..|++.|
T Consensus        55 W~C~~C~~~~   64 (90)
T PRK03976         55 WECRKCGAKF   64 (90)
T ss_pred             EEcCCCCCEE
Confidence            5555555544


No 187
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=32.33  E-value=12  Score=29.30  Aligned_cols=13  Identities=23%  Similarity=0.636  Sum_probs=6.7

Q ss_pred             CCCCcccCchhhh
Q psy11591         82 TDEKKYMCELCGA   94 (220)
Q Consensus        82 ~~~~~~~C~~C~~   94 (220)
                      .|.+-..|..|+.
T Consensus       208 ~G~RyL~CslC~t  220 (309)
T PRK03564        208 QGLRYLHCNLCES  220 (309)
T ss_pred             CCceEEEcCCCCC
Confidence            3444455666553


No 188
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=32.06  E-value=30  Score=28.38  Aligned_cols=30  Identities=27%  Similarity=0.635  Sum_probs=20.4

Q ss_pred             eCCccccccCCHHHHHHHHHHcCCCCcccccccccccCchh
Q psy11591        143 ICEICGKDFGTARYLKRHKDTHNSVNTFVCEVCNTGFKVKK  183 (220)
Q Consensus       143 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~  183 (220)
                      .|+.||..-.+           .|.+-|+|+.|++.+....
T Consensus       352 ~Cp~Cg~~m~S-----------~G~~g~rC~kCg~~~~~~~  381 (421)
T COG1571         352 VCPRCGGRMKS-----------AGRNGFRCKKCGTRARETL  381 (421)
T ss_pred             CCCccCCchhh-----------cCCCCcccccccccCCccc
Confidence            68888866432           2333789999998876543


No 189
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=32.05  E-value=8.5  Score=28.47  Aligned_cols=15  Identities=20%  Similarity=0.623  Sum_probs=7.9

Q ss_pred             CceeCCccccccCCH
Q psy11591        140 SLYICEICGKDFGTA  154 (220)
Q Consensus       140 ~~~~C~~C~~~f~~~  154 (220)
                      +.+.||+|+..|...
T Consensus        18 k~ieCPvC~tkFkke   32 (267)
T COG1655          18 KTIECPVCNTKFKKE   32 (267)
T ss_pred             ceeccCcccchhhhh
Confidence            345555555555444


No 190
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=31.34  E-value=33  Score=30.00  Aligned_cols=12  Identities=17%  Similarity=0.365  Sum_probs=7.2

Q ss_pred             cccccccccCch
Q psy11591        171 VCEVCNTGFKVK  182 (220)
Q Consensus       171 ~C~~C~~~f~~~  182 (220)
                      .|+.||......
T Consensus        43 fC~~CG~~~~~~   54 (645)
T PRK14559         43 HCPNCGAETGTI   54 (645)
T ss_pred             cccccCCcccch
Confidence            577777655443


No 191
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=31.24  E-value=24  Score=23.15  Aligned_cols=11  Identities=18%  Similarity=0.631  Sum_probs=5.7

Q ss_pred             eecCcCccccC
Q psy11591        114 FKCNYCEKVYN  124 (220)
Q Consensus       114 ~~C~~C~~~f~  124 (220)
                      ..|..|+..|.
T Consensus        71 ~~C~~Cg~~~~   81 (115)
T TIGR00100        71 CECEDCSEEVS   81 (115)
T ss_pred             EEcccCCCEEe
Confidence            45555554443


No 192
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=31.07  E-value=23  Score=18.31  Aligned_cols=12  Identities=25%  Similarity=0.927  Sum_probs=7.6

Q ss_pred             CceeCCcccccc
Q psy11591        140 SLYICEICGKDF  151 (220)
Q Consensus       140 ~~~~C~~C~~~f  151 (220)
                      ++-.|++|+..|
T Consensus        28 ~~~~CpYCg~~y   39 (40)
T PF10276_consen   28 GPVVCPYCGTRY   39 (40)
T ss_dssp             CEEEETTTTEEE
T ss_pred             CeEECCCCCCEE
Confidence            356777777655


No 193
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=30.93  E-value=17  Score=23.48  Aligned_cols=12  Identities=17%  Similarity=0.703  Sum_probs=6.3

Q ss_pred             cccccccccccC
Q psy11591        169 TFVCEVCNTGFK  180 (220)
Q Consensus       169 ~~~C~~C~~~f~  180 (220)
                      .|.|+.|+....
T Consensus        19 ~~iCpeC~~EW~   30 (109)
T TIGR00686        19 QLICPSCLYEWN   30 (109)
T ss_pred             eeECcccccccc
Confidence            355555555443


No 194
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=30.88  E-value=22  Score=18.55  Aligned_cols=13  Identities=38%  Similarity=0.920  Sum_probs=7.4

Q ss_pred             CceeCCccccccC
Q psy11591        140 SLYICEICGKDFG  152 (220)
Q Consensus       140 ~~~~C~~C~~~f~  152 (220)
                      -|+.|+.|+..|=
T Consensus        12 ~~~~C~~C~~~FC   24 (43)
T PF01428_consen   12 LPFKCKHCGKSFC   24 (43)
T ss_dssp             SHEE-TTTS-EE-
T ss_pred             CCeECCCCCcccC
Confidence            4678888887764


No 195
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=30.56  E-value=17  Score=19.60  Aligned_cols=14  Identities=21%  Similarity=0.710  Sum_probs=10.5

Q ss_pred             cccccccccccCch
Q psy11591        169 TFVCEVCNTGFKVK  182 (220)
Q Consensus       169 ~~~C~~C~~~f~~~  182 (220)
                      .|+|..|++.+...
T Consensus         1 ky~C~~CgyvYd~~   14 (47)
T PF00301_consen    1 KYQCPVCGYVYDPE   14 (47)
T ss_dssp             EEEETTTSBEEETT
T ss_pred             CcCCCCCCEEEcCC
Confidence            37899999877544


No 196
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=30.18  E-value=25  Score=22.98  Aligned_cols=10  Identities=30%  Similarity=0.494  Sum_probs=4.7

Q ss_pred             eecCcCcccc
Q psy11591        114 FKCNYCEKVY  123 (220)
Q Consensus       114 ~~C~~C~~~f  123 (220)
                      +.|..|+..|
T Consensus        71 ~~C~~Cg~~~   80 (113)
T PRK12380         71 AWCWDCSQVV   80 (113)
T ss_pred             EEcccCCCEE
Confidence            4455555443


No 197
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=29.50  E-value=24  Score=19.28  Aligned_cols=13  Identities=15%  Similarity=0.708  Sum_probs=10.5

Q ss_pred             cccccccccccCc
Q psy11591        169 TFVCEVCNTGFKV  181 (220)
Q Consensus       169 ~~~C~~C~~~f~~  181 (220)
                      .|+|..||+.+..
T Consensus         1 ~y~C~~CgyiYd~   13 (50)
T cd00730           1 KYECRICGYIYDP   13 (50)
T ss_pred             CcCCCCCCeEECC
Confidence            3789999988774


No 198
>KOG3002|consensus
Probab=29.48  E-value=57  Score=25.56  Aligned_cols=76  Identities=21%  Similarity=0.373  Sum_probs=45.0

Q ss_pred             cceecCcCccccCChhhHHHHHhhhcCCCceeCCc----cccccCCHHHHHHHHHHcCCCCcccccc----cccccCchh
Q psy11591        112 IKFKCNYCEKVYNNPSNLQRHIKTHTDNSLYICEI----CGKDFGTARYLKRHKDTHNSVNTFVCEV----CNTGFKVKK  183 (220)
Q Consensus       112 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~----C~~~f~~~~~l~~H~~~h~~~~~~~C~~----C~~~f~~~~  183 (220)
                      ..-.|+.|...+.+...+.  +..-.....+.|+.    |.+.|.+... ..|.+.... .||.|+.    |.+. +...
T Consensus        79 ~~~~CP~Cr~~~g~~R~~a--mEkV~e~~~vpC~~~~~GC~~~~~Y~~~-~~HE~~C~f-~~~~CP~p~~~C~~~-G~~~  153 (299)
T KOG3002|consen   79 VSNKCPTCRLPIGNIRCRA--MEKVAEAVLVPCKNAKLGCTKSFPYGEK-SKHEKVCEF-RPCSCPVPGAECKYT-GSYK  153 (299)
T ss_pred             hcccCCccccccccHHHHH--HHHHHHhceecccccccCCceeeccccc-ccccccccc-CCcCCCCCcccCCcc-CcHH
Confidence            3456777777777554332  22223334455653    7777777766 466665555 6777754    5554 5677


Q ss_pred             HHHHHhhhc
Q psy11591        184 HLTQHYKSH  192 (220)
Q Consensus       184 ~l~~H~~~h  192 (220)
                      .|..|...-
T Consensus       154 ~l~~H~~~~  162 (299)
T KOG3002|consen  154 DLYAHLNDT  162 (299)
T ss_pred             HHHHHHHhh
Confidence            788886543


No 199
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=29.38  E-value=45  Score=27.83  Aligned_cols=24  Identities=17%  Similarity=0.551  Sum_probs=20.3

Q ss_pred             eecCcCccccCChhhHHHHHhhhc
Q psy11591        114 FKCNYCEKVYNNPSNLQRHIKTHT  137 (220)
Q Consensus       114 ~~C~~C~~~f~~~~~l~~H~~~h~  137 (220)
                      |.|+.|.+.|.+...+..|+...|
T Consensus        58 WiCp~CskkF~d~~~~~~H~~~eH   81 (466)
T PF04780_consen   58 WICPRCSKKFSDAESCLSHMEQEH   81 (466)
T ss_pred             eeCCcccceeCCHHHHHHHHHHhh
Confidence            788999999999999999987544


No 200
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=29.11  E-value=26  Score=23.56  Aligned_cols=35  Identities=17%  Similarity=0.438  Sum_probs=19.8

Q ss_pred             eeCCccccccCCHHHHHHHHHHcCCCCcccccccccccCc
Q psy11591        142 YICEICGKDFGTARYLKRHKDTHNSVNTFVCEVCNTGFKV  181 (220)
Q Consensus       142 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~  181 (220)
                      ..||.|+.....     ++-..-.+...|.|..|++.|..
T Consensus        31 ~~cP~C~s~~~~-----k~g~~~~~~qRyrC~~C~~tf~~   65 (129)
T COG3677          31 VNCPRCKSSNVV-----KIGGIRRGHQRYKCKSCGSTFTV   65 (129)
T ss_pred             CcCCCCCcccee-----eECCccccccccccCCcCcceee
Confidence            467777654311     11112233567888888888764


No 201
>PRK10220 hypothetical protein; Provisional
Probab=29.06  E-value=24  Score=22.77  Aligned_cols=12  Identities=17%  Similarity=0.866  Sum_probs=6.4

Q ss_pred             cccccccccccC
Q psy11591        169 TFVCEVCNTGFK  180 (220)
Q Consensus       169 ~~~C~~C~~~f~  180 (220)
                      .|.|+.|+..+.
T Consensus        20 ~~vCpeC~hEW~   31 (111)
T PRK10220         20 MYICPECAHEWN   31 (111)
T ss_pred             eEECCcccCcCC
Confidence            355555555543


No 202
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=28.87  E-value=40  Score=18.89  Aligned_cols=12  Identities=25%  Similarity=0.692  Sum_probs=6.6

Q ss_pred             CCcccccccccc
Q psy11591         56 IRTHQCNHCGRA   67 (220)
Q Consensus        56 ~~~~~C~~C~~~   67 (220)
                      ...|.|+.||..
T Consensus        12 ~v~~~Cp~cGip   23 (55)
T PF13824_consen   12 HVNFECPDCGIP   23 (55)
T ss_pred             ccCCcCCCCCCc
Confidence            344666666554


No 203
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=28.50  E-value=13  Score=17.57  Aligned_cols=18  Identities=28%  Similarity=0.632  Sum_probs=10.1

Q ss_pred             ccccccccccCchhHHHHH
Q psy11591        170 FVCEVCNTGFKVKKHLTQH  188 (220)
Q Consensus       170 ~~C~~C~~~f~~~~~l~~H  188 (220)
                      |.|-.|++.| +......|
T Consensus         1 ~sCiDC~~~F-~~~~y~~H   18 (28)
T PF08790_consen    1 FSCIDCSKDF-DGDSYKSH   18 (28)
T ss_dssp             EEETTTTEEE-EGGGTTT-
T ss_pred             CeeecCCCCc-CcCCcCCC
Confidence            4577777777 44444444


No 204
>KOG0717|consensus
Probab=28.49  E-value=39  Score=28.02  Aligned_cols=22  Identities=32%  Similarity=0.824  Sum_probs=19.7

Q ss_pred             eeCCccccccCCHHHHHHHHHH
Q psy11591        142 YICEICGKDFGTARYLKRHKDT  163 (220)
Q Consensus       142 ~~C~~C~~~f~~~~~l~~H~~~  163 (220)
                      +.|.+|++.|.+...|.+|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            8899999999999999999653


No 205
>KOG4377|consensus
Probab=28.16  E-value=17  Score=29.46  Aligned_cols=26  Identities=19%  Similarity=0.494  Sum_probs=18.7

Q ss_pred             cccc--ccccccCchhHHHHHhhhcccc
Q psy11591        170 FVCE--VCNTGFKVKKHLTQHYKSHSMF  195 (220)
Q Consensus       170 ~~C~--~C~~~f~~~~~l~~H~~~h~~~  195 (220)
                      +.|.  -|+.++.+-+++..|.+.|-..
T Consensus       402 fhc~r~Gc~~tl~s~sqm~shkrkheRq  429 (480)
T KOG4377|consen  402 FHCDRLGCEATLYSVSQMASHKRKHERQ  429 (480)
T ss_pred             eeecccCCceEEEehhhhhhhhhhhhhh
Confidence            4453  3888888888888888777544


No 206
>PRK14873 primosome assembly protein PriA; Provisional
Probab=28.13  E-value=47  Score=29.29  Aligned_cols=27  Identities=19%  Similarity=0.593  Sum_probs=17.1

Q ss_pred             hcCCCceeCCccccccCCHHHHHHHHHHcCCCCcccccccccc
Q psy11591        136 HTDNSLYICEICGKDFGTARYLKRHKDTHNSVNTFVCEVCNTG  178 (220)
Q Consensus       136 h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~  178 (220)
                      |...+...|.+||..                ..+..|+.|+..
T Consensus       405 h~~~~~l~Ch~CG~~----------------~~p~~Cp~Cgs~  431 (665)
T PRK14873        405 PSAGGTPRCRWCGRA----------------APDWRCPRCGSD  431 (665)
T ss_pred             ecCCCeeECCCCcCC----------------CcCccCCCCcCC
Confidence            444556778888742                135688888754


No 207
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=27.22  E-value=48  Score=18.15  Aligned_cols=9  Identities=56%  Similarity=1.165  Sum_probs=3.6

Q ss_pred             CCccccccC
Q psy11591        144 CEICGKDFG  152 (220)
Q Consensus       144 C~~C~~~f~  152 (220)
                      |..|++.|.
T Consensus         5 C~~C~~~F~   13 (57)
T cd00065           5 CMGCGKPFT   13 (57)
T ss_pred             CcccCcccc
Confidence            334444433


No 208
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=27.04  E-value=25  Score=19.34  Aligned_cols=12  Identities=25%  Similarity=0.966  Sum_probs=6.1

Q ss_pred             eCCccccccCCH
Q psy11591        143 ICEICGKDFGTA  154 (220)
Q Consensus       143 ~C~~C~~~f~~~  154 (220)
                      .||+|++.|...
T Consensus        22 ~CPlC~r~l~~e   33 (54)
T PF04423_consen   22 CCPLCGRPLDEE   33 (54)
T ss_dssp             E-TTT--EE-HH
T ss_pred             cCCCCCCCCCHH
Confidence            899998888644


No 209
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=25.92  E-value=27  Score=22.34  Aligned_cols=23  Identities=30%  Similarity=0.491  Sum_probs=18.9

Q ss_pred             CcccccccccccCchhHHHHHhh
Q psy11591        168 NTFVCEVCNTGFKVKKHLTQHYK  190 (220)
Q Consensus       168 ~~~~C~~C~~~f~~~~~l~~H~~  190 (220)
                      ..+.|..|.+-|.+...|..|++
T Consensus        54 GqhYCieCaryf~t~~aL~~Hkk   76 (126)
T COG5112          54 GQHYCIECARYFITEKALMEHKK   76 (126)
T ss_pred             ceeeeehhHHHHHHHHHHHHHhc
Confidence            44788889988988888988874


No 210
>KOG0717|consensus
Probab=25.88  E-value=36  Score=28.19  Aligned_cols=22  Identities=45%  Similarity=0.842  Sum_probs=19.9

Q ss_pred             ccccccccccCchhHHHHHhhh
Q psy11591        170 FVCEVCNTGFKVKKHLTQHYKS  191 (220)
Q Consensus       170 ~~C~~C~~~f~~~~~l~~H~~~  191 (220)
                      +.|.+|+++|.+..+|..|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            8899999999999999999643


No 211
>KOG3507|consensus
Probab=25.60  E-value=45  Score=18.85  Aligned_cols=10  Identities=30%  Similarity=0.786  Sum_probs=4.6

Q ss_pred             ceeCCccccc
Q psy11591        141 LYICEICGKD  150 (220)
Q Consensus       141 ~~~C~~C~~~  150 (220)
                      .+.|..||..
T Consensus        37 ~irCReCG~R   46 (62)
T KOG3507|consen   37 VIRCRECGYR   46 (62)
T ss_pred             cEehhhcchH
Confidence            3444444443


No 212
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=25.13  E-value=57  Score=27.69  Aligned_cols=47  Identities=19%  Similarity=0.464  Sum_probs=24.5

Q ss_pred             ecCcCccccCChhhHHHHHhhhcCCCceeCCccccccCCHHHHHHHHHHcCCCCccccccccc
Q psy11591        115 KCNYCEKVYNNPSNLQRHIKTHTDNSLYICEICGKDFGTARYLKRHKDTHNSVNTFVCEVCNT  177 (220)
Q Consensus       115 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~  177 (220)
                      .|..||....=.. ....+..|..++...|.+||...               ..|..|+.|+.
T Consensus       215 ~C~~Cg~~~~C~~-C~~~l~~h~~~~~l~Ch~Cg~~~---------------~~~~~Cp~C~s  261 (505)
T TIGR00595       215 LCRSCGYILCCPN-CDVSLTYHKKEGKLRCHYCGYQE---------------PIPKTCPQCGS  261 (505)
T ss_pred             EhhhCcCccCCCC-CCCceEEecCCCeEEcCCCcCcC---------------CCCCCCCCCCC
Confidence            5666665533221 11123344555667777777442               24567777765


No 213
>TIGR03826 YvyF flagellar operon protein TIGR03826. This gene is found in flagellar operons of Bacillus-related organisms. Its function has not been determined and an official gene symbol has not been assigned, although the gene is designated yvyF in B. subtilus. A tentative assignment as a regulator is suggested in the NCBI record GI:16080597.
Probab=25.01  E-value=53  Score=22.36  Aligned_cols=40  Identities=28%  Similarity=0.584  Sum_probs=21.8

Q ss_pred             CCccchhhhcCHHHHHHHHHHhhCCCCcccccchhhcCChhHHHHHHhhhcCC
Q psy11591          3 KCPQCGALLKNIWSLREHIMIHTGERPHVCHVCSKSFRNRGKLNVHYKRVHER   55 (220)
Q Consensus         3 ~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~~h~~   55 (220)
                      .|+.||+.|...             ....|+.|.+.-.........+.+.|++
T Consensus         5 nC~~CgklF~~~-------------~~~iCp~C~~~~e~~f~kV~~yLr~~p~   44 (137)
T TIGR03826         5 NCPKCGRLFVKT-------------GRDVCPSCYEEEEREFEKVYKFLRKHEN   44 (137)
T ss_pred             cccccchhhhhc-------------CCccCHHHhHHHHHHHHHHHHHHHHCCC
Confidence            477888777541             1235888876544444444443344444


No 214
>PTZ00448 hypothetical protein; Provisional
Probab=24.50  E-value=52  Score=26.46  Aligned_cols=24  Identities=29%  Similarity=0.685  Sum_probs=21.3

Q ss_pred             cccccccccccCchhHHHHHhhhc
Q psy11591        169 TFVCEVCNTGFKVKKHLTQHYKSH  192 (220)
Q Consensus       169 ~~~C~~C~~~f~~~~~l~~H~~~h  192 (220)
                      .|.|..|+..|.+....+.|+++.
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KSD  337 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRSE  337 (373)
T ss_pred             CccccccccccCCHHHHHHHhhhh
Confidence            588999999999999999998763


No 215
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=24.24  E-value=49  Score=23.92  Aligned_cols=12  Identities=33%  Similarity=0.678  Sum_probs=6.0

Q ss_pred             cccCchhhhhcC
Q psy11591         86 KYMCELCGAEFA   97 (220)
Q Consensus        86 ~~~C~~C~~~f~   97 (220)
                      .+.|..||..++
T Consensus        30 lvrC~eCG~V~~   41 (201)
T COG1326          30 LVRCEECGTVHP   41 (201)
T ss_pred             EEEccCCCcEee
Confidence            345555555443


No 216
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=24.22  E-value=34  Score=22.51  Aligned_cols=10  Identities=30%  Similarity=1.115  Sum_probs=4.9

Q ss_pred             eecCcCcccc
Q psy11591        114 FKCNYCEKVY  123 (220)
Q Consensus       114 ~~C~~C~~~f  123 (220)
                      +.|..|+..|
T Consensus        72 ~~C~~Cg~~~   81 (117)
T PRK00564         72 LECKDCSHVF   81 (117)
T ss_pred             EEhhhCCCcc
Confidence            4555555443


No 217
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=24.19  E-value=38  Score=15.91  Aligned_cols=10  Identities=20%  Similarity=0.740  Sum_probs=3.2

Q ss_pred             ceecCcCccc
Q psy11591        113 KFKCNYCEKV  122 (220)
Q Consensus       113 ~~~C~~C~~~  122 (220)
                      .|.|..|+..
T Consensus        15 ~Y~C~~Cdf~   24 (30)
T PF07649_consen   15 FYRCSECDFD   24 (30)
T ss_dssp             EEE-TTT---
T ss_pred             eEECccCCCc
Confidence            4555555443


No 218
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=23.99  E-value=65  Score=15.87  Aligned_cols=22  Identities=18%  Similarity=0.452  Sum_probs=10.8

Q ss_pred             eeCCccccccCCHHHHHHHHHHc
Q psy11591        142 YICEICGKDFGTARYLKRHKDTH  164 (220)
Q Consensus       142 ~~C~~C~~~f~~~~~l~~H~~~h  164 (220)
                      +.|+.|++.+.. +.+..|+...
T Consensus         5 ~~C~nC~R~v~a-~RfA~HLekC   26 (33)
T PF08209_consen    5 VECPNCGRPVAA-SRFAPHLEKC   26 (33)
T ss_dssp             EE-TTTSSEEEG-GGHHHHHHHH
T ss_pred             EECCCCcCCcch-hhhHHHHHHH
Confidence            566666655432 3445555543


No 219
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=23.54  E-value=22  Score=24.33  Aligned_cols=32  Identities=25%  Similarity=0.653  Sum_probs=18.0

Q ss_pred             ceeCCccccccCCHHHHHHHHHHcCCCCccccccccccc
Q psy11591        141 LYICEICGKDFGTARYLKRHKDTHNSVNTFVCEVCNTGF  179 (220)
Q Consensus       141 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f  179 (220)
                      .|.|..|+..+..      +. .+.....|.|..|+-.+
T Consensus       112 ~y~C~~C~~~~~~------~r-r~~~~~~y~C~~C~g~l  143 (146)
T smart00731      112 PYRCTGCGQRYLR------VR-RSNNVSRYRCGKCGGKL  143 (146)
T ss_pred             EEECCCCCCCCce------Ec-cccCcceEEcCCCCCEE
Confidence            5778777766531      11 12222567888887654


No 220
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=23.54  E-value=33  Score=22.39  Aligned_cols=11  Identities=18%  Similarity=0.751  Sum_probs=5.1

Q ss_pred             eecCcCccccC
Q psy11591        114 FKCNYCEKVYN  124 (220)
Q Consensus       114 ~~C~~C~~~f~  124 (220)
                      +.|..|+..|.
T Consensus        71 ~~C~~Cg~~~~   81 (113)
T PF01155_consen   71 ARCRDCGHEFE   81 (113)
T ss_dssp             EEETTTS-EEE
T ss_pred             EECCCCCCEEe
Confidence            45555555543


No 221
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=23.38  E-value=24  Score=24.31  Aligned_cols=11  Identities=36%  Similarity=1.361  Sum_probs=6.5

Q ss_pred             ceeCCcccccc
Q psy11591        141 LYICEICGKDF  151 (220)
Q Consensus       141 ~~~C~~C~~~f  151 (220)
                      .|.|+.|+..+
T Consensus       123 ~~~C~~C~~~~  133 (157)
T PF10263_consen  123 VYRCPSCGREY  133 (157)
T ss_pred             EEEcCCCCCEe
Confidence            45666666554


No 222
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=22.46  E-value=47  Score=19.00  Aligned_cols=15  Identities=20%  Similarity=0.696  Sum_probs=10.0

Q ss_pred             CCCceeCCccccccC
Q psy11591        138 DNSLYICEICGKDFG  152 (220)
Q Consensus       138 ~~~~~~C~~C~~~f~  152 (220)
                      .+....|++|+..|.
T Consensus        45 ~~gev~CPYC~t~y~   59 (62)
T COG4391          45 DEGEVVCPYCSTRYR   59 (62)
T ss_pred             CCCcEecCccccEEE
Confidence            344467888887765


No 223
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=22.39  E-value=30  Score=19.45  Aligned_cols=10  Identities=40%  Similarity=1.062  Sum_probs=4.2

Q ss_pred             CCcccCchhh
Q psy11591         84 EKKYMCELCG   93 (220)
Q Consensus        84 ~~~~~C~~C~   93 (220)
                      ...|.|..|.
T Consensus        29 i~tYmC~eC~   38 (56)
T PF09963_consen   29 IHTYMCDECK   38 (56)
T ss_pred             CcceeChhHH
Confidence            3334444443


No 224
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=22.33  E-value=1.2e+02  Score=21.67  Aligned_cols=16  Identities=31%  Similarity=0.904  Sum_probs=7.1

Q ss_pred             cCCCceeCCccccccC
Q psy11591        137 TDNSLYICEICGKDFG  152 (220)
Q Consensus       137 ~~~~~~~C~~C~~~f~  152 (220)
                      ....-|.|+.|...|+
T Consensus       109 ~~~~~y~C~~~~~r~s  124 (176)
T COG1675         109 TENNYYVCPNCHVKYS  124 (176)
T ss_pred             ccCCceeCCCCCCccc
Confidence            3344455544444433


No 225
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=22.02  E-value=83  Score=24.44  Aligned_cols=24  Identities=29%  Similarity=0.625  Sum_probs=13.1

Q ss_pred             CcccccccccccCchhHHHHHhhh
Q psy11591        168 NTFVCEVCNTGFKVKKHLTQHYKS  191 (220)
Q Consensus       168 ~~~~C~~C~~~f~~~~~l~~H~~~  191 (220)
                      ..|.|..|-+-|.+...|.+|+..
T Consensus        47 ~lyiCe~Clky~~~~~~l~~H~~~   70 (290)
T PLN03238         47 KLYICEYCLKYMRKKKSLLRHLAK   70 (290)
T ss_pred             eEEEcCCCcchhCCHHHHHHHHHh
Confidence            345555555555555555555543


No 227
>PLN02294 cytochrome c oxidase subunit Vb
Probab=21.83  E-value=43  Score=23.64  Aligned_cols=16  Identities=19%  Similarity=0.613  Sum_probs=12.4

Q ss_pred             CCCceeCCccccccCC
Q psy11591        138 DNSLYICEICGKDFGT  153 (220)
Q Consensus       138 ~~~~~~C~~C~~~f~~  153 (220)
                      .++|..|++||..|.-
T Consensus       138 kGkp~RCpeCG~~fkL  153 (174)
T PLN02294        138 KGKSFECPVCTQYFEL  153 (174)
T ss_pred             CCCceeCCCCCCEEEE
Confidence            3478899999988763


No 228
>COG4640 Predicted membrane protein [Function unknown]
Probab=21.73  E-value=69  Score=26.04  Aligned_cols=17  Identities=18%  Similarity=0.563  Sum_probs=9.3

Q ss_pred             cccccccccCchhHHHH
Q psy11591        171 VCEVCNTGFKVKKHLTQ  187 (220)
Q Consensus       171 ~C~~C~~~f~~~~~l~~  187 (220)
                      +|+.||..|.....+..
T Consensus        17 qC~qCG~~~t~~~sqan   33 (465)
T COG4640          17 QCTQCGHKFTSRQSQAN   33 (465)
T ss_pred             cccccCCcCCchhhhhh
Confidence            46666666555554443


No 229
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=21.16  E-value=41  Score=22.03  Aligned_cols=10  Identities=20%  Similarity=0.624  Sum_probs=5.0

Q ss_pred             eecCcCcccc
Q psy11591        114 FKCNYCEKVY  123 (220)
Q Consensus       114 ~~C~~C~~~f  123 (220)
                      +.|..|+..|
T Consensus        71 ~~C~~Cg~~~   80 (114)
T PRK03681         71 CWCETCQQYV   80 (114)
T ss_pred             EEcccCCCee
Confidence            4555555443


No 230
>PHA02998 RNA polymerase subunit; Provisional
Probab=21.03  E-value=22  Score=25.19  Aligned_cols=9  Identities=22%  Similarity=0.741  Sum_probs=4.2

Q ss_pred             ccccccccc
Q psy11591        170 FVCEVCNTG  178 (220)
Q Consensus       170 ~~C~~C~~~  178 (220)
                      |.|..|++.
T Consensus       172 YkC~~CG~~  180 (195)
T PHA02998        172 HACRDCKKH  180 (195)
T ss_pred             EEcCCCCCc
Confidence            444444444


No 231
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=20.98  E-value=65  Score=16.87  Aligned_cols=15  Identities=33%  Similarity=0.842  Sum_probs=8.6

Q ss_pred             cccccccccCchhHH
Q psy11591        171 VCEVCNTGFKVKKHL  185 (220)
Q Consensus       171 ~C~~C~~~f~~~~~l  185 (220)
                      .|..|+..|+.....
T Consensus        10 ~C~~C~rpf~WRKKW   24 (42)
T PF10013_consen   10 ICPVCGRPFTWRKKW   24 (42)
T ss_pred             cCcccCCcchHHHHH
Confidence            566666666654433


No 232
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=20.90  E-value=28  Score=23.97  Aligned_cols=28  Identities=25%  Similarity=0.617  Sum_probs=15.3

Q ss_pred             ceeCCccccccCCHHHHHHHHHHcCCCCcccccccccc
Q psy11591        141 LYICEICGKDFGTARYLKRHKDTHNSVNTFVCEVCNTG  178 (220)
Q Consensus       141 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~  178 (220)
                      .|.|..||......         + ....-.|+.|+..
T Consensus       112 ~l~C~~Cg~~~~~~---------~-~~~l~~Cp~C~~~  139 (146)
T PF07295_consen  112 TLVCENCGHEVELT---------H-PERLPPCPKCGHT  139 (146)
T ss_pred             eEecccCCCEEEec---------C-CCcCCCCCCCCCC
Confidence            47777777553211         2 2334567777754


No 233
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=20.64  E-value=34  Score=21.83  Aligned_cols=11  Identities=18%  Similarity=0.458  Sum_probs=5.8

Q ss_pred             ccccccccccC
Q psy11591        170 FVCEVCNTGFK  180 (220)
Q Consensus       170 ~~C~~C~~~f~  180 (220)
                      ..|+.||..+.
T Consensus        43 ~~C~~CG~y~~   53 (99)
T PRK14892         43 ITCGNCGLYTE   53 (99)
T ss_pred             EECCCCCCccC
Confidence            45666665443


No 234
>KOG4118|consensus
Probab=20.23  E-value=53  Score=19.00  Aligned_cols=24  Identities=17%  Similarity=0.458  Sum_probs=10.8

Q ss_pred             eeCCccccccCCHHHHHHHHHHcC
Q psy11591        142 YICEICGKDFGTARYLKRHKDTHN  165 (220)
Q Consensus       142 ~~C~~C~~~f~~~~~l~~H~~~h~  165 (220)
                      |.|.+|-..-.....+..|....|
T Consensus        39 ~kCtVC~~~mpdpktfkqhfe~kH   62 (74)
T KOG4118|consen   39 HKCTVCMVQMPDPKTFKQHFENKH   62 (74)
T ss_pred             hhhHhhHhhCCCCchHHHHHhhcC
Confidence            344444444444444444444433


No 235
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=20.08  E-value=18  Score=18.58  Aligned_cols=8  Identities=50%  Similarity=1.593  Sum_probs=3.0

Q ss_pred             ceeCCccc
Q psy11591        141 LYICEICG  148 (220)
Q Consensus       141 ~~~C~~C~  148 (220)
                      .+.|..|+
T Consensus        24 ~w~C~~C~   31 (40)
T PF04810_consen   24 TWICNFCG   31 (40)
T ss_dssp             EEEETTT-
T ss_pred             EEECcCCC
Confidence            34444443


Done!