RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy11608
         (99 letters)



>gnl|CDD|240796 cd12350, RRM3_SHARP, RNA recognition motif 3 in
          SMART/HDAC1-associated repressor protein (SHARP) and
          similar proteins.  This subfamily corresponds to the
          RRM3 of SHARP, also termed Msx2-interacting protein
          (MINT), or SPEN homolog, an estrogen-inducible
          transcriptional repressor that interacts directly with
          the nuclear receptor corepressor SMRT, histone
          deacetylases (HDACs) and components of the NuRD
          complex. SHARP recruits HDAC activity and binds to the
          steroid receptor RNA coactivator SRA through four
          conserved N-terminal RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), further suppressing
          SRA-potentiated steroid receptor transcription
          activity. Thus, SHARP has the capacity to modulate both
          liganded and nonliganded nuclear receptors. SHARP also
          has been identified as a component of transcriptional
          repression complexes in Notch/RBP-Jkappa signaling
          pathways. In addition to the N-terminal RRMs, SHARP
          possesses a C-terminal SPOC domain (Spen paralog and
          ortholog C-terminal domain), which is highly conserved
          among Spen proteins.  .
          Length = 74

 Score = 79.0 bits (195), Expect = 4e-21
 Identities = 30/43 (69%), Positives = 36/43 (83%)

Query: 6  VDIKKQSSASAFAFVQYTDIASVVRAMRAMDGEYVGHNRVNLG 48
          +DIKKQ    A+AF+QY DIASVV+AMR MDGEY+G+NRV LG
Sbjct: 32 IDIKKQGGNPAYAFIQYADIASVVKAMRKMDGEYLGNNRVKLG 74


>gnl|CDD|240755 cd12309, RRM2_Spen, RNA recognition motif 2 in the Spen (split
          end) protein family.  This subfamily corresponds to the
          RRM2 domain in the Spen (split end) protein family
          which includes RNA binding motif protein 15 (RBM15),
          putative RNA binding motif protein 15B (RBM15B), and
          similar proteins found in Metazoa. RBM15, also termed
          one-twenty two protein 1 (OTT1), conserved in
          eukaryotes, is a novel mRNA export factor and component
          of the NXF1 pathway. It binds to NXF1 and serves as
          receptor for the RNA export element RTE. It also
          possess mRNA export activity and can facilitate the
          access of DEAD-box protein DBP5 to mRNA at the nuclear
          pore complex (NPC). RNA-binding protein 15B (RBM15B),
          also termed one twenty-two 3 (OTT3), is a paralog of
          RBM15 and therefore has post-transcriptional regulatory
          activity. It is a nuclear protein sharing with RBM15
          the association with the splicing factor compartment
          and the nuclear envelope as well as the binding to mRNA
          export factors NXF1 and Aly/REF. Members in this family
          belong to the Spen (split end) protein family, which
          share a domain architecture comprising of three
          N-terminal RNA recognition motifs (RRMs), also known as
          RBD (RNA binding domain) or RNP (ribonucleoprotein
          domain), and a C-terminal SPOC (Spen paralog and
          ortholog C-terminal) domain. .
          Length = 79

 Score = 44.7 bits (106), Expect = 1e-07
 Identities = 20/48 (41%), Positives = 32/48 (66%), Gaps = 2/48 (4%)

Query: 6  VDIKKQS--SASAFAFVQYTDIASVVRAMRAMDGEYVGHNRVNLGYGK 51
          VDIK+      +A+AFV++ ++    RA  AM G+Y+G N++ +GYGK
Sbjct: 32 VDIKRPPRGQGNAYAFVKFLNLDMAHRAKVAMSGQYIGRNQIKIGYGK 79


>gnl|CDD|240999 cd12555, RRM2_RBM15, RNA recognition motif 2 in vertebrate RNA
          binding motif protein 15 (RBM15).  This subgroup
          corresponds to the RRM2 of RBM15, also termed
          one-twenty two protein 1 (OTT1), conserved in
          eukaryotes, a novel mRNA export factor and component of
          the NXF1 pathway. It binds to NXF1 and serves as
          receptor for the RNA export element RTE. It also
          possesses mRNA export activity and can facilitate the
          access of DEAD-box protein DBP5 to mRNA at the nuclear
          pore complex (NPC). RBM15 belongs to the Spen (split
          end) protein family, which contain three N-terminal RNA
          recognition motifs (RRMs), also known as RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain), and
          a C-terminal SPOC (Spen paralog and ortholog
          C-terminal) domain. This family also includes a
          RBM15-MKL1 (OTT-MAL) fusion protein that RBM15 is
          N-terminally fused to megakaryoblastic leukemia 1
          protein (MKL1) at the C-terminus in a translocation
          involving chromosome 1 and 22, resulting in acute
          megakaryoblastic leukemia. The fusion protein could
          interact with the mRNA export machinery. Although it
          maintains the specific transactivator function of MKL1,
          the fusion protein cannot activate RTE-mediated mRNA
          expression and has lost the post-transcriptional
          activator function of RBM15. However, it has
          transdominant suppressor function contributing to its
          oncogenic properties. .
          Length = 87

 Score = 35.7 bits (82), Expect = 5e-04
 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 2/49 (4%)

Query: 6  VDIKKQS--SASAFAFVQYTDIASVVRAMRAMDGEYVGHNRVNLGYGKS 52
          VDIK+      S + F+++ ++    RA  AM G+ +  N + +GYGK+
Sbjct: 37 VDIKRPGRGQTSTYGFLKFENLDMAHRAKLAMSGKVLRRNPIKIGYGKA 85


>gnl|CDD|241000 cd12556, RRM2_RBM15B, RNA recognition motif 2 in putative RNA
          binding motif protein 15B (RBM15B) from vertebrate.
          This subgroup corresponds to the RRM2 of RBM15B, also
          termed one twenty-two 3 (OTT3), a paralog of RNA
          binding motif protein 15 (RBM15), also known as
          One-twenty two protein 1 (OTT1). Like RBM15, RBM15B has
          post-transcriptional regulatory activity. It is a
          nuclear protein sharing with RBM15 the association with
          the splicing factor compartment and the nuclear
          envelope as well as the binding to mRNA export factors
          NXF1 and Aly/REF. RBM15B belongs to the Spen (split
          end) protein family, which shares a domain architecture
          comprising of three N-terminal RNA recognition motifs
          (RRMs), also known as RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), and a C-terminal SPOC (Spen
          paralog and ortholog C-terminal) domain. .
          Length = 85

 Score = 34.9 bits (80), Expect = 8e-04
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 6  VDIKK--QSSASAFAFVQYTDIASVVRAMRAMDGEYVGHNRVNLGYGK 51
          V IK+  +    A+AF+++ ++    RA  AM G  +G N + +GYGK
Sbjct: 38 VVIKRPARGQGGAYAFLKFQNLDMAHRAKVAMSGRVIGRNPIKIGYGK 85


>gnl|CDD|214636 smart00360, RRM, RNA recognition motif. 
          Length = 73

 Score = 34.5 bits (80), Expect = 0.001
 Identities = 7/31 (22%), Positives = 17/31 (54%)

Query: 17 FAFVQYTDIASVVRAMRAMDGEYVGHNRVNL 47
          FAFV++       +A+ A++G+ +    + +
Sbjct: 43 FAFVEFESEEDAEKALEALNGKELDGRPLKV 73


>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily.  RRM,
          also known as RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), is a highly abundant domain
          in eukaryotes found in proteins involved in
          post-transcriptional gene expression processes
          including mRNA and rRNA processing, RNA export, and RNA
          stability. This domain is 90 amino acids in length and
          consists of a four-stranded beta-sheet packed against
          two alpha-helices. RRM usually interacts with ssRNA,
          but is also known to interact with ssDNA as well as
          proteins. RRM binds a variable number of nucleotides,
          ranging from two to eight. The active site includes
          three aromatic side-chains located within the conserved
          RNP1 and RNP2 motifs of the domain. The RRM domain is
          found in a variety heterogeneous nuclear
          ribonucleoproteins (hnRNPs), proteins implicated in
          regulation of alternative splicing, and protein
          components of small nuclear ribonucleoproteins
          (snRNPs).
          Length = 72

 Score = 34.2 bits (79), Expect = 0.001
 Identities = 7/31 (22%), Positives = 18/31 (58%)

Query: 17 FAFVQYTDIASVVRAMRAMDGEYVGHNRVNL 47
          FAFV++       +A+ A++G+ +   ++ +
Sbjct: 41 FAFVEFESPEDAEKALEALNGKELDGRKLKV 71


>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif. (a.k.a. RRM, RBD, or RNP
          domain).  The RRM motif is probably diagnostic of an
          RNA binding protein. RRMs are found in a variety of RNA
          binding proteins, including various hnRNP proteins,
          proteins implicated in regulation of alternative
          splicing, and protein components of snRNPs. The motif
          also appears in a few single stranded DNA binding
          proteins. The RRM structure consists of four strands
          and two helices arranged in an alpha/beta sandwich,
          with a third helix present during RNA binding in some
          cases The C-terminal beta strand (4th strand) and final
          helix are hard to align and have been omitted in the
          SEED alignment The LA proteins have an N terminal rrm
          which is included in the seed. There is a second region
          towards the C terminus that has some features
          characteristic of a rrm but does not appear to have the
          important structural core of a rrm. The LA proteins are
          one of the main autoantigens in Systemic lupus
          erythematosus (SLE), an autoimmune disease.
          Length = 70

 Score = 33.7 bits (78), Expect = 0.002
 Identities = 9/29 (31%), Positives = 18/29 (62%)

Query: 17 FAFVQYTDIASVVRAMRAMDGEYVGHNRV 45
          FAFV++ D     +A+ A++G+ +G   +
Sbjct: 41 FAFVEFEDEEDAEKALEALNGKELGGREL 69


>gnl|CDD|240820 cd12374, RRM_UHM_SPF45_PUF60, RNA recognition motif in UHM domain
          of 45 kDa-splicing factor (SPF45) and similar proteins.
           This subfamily corresponds to the RRM found in UHM
          domain of 45 kDa-splicing factor (SPF45 or RBM17),
          poly(U)-binding-splicing factor PUF60 (FIR or Hfp or
          RoBP1 or Siah-BP1), and similar proteins. SPF45 is an
          RNA-binding protein consisting of an unstructured
          N-terminal region, followed by a G-patch motif and a
          C-terminal U2AF (U2 auxiliary factor) homology motifs
          (UHM) that harbors a RNA recognition motif (RRM), also
          termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain) and an Arg-Xaa-Phe sequence
          motif. SPF45 regulates alternative splicing of the
          apoptosis regulatory gene FAS (also known as CD95). It
          induces exon 6 skipping in FAS pre-mRNA through the UHM
          domain that binds to tryptophan-containing linear
          peptide motifs (UHM ligand motifs, ULMs) present in the
          3' splice site-recognizing factors U2AF65, SF1 and
          SF3b155. PUF60 is an essential splicing factor that
          functions as a poly-U RNA-binding protein required to
          reconstitute splicing in depleted nuclear extracts. Its
          function is enhanced through interaction with U2
          auxiliary factor U2AF65. PUF60 also controls human
          c-myc gene expression by binding and inhibiting the
          transcription factor far upstream sequence element
          (FUSE)-binding-protein (FBP), an activator of c-myc
          promoters. PUF60 contains two central RRMs and a
          C-terminal UHM domain. .
          Length = 85

 Score = 33.7 bits (78), Expect = 0.002
 Identities = 9/27 (33%), Positives = 19/27 (70%)

Query: 19 FVQYTDIASVVRAMRAMDGEYVGHNRV 45
          FV+++D    ++A+RA++G + G  +V
Sbjct: 53 FVEFSDADEAIKAVRALNGRFFGGRKV 79


>gnl|CDD|240829 cd12383, RRM_RBM42, RNA recognition motif in RNA-binding protein
          42 (RBM42) and similar proteins.  This subfamily
          corresponds to the RRM of RBM42 which has been
          identified as a heterogeneous nuclear ribonucleoprotein
          K (hnRNP K)-binding protein. It also directly binds the
          3' untranslated region of p21 mRNA that is one of the
          target mRNAs for hnRNP K. Both, hnRNP K and RBM42, are
          components of stress granules (SGs). Under nonstress
          conditions, RBM42 predominantly localizes within the
          nucleus and co-localizes with hnRNP K. Under stress
          conditions, hnRNP K and RBM42 form cytoplasmic foci
          where the SG marker TIAR localizes, and may play a role
          in the maintenance of cellular ATP level by protecting
          their target mRNAs. RBM42 contains an RNA recognition
          motif (RRM), also termed RBD (RNA binding domain) or
          RNP (ribonucleoprotein domain). .
          Length = 83

 Score = 33.4 bits (77), Expect = 0.003
 Identities = 12/28 (42%), Positives = 20/28 (71%), Gaps = 1/28 (3%)

Query: 17 FAFVQYTDIASVVRAMRAMDGEYVGHNR 44
          + FV ++D    ++AM+ M+G+YVG NR
Sbjct: 50 YGFVSFSDPNDYLKAMKEMNGKYVG-NR 76


>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated
          protein SR140 and similar proteins.  This subgroup
          corresponds to the RRM of SR140 (also termed U2
          snRNP-associated SURP motif-containing protein
          orU2SURP, or 140 kDa Ser/Arg-rich domain protein) which
          is a putative splicing factor mainly found in higher
          eukaryotes. Although it is initially identified as one
          of the 17S U2 snRNP-associated proteins, the molecular
          and physiological function of SR140 remains unclear.
          SR140 contains an N-terminal RNA recognition motif
          (RRM), also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), a SWAP/SURP domain that is
          found in a number of pre-mRNA splicing factors in the
          middle region, and a C-terminal arginine/serine-rich
          domain (RS domain).
          Length = 84

 Score = 31.5 bits (72), Expect = 0.014
 Identities = 12/35 (34%), Positives = 20/35 (57%)

Query: 18 AFVQYTDIASVVRAMRAMDGEYVGHNRVNLGYGKS 52
           FV + + A   RA+  +DG+ V    + LG+GK+
Sbjct: 49 GFVAFMNRADAERALDELDGKDVMGYELKLGWGKA 83


>gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the
          U1A/U2B"/SNF protein family.  This subfamily
          corresponds to the RRM1 of U1A/U2B"/SNF protein family
          which contains Drosophila sex determination protein SNF
          and its two mammalian counterparts, U1 small nuclear
          ribonucleoprotein A (U1 snRNP A or U1-A or U1A) and U2
          small nuclear ribonucleoprotein B" (U2 snRNP B" or
          U2B"), all of which consist of two RNA recognition
          motifs (RRMs), connected by a variable, flexible
          linker. SNF is an RNA-binding protein found in the U1
          and U2 snRNPs of Drosophila where it is essential in
          sex determination and possesses a novel dual RNA
          binding specificity. SNF binds with high affinity to
          both Drosophila U1 snRNA stem-loop II (SLII) and U2
          snRNA stem-loop IV (SLIV). It can also bind to poly(U)
          RNA tracts flanking the alternatively spliced
          Sex-lethal (Sxl) exon, as does Drosophila Sex-lethal
          protein (SXL). U1A is an RNA-binding protein associated
          with the U1 snRNP, a small RNA-protein complex involved
          in pre-mRNA splicing. U1A binds with high affinity and
          specificity to stem-loop II (SLII) of U1 snRNA. It is
          predominantly a nuclear protein that shuttles between
          the nucleus and the cytoplasm independently of
          interactions with U1 snRNA. Moreover, U1A may be
          involved in RNA 3'-end processing, specifically
          cleavage, splicing and polyadenylation, through
          interacting with a large number of non-snRNP proteins.
          U2B", initially identified to bind to stem-loop IV
          (SLIV) at the 3' end of U2 snRNA, is a unique protein
          that comprises of the U2 snRNP. Additional research
          indicates U2B" binds to U1 snRNA stem-loop II (SLII) as
          well and shows no preference for SLIV or SLII on the
          basis of binding affinity. Moreover, U2B" does not
          require an auxiliary protein for binding to RNA, and
          its nuclear transport is independent of U2 snRNA
          binding. .
          Length = 78

 Score = 31.3 bits (72), Expect = 0.019
 Identities = 11/36 (30%), Positives = 16/36 (44%), Gaps = 8/36 (22%)

Query: 18 AFVQYTDIASVVRAMRAMDGEYVGHNRVNLGYGKSL 53
          AFV + D+ S   A+RA+ G           Y K +
Sbjct: 45 AFVVFKDVESATNALRALQGFPF--------YDKPM 72


>gnl|CDD|240797 cd12351, RRM4_SHARP, RNA recognition motif 4 in
          SMART/HDAC1-associated repressor protein (SHARP) and
          similar proteins.  This subfamily corresponds to the
          RRM of SHARP, also termed Msx2-interacting protein
          (MINT), or SPEN homolog, is an estrogen-inducible
          transcriptional repressor that interacts directly with
          the nuclear receptor corepressor SMRT, histone
          deacetylases (HDACs) and components of the NuRD
          complex. SHARP recruits HDAC activity and binds to the
          steroid receptor RNA coactivator SRA through four
          conserved N-terminal RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), further suppressing
          SRA-potentiated steroid receptor transcription
          activity. Thus, SHARP has the capacity to modulate both
          liganded and nonliganded nuclear receptors. SHARP also
          has been identified as a component of transcriptional
          repression complexes in Notch/RBP-Jkappa signaling
          pathways. In addition to the N-terminal RRMs, SHARP
          possesses a C-terminal SPOC domain (Spen paralog and
          ortholog C-terminal domain), which is highly conserved
          among Spen proteins. .
          Length = 77

 Score = 30.7 bits (70), Expect = 0.031
 Identities = 9/16 (56%), Positives = 13/16 (81%)

Query: 49 YGKSLATTCVWVDGVA 64
          +GKS+ T CVW+DG+ 
Sbjct: 1  FGKSMPTNCVWLDGLD 16



 Score = 30.7 bits (70), Expect = 0.031
 Identities = 9/16 (56%), Positives = 13/16 (81%)

Query: 79 YGKSLATTCVWVDGVA 94
          +GKS+ T CVW+DG+ 
Sbjct: 1  FGKSMPTNCVWLDGLD 16


>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint
           family.  The proteins represented by this model contain
           three RNA recognition motifs (rrm: pfam00076) and have
           been characterized as poly-pyrimidine tract binding
           proteins associated with RNA splicing factors. In the
           case of PUF60 (GP|6176532), in complex with p54, and in
           the presence of U2AF, facilitates association of U2
           snRNP with pre-mRNA.
          Length = 612

 Score = 31.6 bits (71), Expect = 0.040
 Identities = 11/27 (40%), Positives = 16/27 (59%)

Query: 19  FVQYTDIASVVRAMRAMDGEYVGHNRV 45
           FV+++D   V RA  A+DG + G   V
Sbjct: 569 FVEFSDSMEVDRAKAALDGRFFGGRTV 595


>gnl|CDD|240892 cd12446, RRM_RBM25, RNA recognition motif in eukaryotic
          RNA-binding protein 25 and similar proteins.  This
          subfamily corresponds to the RRM of RBM25, also termed
          Arg/Glu/Asp-rich protein of 120 kDa (RED120), or
          protein S164, or RNA-binding region-containing protein
          7, an evolutionary-conserved splicing coactivator
          SRm160 (SR-related nuclear matrix protein of 160 kDa,
          )-interacting protein. RBM25 belongs to a family of
          RNA-binding proteins containing a well conserved RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain), at the
          N-terminus, a RE/RD-rich (ER) central region, and a
          C-terminal proline-tryptophan-isoleucine (PWI) motif.
          It localizes to the nuclear speckles and associates
          with multiple splicing components, including splicing
          cofactors SRm160/300, U snRNAs, assembled splicing
          complexes, and spliced mRNAs. It may play an important
          role in pre-mRNA processing by coupling splicing with
          mRNA 3'-end formation. Additional research indicates
          that RBM25 is one of the RNA-binding regulators that
          direct the alternative splicing of apoptotic factors.
          It can activate proapoptotic Bcl-xS 5'ss by binding to
          the exonic splicing enhancer, CGGGCA, and stabilize the
          pre-mRNA-U1 snRNP through interaction with hLuc7A, a U1
          snRNP-associated factor. .
          Length = 84

 Score = 30.3 bits (69), Expect = 0.048
 Identities = 11/38 (28%), Positives = 19/38 (50%), Gaps = 5/38 (13%)

Query: 9  KKQSSAS-----AFAFVQYTDIASVVRAMRAMDGEYVG 41
          K+    S     AF F ++ D    +RA+R ++G  +G
Sbjct: 31 KRVKDPSTGKLKAFGFCEFEDPEGALRALRLLNGLELG 68


>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic
          activator RIM4 and similar proteins.  This subfamily
          corresponds to the RRM2 of RIM4, also termed regulator
          of IME2 protein 4, a putative RNA binding protein that
          is expressed at elevated levels early in meiosis. It
          functions as a meiotic activator required for both the
          IME1- and IME2-dependent pathways of meiotic gene
          expression, as well as early events of meiosis, such as
          meiotic division and recombination, in Saccharomyces
          cerevisiae. RIM4 contains two RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). The family also includes a
          putative RNA-binding protein termed multicopy
          suppressor of sporulation protein Msa1. It is a
          putative RNA-binding protein encoded by a novel gene,
          msa1, from the fission yeast Schizosaccharomyces pombe.
          Msa1 may be involved in the inhibition of sexual
          differentiation by controlling the expression of
          Ste11-regulated genes, possibly through the
          pheromone-signaling pathway. Like RIM4, Msa1 also
          contains two RRMs, both of which are essential for the
          function of Msa1. .
          Length = 80

 Score = 30.0 bits (68), Expect = 0.051
 Identities = 9/38 (23%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 8  IKKQSSASAFAFVQYTDIASVVRAMRAMDGEYVGHNRV 45
          IK+ +  +AFAF+++    +  RA+ + +   +  N+ 
Sbjct: 36 IKRANHTNAFAFIKFEREQAAARAVESENH-SMLKNKT 72


>gnl|CDD|241084 cd12640, RRM3_Bruno_like, RNA recognition motif 3 in Drosophila
          melanogaster Bruno protein and similar proteins.  This
          subgroup corresponds to the RRM3 of Bruno protein, a
          Drosophila RNA recognition motif (RRM)-containing
          protein that plays a central role in regulation of
          Oskar (Osk) expression. It mediates repression by
          binding to regulatory Bruno response elements (BREs) in
          the Osk mRNA 3' UTR. The full-length Bruno protein
          contains three RRMs, two located in the N-terminal half
          of the protein and the third near the C-terminus,
          separated by a linker region. .
          Length = 79

 Score = 29.6 bits (66), Expect = 0.092
 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 6  VDIKKQSSAS-AFAFVQYTDIASVVRAMRAMDGEYVGHNRVNL 47
          V I KQ++ S  F FV Y +  S   A++AM+G  +G  R+ +
Sbjct: 36 VFIDKQTNLSKCFGFVSYDNPDSAQAAIQAMNGFQIGTKRLKV 78


>gnl|CDD|240971 cd12527, RRM2_EAR1_like, RNA recognition motif 2 in terminal
          EAR1-like proteins.  This subgroup corresponds to the
          RRM2 of terminal EAR1-like proteins, including terminal
          EAR1-like protein 1 and 2 (TEL1 and TEL2) found in land
          plants. They may play a role in the regulation of leaf
          initiation. The terminal EAR1-like proteins are
          putative RNA-binding proteins carrying three RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          and TEL characteristic motifs that allow sequence and
          putative functional discrimination between the terminal
          EAR1-like proteins and Mei2-like proteins. .
          Length = 71

 Score = 29.0 bits (65), Expect = 0.099
 Identities = 9/27 (33%), Positives = 17/27 (62%)

Query: 19 FVQYTDIASVVRAMRAMDGEYVGHNRV 45
          FV++ D+    +A+RAM+G+ +    V
Sbjct: 42 FVEFFDVRDAAKALRAMNGKEISGKPV 68


>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in
          RNA-binding protein 19 (RBM19) and RNA recognition
          motif 2 found in multiple RNA-binding domain-containing
          protein 1 (MRD1).  This subfamily corresponds to the
          RRM3 of RBM19 and RRM2 of MRD1. RBM19, also termed
          RNA-binding domain-1 (RBD-1), is a nucleolar protein
          conserved in eukaryotes involved in ribosome biogenesis
          by processing rRNA and is essential for preimplantation
          development. It has a unique domain organization
          containing 6 conserved RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). MRD1 is encoded by a novel
          yeast gene MRD1 (multiple RNA-binding domain). It is
          well conserved in yeast and its homologs exist in all
          eukaryotes. MRD1 is present in the nucleolus and the
          nucleoplasm. It interacts with the 35 S precursor rRNA
          (pre-rRNA) and U3 small nucleolar RNAs (snoRNAs). It is
          essential for the initial processing at the A0-A2
          cleavage sites in the 35 S pre-rRNA. MRD1 contains 5
          conserved RRMs, which may play an important structural
          role in organizing specific rRNA processing events. .
          Length = 74

 Score = 29.2 bits (66), Expect = 0.11
 Identities = 10/31 (32%), Positives = 16/31 (51%), Gaps = 1/31 (3%)

Query: 8  IKKQSSAS-AFAFVQYTDIASVVRAMRAMDG 37
          + K++  S  FAFV +      V+A   +DG
Sbjct: 33 LDKETKRSKGFAFVSFMFPEHAVKAYSELDG 63


>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple
          RNA-binding domain-containing protein 1 (MRD1) and
          similar proteins.  This subgroup corresponds to the
          RRM2 of MRD1 which is encoded by a novel yeast gene
          MRD1 (multiple RNA-binding domain). It is
          well-conserved in yeast and its homologs exist in all
          eukaryotes. MRD1 is present in the nucleolus and the
          nucleoplasm. It interacts with the 35 S precursor rRNA
          (pre-rRNA) and U3 small nucleolar RNAs (snoRNAs). It is
          essential for the initial processing at the A0-A2
          cleavage sites in the 35 S pre-rRNA. MRD1 contains 5
          conserved RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), which may play an important structural role
          in organizing specific rRNA processing events. .
          Length = 79

 Score = 28.9 bits (65), Expect = 0.15
 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%)

Query: 6  VDIKKQSSAS-AFAFVQYTDIASVVRAMRAMDG 37
          V I K+S  S  FA+V + D    V+A + +DG
Sbjct: 34 VAIDKKSGKSKGFAYVLFLDPEDAVKAYKELDG 66


>gnl|CDD|240706 cd12260, RRM2_SREK1, RNA recognition motif 2 in splicing
          regulatory glutamine/lysine-rich protein 1 (SREK1) and
          similar proteins.  This subfamily corresponds to the
          RRM2 of SREK1, also termed
          serine/arginine-rich-splicing regulatory protein 86-kDa
          (SRrp86), or splicing factor arginine/serine-rich 12
          (SFRS12), or splicing regulatory protein 508 amino acid
          (SRrp508). SREK1 belongs to a family of proteins
          containing regions rich in serine-arginine dipeptides
          (SR proteins family), which is involved in
          bridge-complex formation and splicing by mediating
          protein-protein interactions across either introns or
          exons. It is a unique SR family member and it may play
          a crucial role in determining tissue specific patterns
          of alternative splicing. SREK1 can alter splice site
          selection by both positively and negatively modulating
          the activity of other SR proteins. For instance, SREK1
          can activate SRp20 and repress SC35 in a dose-dependent
          manner both in vitro and in vivo. In addition, SREK1
          contains two (some contain only one) RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), and two
          serine-arginine (SR)-rich domains (SR domains)
          separated by an unusual glutamic acid-lysine (EK) rich
          region. The RRM and SR domains are highly conserved
          among other members of the SR superfamily. However, the
          EK domain is unique to SREK1. It plays a modulatory
          role controlling SR domain function by involvement in
          the inhibition of both constitutive and alternative
          splicing and in the selection of splice-site. .
          Length = 85

 Score = 28.8 bits (65), Expect = 0.16
 Identities = 7/25 (28%), Positives = 15/25 (60%)

Query: 17 FAFVQYTDIASVVRAMRAMDGEYVG 41
          +AFV++ +  SV+ A++     + G
Sbjct: 46 YAFVEFAEQTSVINALKLNGAMFGG 70


>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like
          family of RNA binding proteins CELF1, CELF2, CELF3,
          CELF4, CELF5, CELF6 and similar proteins.  This
          subgroup corresponds to the RRM3 of the CUGBP1 and
          ETR-3-like factors (CELF) or BRUNOL (Bruno-like)
          proteins, a family of structurally related RNA-binding
          proteins involved in the regulation of pre-mRNA
          splicing in the nucleus and in the control of mRNA
          translation and deadenylation in the cytoplasm. The
          family contains six members: CELF-1 (also termed
          BRUNOL-2, or CUG-BP1, or NAPOR, or EDEN-BP), CELF-2
          (also termed BRUNOL-3, or ETR-3, or CUG-BP2, or
          NAPOR-2), CELF-3 (also termed BRUNOL-1, or TNRC4, or
          ETR-1, or CAGH4, or ER DA4), CELF-4 (also termed
          BRUNOL-4), CELF-5 (also termed BRUNOL-5), CELF-6 (also
          termed BRUNOL-6). They all contain three highly
          conserved RNA recognition motifs (RRMs), also known as
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains): two consecutive RRMs (RRM1 and RRM2) situated
          in the N-terminal region followed by a linker region
          and the third RRM (RRM3) close to the C-terminus of the
          protein. The low sequence conservation of the linker
          region is highly suggestive of a large variety in the
          co-factors that associate with the various CELF family
          members. Based on both sequence similarity and
          function, the CELF family can be divided into two
          subfamilies, the first containing CELFs 1 and 2, and
          the second containing CELFs 3, 4, 5, and 6. The
          different CELF proteins may act through different sites
          on at least some substrates. Furthermore, CELF proteins
          may interact with each other in varying combinations to
          influence alternative splicing in different contexts. .
          Length = 73

 Score = 28.4 bits (64), Expect = 0.18
 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 1/40 (2%)

Query: 6  VDIKKQSSAS-AFAFVQYTDIASVVRAMRAMDGEYVGHNR 44
          V + K +  S  F FV Y +  S   A++AM+G  VG  R
Sbjct: 30 VFVDKNTGQSKCFGFVSYDNPESAQAAIKAMNGFQVGGKR 69


>gnl|CDD|241043 cd12599, RRM1_SF2_plant_like, RNA recognition motif 1 in plant
          pre-mRNA-splicing factor SF2 and similar proteins.
          This subgroup corresponds to the RRM1 of SF2, also
          termed SR1 protein, a plant serine/arginine (SR)-rich
          phosphoprotein similar to the mammalian splicing factor
          SF2/ASF. It promotes splice site switching in mammalian
          nuclear extracts. SF2 contains two N-terminal RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          followed by a C-terminal domain rich in proline, serine
          and lysine residues (PSK domain), a composition
          reminiscent of histones. This PSK domain harbors a
          putative phosphorylation site for the mitotic kinase
          cyclin/p34cdc2. .
          Length = 72

 Score = 28.6 bits (64), Expect = 0.18
 Identities = 13/44 (29%), Positives = 22/44 (50%), Gaps = 2/44 (4%)

Query: 6  VDIKKQSSASAFAFVQYTDIASVVRAMRAMDG-EYVGHN-RVNL 47
          +D+K       +AF+++ D      A+R  DG ++ G   RV L
Sbjct: 29 IDLKLPPRPPGYAFIEFEDARDAEDAIRGRDGYDFDGQRLRVEL 72


>gnl|CDD|241082 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in CUGBP Elav-like
          family member CELF-1, CELF-2 and similar proteins.
          This subgroup corresponds to the RRM3 of CELF-1 (also
          termed BRUNOL-2, or CUG-BP1, or EDEN-BP) and CELF-2
          (also termed BRUNOL-3, or ETR-3, or CUG-BP2, or NAPOR),
          both of which belong to the CUGBP1 and ETR-3-like
          factors (CELF) or BRUNOL (Bruno-like) family of
          RNA-binding proteins that have been implicated in the
          regulation of pre-mRNA splicing and in the control of
          mRNA translation and deadenylation. CELF-1 is strongly
          expressed in all adult and fetal tissues tested. Human
          CELF-1 is a nuclear and cytoplasmic RNA-binding protein
          that regulates multiple aspects of nuclear and
          cytoplasmic mRNA processing, with implications for
          onset of type 1 myotonic dystrophy (DM1), a
          neuromuscular disease associated with an unstable CUG
          triplet expansion in the 3'-UTR (3'-untranslated
          region) of the DMPK (myotonic dystrophy protein kinase)
          gene; it preferentially targets UGU-rich mRNA elements.
          It has been shown to bind to a Bruno response element,
          a cis-element involved in translational control of
          oskar mRNA in Drosophila, and share sequence similarity
          to Bruno, the Drosophila protein that mediates this
          process. The Xenopus homolog embryo deadenylation
          element-binding protein (EDEN-BP) mediates
          sequence-specific deadenylation of Eg5 mRNA. It
          specifically binds to the EDEN motif in the
          3'-untranslated regions of maternal mRNAs and targets
          these mRNAs for deadenylation and translational
          repression. CELF-1 contain three highly conserved RNA
          recognition motifs (RRMs), also known as RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains):
          two consecutive RRMs (RRM1 and RRM2) situated in the
          N-terminal region followed by a linker region and the
          third RRM (RRM3) close to the C-terminus of the
          protein. The two N-terminal RRMs of EDEN-BP are
          necessary for the interaction with EDEN as well as a
          part of the linker region (between RRM2 and RRM3).
          Oligomerization of EDEN-BP is required for specific
          mRNA deadenylation and binding. CELF-2 is expressed in
          all tissues at some level, but highest in brain, heart,
          and thymus. It has been implicated in the regulation of
          nuclear and cytoplasmic RNA processing events,
          including alternative splicing, RNA editing, stability
          and translation. CELF-2 shares high sequence identity
          with CELF-1, but shows different binding specificity;
          it binds preferentially to sequences with UG repeats
          and UGUU motifs. It has been shown to bind to a Bruno
          response element, a cis-element involved in
          translational control of oskar mRNA in Drosophila, and
          share sequence similarity to Bruno, the Drosophila
          protein that mediates this process. It also binds to
          the 3'-UTR of cyclooxygenase-2 messages, affecting both
          translation and mRNA stability, and binds to apoB mRNA,
          regulating its C to U editing. CELF-2 also contain
          three highly conserved RRMs. It binds to RNA via the
          first two RRMs, which are important for localization in
          the cytoplasm. The splicing activation or repression
          activity of CELF-2 on some specific substrates is
          mediated by RRM1/RRM2. Both, RRM1 and RRM2 of CELF-2,
          can activate cardiac troponin T (cTNT) exon 5
          inclusion. In addition, CELF-2 possesses a typical
          arginine and lysine-rich nuclear localization signal
          (NLS) in the C-terminus, within RRM3. .
          Length = 92

 Score = 28.9 bits (64), Expect = 0.19
 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 6  VDIKKQSSAS-AFAFVQYTDIASVVRAMRAMDGEYVGHNRVNL 47
          V I KQ++ S  F FV Y +  S   A++AM+G  +G  R+ +
Sbjct: 39 VFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKV 81


>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a.k.a. RRM, RBD, or RNP
          domain). 
          Length = 69

 Score = 28.3 bits (64), Expect = 0.19
 Identities = 6/30 (20%), Positives = 14/30 (46%)

Query: 17 FAFVQYTDIASVVRAMRAMDGEYVGHNRVN 46
          FAFV++        A++ ++G  +    + 
Sbjct: 40 FAFVEFASPEDAEAALKKLNGLVLDGRTLR 69


>gnl|CDD|241083 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 in CUGBP
          Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6
          and similar proteins.  This subgroup corresponds to the
          RRM3 of CELF-3, CELF-4, CELF-5, and CELF-6, all of
          which belong to the CUGBP1 and ETR-3-like factors
          (CELF) or BRUNOL (Bruno-like) family of RNA-binding
          proteins that display dual nuclear and cytoplasmic
          localizations and have been implicated in the
          regulation of pre-mRNA splicing and in the control of
          mRNA translation and deadenylation. CELF-3, expressed
          in brain and testis only, is also known as bruno-like
          protein 1 (BRUNOL-1), or CAG repeat protein 4, or
          CUG-BP- and ETR-3-like factor 3, or embryonic lethal
          abnormal vision (ELAV)-type RNA-binding protein 1
          (ETR-1), or expanded repeat domain protein CAG/CTG 4,
          or trinucleotide repeat-containing gene 4 protein
          (TNRC4). It plays an important role in the pathogenesis
          of tauopathies. CELF-3 contains three highly conserved
          RNA recognition motifs (RRMs), also known as RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains):
          two consecutive RRMs (RRM1 and RRM2) situated in the
          N-terminal region followed by a linker region and the
          third RRM (RRM3) close to the C-terminus of the
          protein.The effect of CELF-3 on tau splicing is
          mediated mainly by the RNA-binding activity of RRM2.
          The divergent linker region might mediate the
          interaction of CELF-3 with other proteins regulating
          its activity or involved in target recognition. CELF-4,
          highly expressed throughout the brain and in glandular
          tissues, moderately expressed in heart, skeletal
          muscle, and liver, is also known as bruno-like protein
          4 (BRUNOL-4), or CUG-BP- and ETR-3-like factor 4. Like
          CELF-3, CELF-4 also contains three highly conserved
          RRMs. The splicing activation or repression activity of
          CELF-4 on some specific substrates is mediated by its
          RRM1/RRM2. Both, RRM1 and RRM2 of CELF-4, can activate
          cardiac troponin T (cTNT) exon 5 inclusion. CELF-5,
          expressed in brain, is also known as bruno-like protein
          5 (BRUNOL-5), or CUG-BP- and ETR-3-like factor 5.
          Although its biological role remains unclear, CELF-5
          shares same domain architecture with CELF-3. CELF-6,
          strongly expressed in kidney, brain, and testis, is
          also known as bruno-like protein 6 (BRUNOL-6), or
          CUG-BP- and ETR-3-like factor 6. It activates exon
          inclusion of a cardiac troponin T minigene in transient
          transfection assays in an muscle-specific splicing
          enhancer (MSE)-dependent manner and can activate
          inclusion via multiple copies of a single element,
          MSE2. CELF-6 also promotes skipping of exon 11 of
          insulin receptor, a known target of CELF activity that
          is expressed in kidney. In addition to three highly
          conserved RRMs, CELF-6 also possesses numerous
          potential phosphorylation sites, a potential nuclear
          localization signal (NLS) at the C terminus, and an
          alanine-rich region within the divergent linker region.
          .
          Length = 79

 Score = 28.7 bits (64), Expect = 0.19
 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 5  FVDIKKQSSASAFAFVQYTDIASVVRAMRAMDGEYVGHNRV 45
          FVD +  + +  F FV + + AS   A++AM+G  +G  R+
Sbjct: 37 FVD-RATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRL 76


>gnl|CDD|240784 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 in
          serine/arginine-rich splicing factor 1 (SRSF1) and
          similar proteins.  This subgroup corresponds to the
          RRM1 in three serine/arginine (SR) proteins:
          serine/arginine-rich splicing factor 1 (SRSF1 or
          ASF-1), serine/arginine-rich splicing factor 9 (SRSF9
          or SRp30C), and plant pre-mRNA-splicing factor SF2
          (SR1). SRSF1 is a shuttling SR protein involved in
          constitutive and alternative splicing,
          nonsense-mediated mRNA decay (NMD), mRNA export and
          translation. It also functions as a splicing-factor
          oncoprotein that regulates apoptosis and proliferation
          to promote mammary epithelial cell transformation.
          SRSF9 has been implicated in the activity of many
          elements that control splice site selection, the
          alternative splicing of the glucocorticoid receptor
          beta in neutrophils and in the gonadotropin-releasing
          hormone pre-mRNA. It can also interact with other
          proteins implicated in alternative splicing, including
          YB-1, rSLM-1, rSLM-2, E4-ORF4, Nop30, and p32. Both,
          SRSF1 and SRSF9, contain two N-terminal RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), and a C-terminal
          RS domains rich in serine-arginine dipeptides. In
          contrast, SF2 contains two N-terminal RRMs and a
          C-terminal PSK domain rich in proline, serine and
          lysine residues.  .
          Length = 72

 Score = 28.5 bits (64), Expect = 0.20
 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 2/44 (4%)

Query: 6  VDIKKQSSASAFAFVQYTDIASVVRAMRAMDG-EYVGHN-RVNL 47
          +D+K +     FAFV++ D      A+R  DG ++ G+  RV  
Sbjct: 29 IDLKNRRRGPPFAFVEFEDPRDAEDAVRGRDGYDFDGYRLRVEF 72


>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in
          serine/arginine-rich splicing factor 3 (SRSF3) and
          similar proteins.  This subfamily corresponds to the
          RRM of two serine/arginine (SR) proteins,
          serine/arginine-rich splicing factor 3 (SRSF3) and
          serine/arginine-rich splicing factor 7 (SRSF7). SRSF3,
          also termed pre-mRNA-splicing factor SRp20, modulates
          alternative splicing by interacting with RNA
          cis-elements in a concentration- and cell
          differentiation-dependent manner. It is also involved
          in termination of transcription, alternative RNA
          polyadenylation, RNA export, and protein translation.
          SRSF3 is critical for cell proliferation, and tumor
          induction and maintenance. It can shuttle between the
          nucleus and cytoplasm. SRSF7, also termed splicing
          factor 9G8, plays a crucial role in both constitutive
          splicing and alternative splicing of many pre-mRNAs.
          Its localization and functions are tightly regulated by
          phosphorylation. SRSF7 is predominantly present in the
          nuclear and can shuttle between nucleus and cytoplasm.
          It cooperates with the export protein, Tap/NXF1, helps
          mRNA export to the cytoplasm, and enhances the
          expression of unspliced mRNA. Moreover, SRSF7 inhibits
          tau E10 inclusion through directly interacting with the
          proximal downstream intron of E10, a clustering region
          for frontotemporal dementia with Parkinsonism (FTDP)
          mutations. Both SRSF3 and SRSF7 contain a single
          N-terminal RNA recognition motif (RRM), also termed RBD
          (RNA binding domain) or RNP (ribonucleoprotein domain),
          and a C-terminal RS domain rich in serine-arginine
          dipeptides. The RRM domain is involved in RNA binding,
          and the RS domain has been implicated in protein
          shuttling and protein-protein interactions. .
          Length = 73

 Score = 28.4 bits (64), Expect = 0.20
 Identities = 13/29 (44%), Positives = 18/29 (62%)

Query: 17 FAFVQYTDIASVVRAMRAMDGEYVGHNRV 45
          FAFV++ D      A+RA+DG  +  NRV
Sbjct: 38 FAFVEFEDPRDAEDAVRALDGRRICGNRV 66


>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast
          negative growth regulatory protein NGR1 (RBP1), yeast
          protein NAM8 and similar proteins.  This subfamily
          corresponds to the RRM3 of NGR1 and NAM8. NGR1, also
          termed RNA-binding protein RBP1, is a putative
          glucose-repressible protein that binds both RNA and
          single-stranded DNA (ssDNA) in yeast. It may function
          in regulating cell growth in early log phase, possibly
          through its participation in RNA metabolism. NGR1
          contains two RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), followed by a glutamine-rich stretch that may
          be involved in transcriptional activity. In addition,
          NGR1 has an asparagine-rich region near the carboxyl
          terminus which also harbors a methionine-rich region.
          The family also includes protein NAM8, which is a
          putative RNA-binding protein that acts as a suppressor
          of mitochondrial splicing deficiencies when
          overexpressed in yeast. It may be a non-essential
          component of the mitochondrial splicing machinery. Like
          NGR1, NAM8 contains two RRMs. .
          Length = 72

 Score = 28.4 bits (64), Expect = 0.22
 Identities = 10/32 (31%), Positives = 19/32 (59%)

Query: 19 FVQYTDIASVVRAMRAMDGEYVGHNRVNLGYG 50
          FVQ+   A+   A++ + G  +G +R+ L +G
Sbjct: 41 FVQFVHRAAAEAAIQQLQGTIIGGSRIRLSWG 72


>gnl|CDD|240968 cd12524, RRM1_MEI2_like, RNA recognition motif 1 in plant
          Mei2-like proteins.  This subgroup corresponds to the
          RRM1 of Mei2-like proteins that represent an ancient
          eukaryotic RNA-binding proteins family. Their
          corresponding Mei2-like genes appear to have arisen
          early in eukaryote evolution, been lost from some
          lineages such as Saccharomyces cerevisiae and
          metazoans, and diversified in the plant lineage. The
          plant Mei2-like genes may function in cell fate
          specification during development, rather than as
          stimulators of meiosis. Members in this family contain
          three RNA recognition motifs (RRMs), also termed RBDs
          (RNA binding domains) or RNPs (ribonucleoprotein
          domains). The C-terminal RRM (RRM3) is unique to
          Mei2-like proteins and it is highly conserved between
          plants and fungi. Up to date, the intracellular
          localization, RNA target(s), cellular interactions and
          phosphorylation states of Mei2-like proteins in plants
          remain unclear. .
          Length = 77

 Score = 28.0 bits (63), Expect = 0.33
 Identities = 15/43 (34%), Positives = 19/43 (44%), Gaps = 4/43 (9%)

Query: 5  FVDIKKQSSAS---AFAFVQYTDIASVVRAMRAMDGEYVGHNR 44
          F DI+   +A     F  V Y DI +  RA RA+ G      R
Sbjct: 25 FGDIRTLYTACKHRGFIMVSYYDIRAARRAKRALQGT-ELGGR 66


>gnl|CDD|240938 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in vertebrate
          heterogeneous nuclear ribonucleoprotein R (hnRNP R).
          This subgroup corresponds to the RRM3 of hnRNP R. a
          ubiquitously expressed nuclear RNA-binding protein that
          specifically bind mRNAs with a preference for poly(U)
          stretches. Upon binding of RNA, hnRNP R forms
          oligomers, most probably dimers. hnRNP R has been
          implicated in mRNA processing and mRNA transport, and
          also acts as a regulator to modify binding to ribosomes
          and RNA translation. hnRNP R is predominantly located
          in axons of motor neurons and to a much lower degree in
          sensory axons. In axons of motor neurons, it also
          functions as a cytosolic protein and interacts with
          wild type of survival motor neuron (SMN) proteins
          directly, further providing a molecular link between
          SMN and the spliceosome. Moreover, hnRNP R plays an
          important role in neural differentiation and
          development, as well as in retinal development and
          light-elicited cellular activities. hnRNP R contains an
          acidic auxiliary N-terminal region, followed by two
          well-defined and one degenerated RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a C-terminal RGG
          motif; hnRNP R binds RNA through its RRM domains. .
          Length = 72

 Score = 27.7 bits (61), Expect = 0.33
 Identities = 10/35 (28%), Positives = 19/35 (54%)

Query: 17 FAFVQYTDIASVVRAMRAMDGEYVGHNRVNLGYGK 51
          +AFV + +  + VRAM  M+G+ +    + +   K
Sbjct: 37 YAFVHFEERDAAVRAMDEMNGKEIEGEEIEIVLAK 71


>gnl|CDD|241134 cd12690, RRM3_PTBPH1_PTBPH2, RNA recognition motif 3 in plant
          polypyrimidine tract-binding protein homolog 1 and 2
          (PTBPH1 and PTBPH2).  This subfamily corresponds to the
          RRM3 of PTBPH1 and PTBPH2. Although their biological
          roles remain unclear, PTBPH1 and PTBPH2 show
          significant sequence similarity to polypyrimidine tract
          binding protein (PTB) that is an important negative
          regulator of alternative splicing in mammalian cells
          and also functions at several other aspects of mRNA
          metabolism, including mRNA localization, stabilization,
          polyadenylation, and translation. Both, PTBPH1 and
          PTBPH2, contain three RNA recognition motifs (RRM),
          also known as RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain). .
          Length = 97

 Score = 28.3 bits (63), Expect = 0.34
 Identities = 11/44 (25%), Positives = 24/44 (54%), Gaps = 3/44 (6%)

Query: 11 QSSASAFAFVQYTDIASVVRAMRAMDGEYV---GHNRVNLGYGK 51
          + +    A +QY D+ + V A  A++G  +   G+ +++L Y +
Sbjct: 37 EKNGGFQALIQYPDVPTAVNAKEALEGHCIYDGGYCKLHLSYSR 80


>gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast
          nucleolar protein 3 (Npl3p) and similar proteins.  This
          subfamily corresponds to the RRM1 of Npl3p, also termed
          mitochondrial targeting suppressor 1 protein, or
          nuclear polyadenylated RNA-binding protein 1. Npl3p is
          a major yeast RNA-binding protein that competes with
          3'-end processing factors, such as Rna15, for binding
          to the nascent RNA, protecting the transcript from
          premature termination and coordinating transcription
          termination and the packaging of the fully processed
          transcript for export. It specifically recognizes a
          class of G/U-rich RNAs. Npl3p is a multi-domain protein
          containing two central RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), separated by a short
          linker and a C-terminal domain rich in glycine,
          arginine and serine residues. .
          Length = 67

 Score = 27.4 bits (61), Expect = 0.48
 Identities = 11/35 (31%), Positives = 22/35 (62%)

Query: 15 SAFAFVQYTDIASVVRAMRAMDGEYVGHNRVNLGY 49
          S FAFV++  + S +RA  ++ G+ + +N + + Y
Sbjct: 33 SNFAFVEFESLESAIRAKDSVHGKVLNNNPLYVTY 67


>gnl|CDD|240836 cd12390, RRM3_RAVER, RNA recognition motif 3 in ribonucleoprotein
          PTB-binding raver-1, raver-2 and similar proteins.
          This subfamily corresponds to the RRM3 of raver-1 and
          raver-2. Raver-1 is a ubiquitously expressed
          heterogeneous nuclear ribonucleoprotein (hnRNP) that
          serves as a co-repressor of the nucleoplasmic splicing
          repressor polypyrimidine tract-binding protein
          (PTB)-directed splicing of select mRNAs. It shuttles
          between the cytoplasm and the nucleus and can
          accumulate in the perinucleolar compartment, a dynamic
          nuclear substructure that harbors PTB. Raver-1 also
          modulates focal adhesion assembly by binding to the
          cytoskeletal proteins, including alpha-actinin,
          vinculin, and metavinculin (an alternatively spliced
          isoform of vinculin) at adhesion complexes,
          particularly in differentiated muscle tissue. Raver-2
          is a novel member of the heterogeneous nuclear
          ribonucleoprotein (hnRNP) family. It shows high
          sequence homology to raver-1. Raver-2 exerts a
          spatio-temporal expression pattern during embryogenesis
          and is mainly limited to differentiated neurons and
          glia cells. Although it displays nucleo-cytoplasmic
          shuttling in heterokaryons, raver2 localizes to the
          nucleus in glia cells and neurons. Raver-2 can interact
          with PTB and may participate in PTB-mediated
          RNA-processing. However, there is no evidence
          indicating that raver-2 can bind to cytoplasmic
          proteins. Both, raver-1 and raver-2, contain three
          N-terminal RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), two putative nuclear localization signals
          (NLS) at the N- and C-termini, a central leucine-rich
          region, and a C-terminal region harboring two
          [SG][IL]LGxxP motifs. They binds to RNA through the
          RRMs. In addition, the two [SG][IL]LGxxP motifs serve
          as the PTB-binding motifs in raver1. However, raver-2
          interacts with PTB through the SLLGEPP motif only. .
          Length = 92

 Score = 27.6 bits (62), Expect = 0.49
 Identities = 9/34 (26%), Positives = 18/34 (52%)

Query: 17 FAFVQYTDIASVVRAMRAMDGEYVGHNRVNLGYG 50
          FAFV+Y        A +A++G  +  + + + +G
Sbjct: 46 FAFVEYATAEDAEEAQQALNGHSLQGSPIRVSFG 79


>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in
          serine/arginine-rich splicing factor SRSF2, SRSF8 and
          similar proteins.  This subfamily corresponds to the
          RRM of SRSF2 and SRSF8. SRSF2, also termed protein
          PR264, or splicing component, 35 kDa (splicing factor
          SC35 or SC-35), is a prototypical SR protein that plays
          important roles in the alternative splicing of
          pre-mRNA. It is also involved in transcription
          elongation by directly or indirectly mediating the
          recruitment of elongation factors to the C-terminal
          domain of polymerase II. SRSF2 is exclusively localized
          in the nucleus and is restricted to nuclear processes.
          It contains a single N-terminal RNA recognition motif
          (RRM), also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), followed by a C-terminal RS
          domain rich in serine-arginine dipeptides. The RRM is
          responsible for the specific recognition of 5'-SSNG-3'
          (S=C/G) RNA. In the regulation of alternative splicing
          events, it specifically binds to cis-regulatory
          elements on the pre-mRNA. The RS domain modulates SRSF2
          activity through phosphorylation, directly contacts
          RNA, and promotes protein-protein interactions with the
          spliceosome. SRSF8, also termed SRP46 or SFRS2B, is a
          novel mammalian SR splicing factor encoded by a
          PR264/SC35 functional retropseudogene. SRSF8 is
          localized in the nucleus and does not display the same
          activity as PR264/SC35. It functions as an essential
          splicing factor in complementing a HeLa cell S100
          extract deficient in SR proteins. Like SRSF2, SRSF8
          contains a single N-terminal RRM and a C-terminal RS
          domain. .
          Length = 73

 Score = 27.3 bits (61), Expect = 0.54
 Identities = 11/21 (52%), Positives = 13/21 (61%)

Query: 17 FAFVQYTDIASVVRAMRAMDG 37
          FAFV++ D      AM AMDG
Sbjct: 42 FAFVRFYDKRDAEDAMDAMDG 62


>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding
          protein 19 (RBM19 or RBD-1) and similar proteins.  This
          subfamily corresponds to the RRM5 of RBM19 and RRM4 of
          MRD1. RBM19, also termed RNA-binding domain-1 (RBD-1),
          is a nucleolar protein conserved in eukaryotes involved
          in ribosome biogenesis by processing rRNA and is
          essential for preimplantation development. It has a
          unique domain organization containing 6 conserved RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains). .
          Length = 82

 Score = 27.2 bits (61), Expect = 0.59
 Identities = 6/27 (22%), Positives = 15/27 (55%), Gaps = 1/27 (3%)

Query: 17 FAFVQYTDIASVVRAMRAMDGEYV-GH 42
          + FV++    +  +A++ + G  + GH
Sbjct: 49 YGFVEFKSKEAAQKALKRLQGTVLDGH 75


>gnl|CDD|240920 cd12476, RRM1_SNF, RNA recognition motif 1 found in Drosophila
          melanogaster sex determination protein SNF and similar
          proteins.  This subgroup corresponds to the RRM1 of SNF
          (Sans fille), also termed U1 small nuclear
          ribonucleoprotein A (U1 snRNP A or U1-A or U1A), an
          RNA-binding protein found in the U1 and U2 snRNPs of
          Drosophila. It is essential in Drosophila sex
          determination and possesses a novel dual RNA binding
          specificity. SNF binds with high affinity to both
          Drosophila U1 snRNA stem-loop II (SLII) and U2 snRNA
          stem-loop IV (SLIV). It can also bind to poly(U) RNA
          tracts flanking the alternatively spliced Sex-lethal
          (Sxl) exon, as does Drosophila Sex-lethal protein
          (SXL). SNF contains two RNA recognition motifs (RRMs);
          it can self-associate through RRM1, and each RRM can
          recognize poly(U) RNA binding independently. .
          Length = 78

 Score = 27.2 bits (60), Expect = 0.60
 Identities = 10/20 (50%), Positives = 14/20 (70%)

Query: 18 AFVQYTDIASVVRAMRAMDG 37
          AFV + DI+S   A+R+M G
Sbjct: 45 AFVVFKDISSATNALRSMQG 64


>gnl|CDD|240693 cd12247, RRM2_U1A_like, RNA recognition motif 2 in the
          U1A/U2B"/SNF protein family.  This subfamily
          corresponds to the RRM2 of U1A/U2B"/SNF protein family,
          containing Drosophila sex determination protein SNF and
          its two mammalian counterparts, U1 small nuclear
          ribonucleoprotein A (U1 snRNP A or U1-A or U1A) and U2
          small nuclear ribonucleoprotein B" (U2 snRNP B" or
          U2B"), all of which consist of two RNA recognition
          motifs (RRMs) connected by a variable, flexible linker.
          SNF is an RNA-binding protein found in the U1 and U2
          snRNPs of Drosophila where it is essential in sex
          determination and possesses a novel dual RNA binding
          specificity. SNF binds with high affinity to both
          Drosophila U1 snRNA stem-loop II (SLII) and U2 snRNA
          stem-loop IV (SLIV). It can also bind to poly(U) RNA
          tracts flanking the alternatively spliced Sex-lethal
          (Sxl) exon, as does Drosophila Sex-lethal protein
          (SXL). U1A is an RNA-binding protein associated with
          the U1 snRNP, a small RNA-protein complex involved in
          pre-mRNA splicing. U1A binds with high affinity and
          specificity to stem-loop II (SLII) of U1 snRNA. It is
          predominantly a nuclear protein that shuttles between
          the nucleus and the cytoplasm independently of
          interactions with U1 snRNA. Moreover, U1A may be
          involved in RNA 3'-end processing, specifically
          cleavage, splicing and polyadenylation, through
          interacting with a large number of non-snRNP proteins.
          U2B", initially identified to bind to stem-loop IV
          (SLIV) at the 3' end of U2 snRNA, is a unique protein
          that comprises of the U2 snRNP. Additional research
          indicates U2B" binds to U1 snRNA stem-loop II (SLII) as
          well and shows no preference for SLIV or SLII on the
          basis of binding affinity. U2B" does not require an
          auxiliary protein for binding to RNA and its nuclear
          transport is independent on U2 snRNA binding. .
          Length = 72

 Score = 26.8 bits (60), Expect = 0.84
 Identities = 8/29 (27%), Positives = 14/29 (48%), Gaps = 2/29 (6%)

Query: 17 FAFVQYTDIASVVRAMRAMDGEYV--GHN 43
           AFV++        A++A+ G  +  GH 
Sbjct: 40 IAFVEFETEEQATVALQALQGFKITPGHA 68


>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit,
           splicing factor.  These splicing factors consist of an
           N-terminal arginine-rich low complexity domain followed
           by three tandem RNA recognition motifs (pfam00076). The
           well-characterized members of this family are auxilliary
           components of the U2 small nuclear ribonuclearprotein
           splicing factor (U2AF). These proteins are closely
           related to the CC1-like subfamily of splicing factors
           (TIGR01622). Members of this subfamily are found in
           plants, metazoa and fungi.
          Length = 509

 Score = 27.9 bits (62), Expect = 0.85
 Identities = 9/31 (29%), Positives = 15/31 (48%)

Query: 19  FVQYTDIASVVRAMRAMDGEYVGHNRVNLGY 49
           F++Y D+ S  +AM  M+G       V   +
Sbjct: 468 FLEYADVRSAEKAMEGMNGRKFNDRVVVAAF 498


>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif. (a.k.a. RRM, RBD, or RNP
          domain).  The RRM motif is probably diagnostic of an
          RNA binding protein. RRMs are found in a variety of RNA
          binding proteins, including various hnRNP proteins,
          proteins implicated in regulation of alternative
          splicing, and protein components of snRNPs. The motif
          also appears in a few single stranded DNA binding
          proteins.
          Length = 56

 Score = 26.3 bits (59), Expect = 0.90
 Identities = 10/44 (22%), Positives = 21/44 (47%)

Query: 6  VDIKKQSSASAFAFVQYTDIASVVRAMRAMDGEYVGHNRVNLGY 49
            IK       FAFV+++   +  +A++ ++G   G   + + Y
Sbjct: 12 EKIKLLKKKPGFAFVEFSTEEAAEKAVQYLNGVLFGGRPLRVDY 55


>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding
          protein 7 (RBM7) and similar proteins.  This subfamily
          corresponds to the RRM of RBM7, RBM11 and their
          eukaryotic homologous. RBM7 is an ubiquitously
          expressed pre-mRNA splicing factor that enhances
          messenger RNA (mRNA) splicing in a cell-specific manner
          or in a certain developmental process, such as
          spermatogenesis. It interacts with splicing factors
          SAP145 (the spliceosomal splicing factor 3b subunit 2)
          and SRp20, and may play a more specific role in meiosis
          entry and progression. Together with additional
          testis-specific RNA-binding proteins, RBM7 may regulate
          the splicing of specific pre-mRNA species that are
          important in the meiotic cell cycle. RBM11 is a novel
          tissue-specific splicing regulator that is selectively
          expressed in brain, cerebellum and testis, and to a
          lower extent in kidney. It is localized in the
          nucleoplasm and enriched in SRSF2-containing splicing
          speckles. It may play a role in the modulation of
          alternative splicing during neuron and germ cell
          differentiation. Both, RBM7 and RBM11, contain an
          N-terminal RNA recognition motif (RRM), also termed RBD
          (RNA binding domain) or RNP (ribonucleoprotein domain),
          and a region lacking known homology at the C-terminus.
          The RRM is responsible for RNA binding, whereas the
          C-terminal region permits nuclear localization and
          homodimerization. .
          Length = 75

 Score = 26.5 bits (59), Expect = 0.91
 Identities = 8/21 (38%), Positives = 13/21 (61%)

Query: 17 FAFVQYTDIASVVRAMRAMDG 37
          FAFV +    SV  A++ ++G
Sbjct: 44 FAFVTFKHEVSVPYAIQLLNG 64


>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate
          RNA-binding protein RBM23, RBM39 and similar proteins. 
          This subfamily corresponds to the RRM2 of RBM39 (also
          termed HCC1), a nuclear autoantigen that contains an
          N-terminal arginine/serine rich (RS) motif and three
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          An octapeptide sequence called the RS-ERK motif is
          repeated six times in the RS region of RBM39. Although
          the cellular function of RBM23 remains unclear, it
          shows high sequence homology to RBM39 and contains two
          RRMs. It may possibly function as a pre-mRNA splicing
          factor. .
          Length = 73

 Score = 26.5 bits (59), Expect = 0.96
 Identities = 7/36 (19%), Positives = 17/36 (47%), Gaps = 3/36 (8%)

Query: 5  FVDIKKQSSASA---FAFVQYTDIASVVRAMRAMDG 37
          FV +++         + F+Q+ D     +A+  ++G
Sbjct: 27 FVQLQRDPETGRSKGYGFIQFADAEDAKKALEQLNG 62


>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila
          sex-lethal (SXL) and similar proteins.  This subfamily
          corresponds to the RRM1 of SXL which governs sexual
          differentiation and X chromosome dosage compensation in
          Drosophila melanogaster. It induces female-specific
          alternative splicing of the transformer (tra) pre-mRNA
          by binding to the tra uridine-rich polypyrimidine tract
          at the non-sex-specific 3' splice site during the
          sex-determination process. SXL binds also to its own
          pre-mRNA and promotes female-specific alternative
          splicing. SXL contains an N-terminal Gly/Asn-rich
          domain that may be responsible for the protein-protein
          interaction, and tandem RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), that show high preference
          to bind single-stranded, uridine-rich target RNA
          transcripts. .
          Length = 81

 Score = 26.6 bits (59), Expect = 0.96
 Identities = 10/36 (27%), Positives = 18/36 (50%)

Query: 17 FAFVQYTDIASVVRAMRAMDGEYVGHNRVNLGYGKS 52
          F FV Y       RA+R ++G  + + R+ + Y + 
Sbjct: 44 FGFVDYQSAEDAQRAIRTLNGLQLQNKRIKVAYARP 79


>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in
          heterogeneous nuclear ribonucleoprotein R (hnRNP R) and
          similar proteins.  This subfamily corresponds to the
          RRM3 in hnRNP R, hnRNP Q, and APOBEC-1 complementation
          factor (ACF). hnRNP R is a ubiquitously expressed
          nuclear RNA-binding protein that specifically bind
          mRNAs with a preference for poly(U) stretches and has
          been implicated in mRNA processing and mRNA transport,
          and also acts as a regulator to modify binding to
          ribosomes and RNA translation. hnRNP Q is also a
          ubiquitously expressed nuclear RNA-binding protein. It
          has been identified as a component of the spliceosome
          complex, as well as a component of the apobec-1
          editosome, and has been implicated in the regulation of
          specific mRNA transport. ACF is an RNA-binding subunit
          of a core complex that interacts with apoB mRNA to
          facilitate C to U RNA editing. It may also act as an
          apoB mRNA recognition factor and chaperone and play a
          key role in cell growth and differentiation. This
          family also includes two functionally unknown
          RNA-binding proteins, RBM46 and RBM47. All members
          contain three conserved RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains).
          Length = 72

 Score = 26.4 bits (59), Expect = 1.2
 Identities = 8/24 (33%), Positives = 15/24 (62%)

Query: 17 FAFVQYTDIASVVRAMRAMDGEYV 40
          +AFV + +    V+AM  M+G+ +
Sbjct: 37 YAFVHFEERDDAVKAMEEMNGKEL 60


>gnl|CDD|182944 PRK11070, PRK11070, ssDNA exonuclease RecJ; Provisional.
          Length = 575

 Score = 27.3 bits (61), Expect = 1.4
 Identities = 12/33 (36%), Positives = 16/33 (48%), Gaps = 3/33 (9%)

Query: 23  TDIASVVRAMRAMDGEYVGH---NRVNLGYGKS 52
           T  A  V A+R++    V +   NR   GYG S
Sbjct: 84  TSTALSVLALRSLGCSNVDYLVPNRFEDGYGLS 116


>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding
          protein 28 (RBM28) and similar proteins.  This
          subfamily corresponds to the RRM2 of RBM28 and Nop4p.
          RBM28 is a specific nucleolar component of the
          spliceosomal small nuclear ribonucleoproteins (snRNPs),
          possibly coordinating their transition through the
          nucleolus. It specifically associates with U1, U2, U4,
          U5, and U6 small nuclear RNAs (snRNAs), and may play a
          role in the maturation of both small nuclear and
          ribosomal RNAs. RBM28 has four RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and an extremely acidic
          region between RRM2 and RRM3. The family also includes
          nucleolar protein 4 (Nop4p or Nop77p) encoded by
          YPL043W from Saccharomyces cerevisiae. It is an
          essential nucleolar protein involved in processing and
          maturation of 27S pre-rRNA and biogenesis of 60S
          ribosomal subunits. Nop4p also contains four RRMs.  .
          Length = 76

 Score = 26.1 bits (58), Expect = 1.4
 Identities = 9/21 (42%), Positives = 15/21 (71%)

Query: 17 FAFVQYTDIASVVRAMRAMDG 37
          FAFVQ+T  A   +A++ ++G
Sbjct: 42 FAFVQFTSKADAEKAIKGVNG 62


>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in
          CELF/Bruno-like family of RNA binding proteins and
          plant flowering time control protein FCA.  This
          subfamily corresponds to the RRM1 and RRM2 domains of
          the CUGBP1 and ETR-3-like factors (CELF) as well as
          plant flowering time control protein FCA. CELF, also
          termed BRUNOL (Bruno-like) proteins, is a family of
          structurally related RNA-binding proteins involved in
          regulation of pre-mRNA splicing in the nucleus, and
          control of mRNA translation and deadenylation in the
          cytoplasm. The family contains six members: CELF-1
          (also known as BRUNOL-2, CUG-BP1, NAPOR, EDEN-BP),
          CELF-2 (also known as BRUNOL-3, ETR-3, CUG-BP2,
          NAPOR-2), CELF-3 (also known as BRUNOL-1, TNRC4, ETR-1,
          CAGH4, ER DA4), CELF-4 (BRUNOL-4), CELF-5 (BRUNOL-5)
          and CELF-6 (BRUNOL-6). They all contain three highly
          conserved RNA recognition motifs (RRMs), also known as
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains): two consecutive RRMs (RRM1 and RRM2) situated
          in the N-terminal region followed by a linker region
          and the third RRM (RRM3) close to the C-terminus of the
          protein. The low sequence conservation of the linker
          region is highly suggestive of a large variety in the
          co-factors that associate with the various CELF family
          members. Based on both, sequence similarity and
          function, the CELF family can be divided into two
          subfamilies, the first containing CELFs 1 and 2, and
          the second containing CELFs 3, 4, 5, and 6. The
          different CELF proteins may act through different sites
          on at least some substrates. Furthermore, CELF proteins
          may interact with each other in varying combinations to
          influence alternative splicing in different contexts.
          This subfamily also includes plant flowering time
          control protein FCA that functions in the
          posttranscriptional regulation of transcripts involved
          in the flowering process. FCA contains two RRMs, and a
          WW protein interaction domain.  .
          Length = 77

 Score = 26.0 bits (58), Expect = 1.4
 Identities = 6/26 (23%), Positives = 13/26 (50%)

Query: 18 AFVQYTDIASVVRAMRAMDGEYVGHN 43
          AFV+++      +A+ A+ G+     
Sbjct: 44 AFVKFSSREEAQKAIEALHGKVTMPG 69


>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in
          granule-associated RNA binding proteins p40-TIA-1 and
          TIAR.  This subfamily corresponds to the RRM1 of
          nucleolysin TIA-1 isoform p40 (p40-TIA-1 or TIA-1) and
          nucleolysin TIA-1-related protein (TIAR), both of which
          are granule-associated RNA binding proteins involved in
          inducing apoptosis in cytotoxic lymphocyte (CTL) target
          cells. TIA-1 and TIAR share high sequence similarity.
          They are expressed in a wide variety of cell types.
          TIA-1 can be phosphorylated by a serine/threonine
          kinase that is activated during Fas-mediated
          apoptosis.TIAR is mainly localized in the nucleus of
          hematopoietic and nonhematopoietic cells. It is
          translocated from the nucleus to the cytoplasm in
          response to exogenous triggers of apoptosis. Both,
          TIA-1 and TIAR, bind specifically to poly(A) but not to
          poly(C) homopolymers. They are composed of three
          N-terminal highly homologous RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a glutamine-rich
          C-terminal auxiliary domain containing a
          lysosome-targeting motif. TIA-1 and TIAR interact with
          RNAs containing short stretches of uridylates and their
          RRM2 can mediate the specific binding to uridylate-rich
          RNAs. The C-terminal auxiliary domain may be
          responsible for interacting with other proteins. In
          addition, TIA-1 and TIAR share a potential serine
          protease-cleavage site (Phe-Val-Arg) localized at the
          junction between their RNA binding domains and their
          C-terminal auxiliary domains.
          Length = 72

 Score = 26.1 bits (58), Expect = 1.5
 Identities = 11/39 (28%), Positives = 20/39 (51%), Gaps = 2/39 (5%)

Query: 10 KQSSASAFAFVQYTDIASVVRAMRAMDGEYVGHN--RVN 46
          ++     +AFV+Y D  S   A++ M+G  +     +VN
Sbjct: 32 REHGNDPYAFVEYYDHRSAAAALQTMNGRLILGQEIKVN 70


>gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor
          3B subunit 4 (SF3B4) and similar proteins.  This
          subfamily corresponds to the RRM2 of SF3B4, also termed
          pre-mRNA-splicing factor SF3b 49 kDa (SF3b50), or
          spliceosome-associated protein 49 (SAP 49). SF3B4 is a
          component of the multiprotein complex splicing factor
          3b (SF3B), an integral part of the U2 small nuclear
          ribonucleoprotein (snRNP) and the U11/U12 di-snRNP.
          SF3B is essential for the accurate excision of introns
          from pre-messenger RNA, and is involved in the
          recognition of the pre-mRNA's branch site within the
          major and minor spliceosomes. SF3B4 functions to tether
          U2 snRNP with pre-mRNA at the branch site during
          spliceosome assembly. It is an evolutionarily highly
          conserved protein with orthologs across diverse
          species. SF3B4 contains two closely adjacent N-terminal
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          It binds directly to pre-mRNA and also interacts
          directly and highly specifically with another SF3B
          subunit called SAP 145. .
          Length = 83

 Score = 26.1 bits (58), Expect = 1.8
 Identities = 10/33 (30%), Positives = 19/33 (57%)

Query: 17 FAFVQYTDIASVVRAMRAMDGEYVGHNRVNLGY 49
          FAF+ Y    +   A+ AM+G+Y+ +  + + Y
Sbjct: 46 FAFISYDSFEASDAAIEAMNGQYLCNRPITVSY 78


>gnl|CDD|240708 cd12262, RRM2_4_MRN1, RNA recognition motif 2 and 4 in
          RNA-binding protein MRN1 and similar proteins.  This
          subgroup corresponds to the RRM2 and RRM4 of MRN1, also
          termed multicopy suppressor of RSC-NHP6 synthetic
          lethality protein 1, or post-transcriptional regulator
          of 69 kDa, and is an RNA-binding protein found in
          yeast. Although its specific biological role remains
          unclear, MRN1 might be involved in translational
          regulation. Members in this family contain four copies
          of conserved RNA recognition motif (RRM), also known as
          RBD (RNA binding domain) or RNP (ribonucleoprotein
          domain). .
          Length = 82

 Score = 26.0 bits (57), Expect = 1.9
 Identities = 10/36 (27%), Positives = 21/36 (58%)

Query: 16 AFAFVQYTDIASVVRAMRAMDGEYVGHNRVNLGYGK 51
          A AF+ + +I + + A++ ++G+      V + YGK
Sbjct: 44 ACAFINFMNIPNAIAALQTLNGKKPYDTIVRINYGK 79


>gnl|CDD|236047 PRK07560, PRK07560, elongation factor EF-2; Reviewed.
          Length = 731

 Score = 26.7 bits (60), Expect = 1.9
 Identities = 9/13 (69%), Positives = 10/13 (76%)

Query: 28  VVRAMRAMDGEYV 40
           V RAMRA+DG  V
Sbjct: 104 VTRAMRAVDGAIV 116


>gnl|CDD|237307 PRK13209, PRK13209, L-xylulose 5-phosphate 3-epimerase; Reviewed.
          Length = 283

 Score = 26.5 bits (59), Expect = 2.0
 Identities = 15/50 (30%), Positives = 20/50 (40%), Gaps = 7/50 (14%)

Query: 4   YFVDIKKQSSASAFAFVQYTDIASVVRAMRAMDGEYVGHNRVNLGYGKSL 53
            F+D  K+S       V+    ASV  A   MD  ++      LGY   L
Sbjct: 135 RFIDGLKES-------VELASRASVTLAFEIMDTPFMNSISKALGYAHYL 177


>gnl|CDD|240913 cd12467, RRM_Srp1p_like, RNA recognition motif 1 in fission yeast
          pre-mRNA-splicing factor Srp1p and similar proteins.
          This subgroup corresponds to the RRM domain in Srp1p
          encoded by gene srp1 from fission yeast
          Schizosaccharomyces pombe. It plays a role in the
          pre-mRNA splicing process, but not essential for
          growth. Srp1p is closely related to the SR protein
          family found in metazoa. It contains an N-terminal RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain), a glycine
          hinge and a RS domain in the middle, and a C-terminal
          domain. Some family members also contain another RRM
          domain.
          Length = 78

 Score = 25.9 bits (57), Expect = 2.1
 Identities = 8/28 (28%), Positives = 11/28 (39%)

Query: 10 KQSSASAFAFVQYTDIASVVRAMRAMDG 37
          +   +  FAFV+Y        A   M G
Sbjct: 35 RTFQSRPFAFVEYESHRDAEDAYEEMHG 62


>gnl|CDD|240814 cd12368, RRM3_RBM45, RNA recognition motif 3 in RNA-binding
          protein 45 (RBM45) and similar proteins.  This
          subfamily corresponds to the RRM3 of RBM45, also termed
          developmentally-regulated RNA-binding protein 1 (DRB1),
          a new member of RNA recognition motif (RRM)-type neural
          RNA-binding proteins, which expresses under
          spatiotemporal control. It is encoded by gene drb1 that
          is expressed in neurons, not in glial cells. RBM45
          predominantly localizes in cytoplasm of cultured cells
          and specifically binds to poly(C) RNA. It could play an
          important role during neurogenesis. RBM45 carries four
          RRMs, also known as RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). .
          Length = 75

 Score = 25.7 bits (57), Expect = 2.2
 Identities = 15/46 (32%), Positives = 26/46 (56%), Gaps = 4/46 (8%)

Query: 3  MYFVDIKK--QSSAS-AFAFVQYTDIASVVRAMRAMDG-EYVGHNR 44
          + + D+K+   +  S  FA+V Y++ AS + A   ++G EY   NR
Sbjct: 26 LEYCDLKRDPYTGKSKGFAYVTYSNPASAIYAKEKLNGFEYPPGNR 71


>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible
          RNA binding protein (CIRBP), RNA binding motif protein
          3 (RBM3) and similar proteins.  This subfamily
          corresponds to the RRM domain of two structurally
          related heterogenous nuclear ribonucleoproteins, CIRBP
          (also termed CIRP or A18 hnRNP) and RBM3 (also termed
          RNPL), both of which belong to a highly conserved cold
          shock proteins family. The cold shock proteins can be
          induced after exposure to a moderate cold-shock and
          other cellular stresses such as UV radiation and
          hypoxia. CIRBP and RBM3 may function in
          posttranscriptional regulation of gene expression by
          binding to different transcripts, thus allowing the
          cell to response rapidly to environmental signals.
          However, the kinetics and degree of cold induction are
          different between CIRBP and RBM3. Tissue distribution
          of their expression is different. CIRBP and RBM3 may be
          differentially regulated under physiological and stress
          conditions and may play distinct roles in cold
          responses of cells. CIRBP, also termed glycine-rich
          RNA-binding protein CIRP, is localized in the nucleus
          and mediates the cold-induced suppression of cell cycle
          progression. CIRBP also binds DNA and possibly serves
          as a chaperone that assists in the folding/unfolding,
          assembly/disassembly and transport of various proteins.
          RBM3 may enhance global protein synthesis and the
          formation of active polysomes while reducing the levels
          of ribonucleoprotein complexes containing microRNAs.
          RBM3 may also serve to prevent the loss of muscle mass
          by its ability to decrease cell death. Furthermore,
          RBM3 may be essential for cell proliferation and
          mitosis. Both, CIRBP and RBM3, contain an N-terminal
          RNA recognition motif (RRM), also termed RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain), that
          is involved in RNA binding, and C-terminal glycine-rich
          domain (RGG motif) that probably enhances RNA-binding
          via protein-protein and/or protein-RNA interactions.
          Like CIRBP, RBM3 can also bind to both RNA and DNA via
          its RRM domain. .
          Length = 80

 Score = 25.6 bits (56), Expect = 2.5
 Identities = 9/24 (37%), Positives = 13/24 (54%)

Query: 17 FAFVQYTDIASVVRAMRAMDGEYV 40
          F FV + +      AM AM+G+ V
Sbjct: 44 FGFVTFENPDDAKDAMMAMNGKSV 67


>gnl|CDD|240865 cd12419, RRM_Ssp2_like, RNA recognition motif in yeast
          sporulation-specific protein 2 (Ssp2) and similar
          protein.  This subfamily corresponds to the RRM of the
          lineage specific yeast sporulation-specific protein 2
          (Ssp2) and similar proteins. Ssp2 is encoded by a
          sporulation-specific gene necessary for outer spore
          wall assembly in the yeast Saccharomyces cerevisiae. It
          localizes to the spore wall and may play an important
          role after meiosis II and during spore wall formation.
          Ssp2 contains one RNA recognition motif (RRM), also
          termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain). .
          Length = 80

 Score = 25.4 bits (56), Expect = 2.6
 Identities = 12/56 (21%), Positives = 22/56 (39%), Gaps = 5/56 (8%)

Query: 6  VDIKKQSSASAFAFVQYTDIASVVRAMRAMDGE----YVGHNRVN-LGYGKSLATT 56
          VDI    S      + + DI S +RA   ++ +       + +   + YGK +   
Sbjct: 22 VDISPIISRKLCVSIFFADIRSAIRAKETLEDKGSSLNNKYIKQWSIWYGKDITDK 77


>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1,
           2, 3, 4 family.  These eukaryotic proteins recognize the
           poly-A of mRNA and consists of four tandem RNA
           recognition domains at the N-terminus (rrm: pfam00076)
           followed by a PABP-specific domain (pfam00658) at the
           C-terminus. The protein is involved in the transport of
           mRNA's from the nucleus to the cytoplasm. There are four
           paralogs in Homo sapiens which are expressed in testis
           (GP:11610605_PABP3 ), platelets (SP:Q13310_PABP4 ),
           broadly expressed (SP:P11940_PABP1) and of unknown
           tissue range (SP:Q15097_PABP2).
          Length = 562

 Score = 26.7 bits (59), Expect = 2.6
 Identities = 8/25 (32%), Positives = 14/25 (56%)

Query: 17  FAFVQYTDIASVVRAMRAMDGEYVG 41
           FAFV +       +A+  M+G+ +G
Sbjct: 221 FAFVNFEKHEDAAKAVEEMNGKKIG 245


>gnl|CDD|240679 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition motif found in
          fission yeast pre-mRNA-splicing factor Srp1p,
          Arabidopsis thaliana arginine/serine-rich-splicing
          factor RSp31 and similar proteins.  This subfamily
          corresponds to the RRM of Srp1p and RRM2 of plant SR
          splicing factors. Srp1p is encoded by gene srp1 from
          fission yeast Schizosaccharomyces pombe. It plays a
          role in the pre-mRNA splicing process, but is not
          essential for growth. Srp1p is closely related to the
          SR protein family found in Metazoa. It contains an
          N-terminal RNA recognition motif (RRM), also termed RBD
          (RNA binding domain) or RNP (ribonucleoprotein domain),
          a glycine hinge and a RS domain in the middle, and a
          C-terminal domain. The family also includes a novel
          group of arginine/serine (RS) or serine/arginine (SR)
          splicing factors existing in plants, such as A.
          thaliana RSp31, RSp35, RSp41 and similar proteins. Like
          vertebrate RS splicing factors, these proteins function
          as plant splicing factors and play crucial roles in
          constitutive and alternative splicing in plants. They
          all contain two RRMs at their N-terminus and an RS
          domain at their C-terminus.
          Length = 70

 Score = 25.5 bits (56), Expect = 2.7
 Identities = 12/46 (26%), Positives = 23/46 (50%), Gaps = 5/46 (10%)

Query: 6  VDIKKQSSASAFAFVQYTDIASVVRAMRAMDGEYVGHNRVNLGYGK 51
           DI+K      FAFV++ D     +A+ A+ G  +  + + + + K
Sbjct: 30 CDIRKT-----FAFVEFEDSEDATKALEALHGSRIDGSVLTVEFVK 70


>gnl|CDD|163659 cd07416, MPP_PP2B, PP2B, metallophosphatase domain.  PP2B
           (calcineurin) is a unique serine/threonine protein
           phosphatase in its regulation by a second messenger
           (calcium and calmodulin).  PP2B is involved in many
           biological processes including immune responses, the
           second messenger cAMP pathway, sodium/potassium ion
           transport in the nephron, cell cycle progression in
           lower eukaryotes, cardiac hypertrophy, and memory
           formation.  PP2B is highly conserved from yeast to
           humans, but is absent from plants.  PP2B is a
           heterodimer consisting of a catalytic subunit (CnA) and
           a regulatory subunit (CnB); CnB  contains four Ca2+
           binding motifs referred to as EF hands.  The PPP
           (phosphoprotein phosphatase) family, to which PP2B
           belongs, is one of two known protein phosphatase
           families specific for serine and threonine.  The PPP
           family also includes: PP1, PP2A, PP4, PP5, PP6, PP7,
           Bsu1, RdgC, PrpE, PrpA/PrpB, and ApA4 hydrolase. The PPP
           catalytic domain is defined by three conserved motifs
           (-GDXHG-, -GDXVDRG- and -GNHE-).  The PPP enzyme family
           is ancient with members found in all eukaryotes, and in
           most bacterial and archeal genomes.  Dephosphorylation
           of phosphoserines and phosphothreonines on target
           proteins plays a central role in the regulation of many
           cellular processes.  PPPs belong to the
           metallophosphatase (MPP) superfamily.  MPPs are
           functionally diverse, but all share a conserved domain
           with an active site consisting of two metal ions
           (usually manganese, iron, or zinc) coordinated with
           octahedral geometry by a cage of histidine, aspartate,
           and asparagine residues. The MPP superfamily includes:
           Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat
           debranching enzymes, YfcE-like phosphodiesterases,
           purple acid phosphatases (PAPs), YbbF-like
           UDP-2,3-diacylglucosamine hydrolases, and acid
           sphingomyelinases (ASMases).  The conserved domain is a
           double beta-sheet sandwich with a di-metal active site
           made up of residues located at the C-terminal side of
           the sheets.  This domain is thought to allow for
           productive metal coordination.
          Length = 305

 Score = 26.5 bits (59), Expect = 2.8
 Identities = 9/28 (32%), Positives = 15/28 (53%)

Query: 12  SSASAFAFVQYTDIASVVRAMRAMDGEY 39
           S  +   F+Q  ++ S++RA  A D  Y
Sbjct: 221 SYRAVCEFLQKNNLLSIIRAHEAQDAGY 248


>gnl|CDD|233507 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonucleoprotein R, Q
           family.  Sequences in this subfamily include the human
           heterogeneous nuclear ribonucleoproteins (hnRNP) R , Q
           and APOBEC-1 complementation factor (aka APOBEC-1
           stimulating protein). These proteins contain three RNA
           recognition domains (rrm: pfam00076) and a somewhat
           variable C-terminal domain.
          Length = 578

 Score = 26.5 bits (58), Expect = 2.8
 Identities = 8/21 (38%), Positives = 13/21 (61%)

Query: 17  FAFVQYTDIASVVRAMRAMDG 37
           +AFV + D    V+AM  ++G
Sbjct: 271 YAFVHFEDREDAVKAMDELNG 291


>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein
          with serine-rich domain 1 (RNPS1) and similar proteins.
           This subfamily corresponds to the RRM of RNPS1 and its
          eukaryotic homologs. RNPS1, also termed RNA-binding
          protein prevalent during the S phase, or SR-related
          protein LDC2, was originally characterized as a general
          pre-mRNA splicing activator, which activates both
          constitutive and alternative splicing of pre-mRNA in
          vitro.It has been identified as a protein component of
          the splicing-dependent mRNP complex, or exon-exon
          junction complex (EJC), and is directly involved in
          mRNA surveillance. Furthermore, RNPS1 is a splicing
          regulator whose activator function is controlled in
          part by CK2 (casein kinase II) protein kinase
          phosphorylation. It can also function as a
          squamous-cell carcinoma antigen recognized by T cells-3
          (SART3)-binding protein, and is involved in the
          regulation of mRNA splicing. RNPS1 contains an
          N-terminal serine-rich (S) domain, a central RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain), and the
          C-terminal arginine/serine/proline-rich (RS/P) domain.
          .
          Length = 73

 Score = 25.2 bits (56), Expect = 3.0
 Identities = 6/24 (25%), Positives = 14/24 (58%)

Query: 17 FAFVQYTDIASVVRAMRAMDGEYV 40
          +A+V++       +A++ MDG  +
Sbjct: 42 YAYVEFESPEDAEKAIKHMDGGQI 65


>gnl|CDD|241058 cd12614, RRM1_PUB1, RNA recognition motif 1 in yeast nuclear and
          cytoplasmic polyadenylated RNA-binding protein PUB1 and
          similar proteins.  This subgroup corresponds to the
          RRM1 of yeast protein PUB1, also termed ARS
          consensus-binding protein ACBP-60, or poly
          uridylate-binding protein, or poly(U)-binding protein.
          PUB1 has been identified as both, a heterogeneous
          nuclear RNA-binding protein (hnRNP) and a cytoplasmic
          mRNA-binding protein (mRNP), which may be stably bound
          to a translationally inactive subpopulation of mRNAs
          within the cytoplasm. It is distributed in both, the
          nucleus and the cytoplasm, and binds to poly(A)+ RNA
          (mRNA or pre-mRNA). Although it is one of the major
          cellular proteins cross-linked by UV light to
          polyadenylated RNAs in vivo, PUB1 is nonessential for
          cell growth in yeast. PUB1 also binds to T-rich single
          stranded DNA (ssDNA); however, there is no strong
          evidence implicating PUB1 in the mechanism of DNA
          replication. PUB1 contains three RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a GAR motif (glycine
          and arginine rich stretch) that is located between RRM2
          and RRM3. .
          Length = 74

 Score = 25.2 bits (55), Expect = 3.2
 Identities = 9/32 (28%), Positives = 17/32 (53%), Gaps = 2/32 (6%)

Query: 17 FAFVQYTDIASVVRAMRAMDGEYVGHN--RVN 46
          + FV+Y        A++ ++G  + +N  RVN
Sbjct: 41 YGFVEYHQSHDAEIALQTLNGRQIENNEIRVN 72


>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage
          stimulation factor subunit 2 (CSTF2), yeast ortholog
          mRNA 3'-end-processing protein RNA15 and similar
          proteins.  This subfamily corresponds to the RRM domain
          of CSTF2, its tau variant and eukaryotic homologs.
          CSTF2, also termed cleavage stimulation factor 64 kDa
          subunit (CstF64), is the vertebrate conterpart of yeast
          mRNA 3'-end-processing protein RNA15. It is expressed
          in all somatic tissues and is one of three cleavage
          stimulatory factor (CstF) subunits required for
          polyadenylation. CstF64 contains an N-terminal RNA
          recognition motif (RRM), also known as RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain), a
          CstF77-binding domain, a repeated MEARA helical region
          and a conserved C-terminal domain reported to bind the
          transcription factor PC-4. During polyadenylation, CstF
          interacts with the pre-mRNA through the RRM of CstF64
          at U- or GU-rich sequences within 10 to 30 nucleotides
          downstream of the cleavage site. CSTF2T, also termed
          tauCstF64, is a paralog of the X-linked cleavage
          stimulation factor CstF64 protein that supports
          polyadenylation in most somatic cells. It is expressed
          during meiosis and subsequent haploid differentiation
          in a more limited set of tissues and cell types,
          largely in meiotic and postmeiotic male germ cells, and
          to a lesser extent in brain. The loss of CSTF2T will
          cause male infertility, as it is necessary for
          spermatogenesis and fertilization. Moreover, CSTF2T is
          required for expression of genes involved in
          morphological differentiation of spermatids, as well as
          for genes having products that function during
          interaction of motile spermatozoa with eggs. It
          promotes germ cell-specific patterns of polyadenylation
          by using its RRM to bind to different sequence elements
          downstream of polyadenylation sites than does CstF64.
          The family also includes yeast ortholog mRNA
          3'-end-processing protein RNA15 and similar proteins.
          RNA15 is a core subunit of cleavage factor IA (CFIA),
          an essential transcriptional 3'-end processing factor
          from Saccharomyces cerevisiae. RNA recognition by CFIA
          is mediated by an N-terminal RRM, which is contained in
          the RNA15 subunit of the complex. The RRM of RNA15 has
          a strong preference for GU-rich RNAs, mediated by a
          binding pocket that is entirely conserved in both yeast
          and vertebrate RNA15 orthologs.
          Length = 75

 Score = 25.3 bits (56), Expect = 3.3
 Identities = 6/22 (27%), Positives = 13/22 (59%)

Query: 17 FAFVQYTDIASVVRAMRAMDGE 38
          + F ++ DI +   A+R ++G 
Sbjct: 42 YGFCEFEDIETAASAIRNLNGY 63


>gnl|CDD|241070 cd12626, RRM1_IGF2BP2, RNA recognition motif 1 in vertebrate
          insulin-like growth factor 2 mRNA-binding protein 2
          (IGF2BP2).  This subgroup corresponds to the RRM1 of
          IGF2BP2 (IGF2 mRNA-binding protein 2 or IMP-2), also
          termed hepatocellular carcinoma autoantigen p62, or
          VICKZ family member 2,  which is a ubiquitously
          expressed RNA-binding protein involved in the
          stimulation of insulin action. It is predominantly
          nuclear. SNPs in IGF2BP2 gene are implicated in
          susceptibility to type 2 diabetes. IGF2BP2 plays an
          important role in cellular motility; it regulates the
          expression of PINCH-2, an important mediator of cell
          adhesion and motility, and MURF-3, a
          microtubule-stabilizing protein, through direct binding
          to their mRNAs. IGF2BP2 may be involved in the
          regulation of mRNA stability through the interaction
          with the AU-rich element-binding factor AUF1. IGF2BP2
          binds initially to nascent beta-actin transcripts and
          facilitates the subsequent binding of the shuttling
          IGF2BP1. IGF2BP2 contains four hnRNP K-homology (KH)
          domains, two RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), and a RGG RNA-binding domain. .
          Length = 77

 Score = 25.3 bits (55), Expect = 3.4
 Identities = 11/31 (35%), Positives = 17/31 (54%)

Query: 15 SAFAFVQYTDIASVVRAMRAMDGEYVGHNRV 45
          S +AFV Y D    +RA+  + G+   H +V
Sbjct: 37 SGYAFVDYPDQNWAIRAIETLSGKVELHGKV 67


>gnl|CDD|241089 cd12645, RRM_SRSF3, RNA recognition motif in vertebrate
          serine/arginine-rich splicing factor 3 (SRSF3).  This
          subgroup corresponds to the RRM of SRSF3, also termed
          pre-mRNA-splicing factor SRp20, a splicing regulatory
          serine/arginine (SR) protein that modulates alternative
          splicing by interacting with RNA cis-elements in a
          concentration- and cell differentiation-dependent
          manner. It is also involved in termination of
          transcription, alternative RNA polyadenylation, RNA
          export, and protein translation. SRSF3 is critical for
          cell proliferation and tumor induction and maintenance.
          SRSF3 can shuttle between the nucleus and cytoplasm. It
          contains a single N-terminal RNA recognition motif
          (RRM), also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), and a C-terminal RS domain
          rich in serine-arginine dipeptides. The RRM domain is
          involved in RNA binding, and the RS domain has been
          implicated in protein shuttling and protein-protein
          interactions. .
          Length = 81

 Score = 25.4 bits (55), Expect = 3.6
 Identities = 11/32 (34%), Positives = 17/32 (53%)

Query: 16 AFAFVQYTDIASVVRAMRAMDGEYVGHNRVNL 47
           FAFV++ D      A+R +DG  +   RV +
Sbjct: 42 GFAFVEFEDPRDAADAVRELDGRTLCGCRVRV 73


>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic
          translation initiation factor 3 subunit G (eIF-3G) and
          similar proteins.  This subfamily corresponds to the
          RRM of eIF-3G and similar proteins. eIF-3G, also termed
          eIF-3 subunit 4, or eIF-3-delta, or eIF3-p42, or
          eIF3-p44, is the RNA-binding subunit of eIF3, a large
          multisubunit complex that plays a central role in the
          initiation of translation by binding to the 40 S
          ribosomal subunit and promoting the binding of
          methionyl-tRNAi and mRNA. eIF-3G binds 18 S rRNA and
          beta-globin mRNA, and therefore appears to be a
          nonspecific RNA-binding protein. eIF-3G is one of the
          cytosolic targets and interacts with mature
          apoptosis-inducing factor (AIF). eIF-3G contains one
          RNA recognition motif (RRM), also termed RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain). This
          family also includes yeast eIF3-p33, a homolog of
          vertebrate eIF-3G, plays an important role in the
          initiation phase of protein synthesis in yeast. It
          binds both, mRNA and rRNA, fragments due to an RRM near
          its C-terminus. .
          Length = 77

 Score = 24.8 bits (55), Expect = 4.3
 Identities = 9/35 (25%), Positives = 16/35 (45%)

Query: 3  MYFVDIKKQSSASAFAFVQYTDIASVVRAMRAMDG 37
          +Y    K+   +  FAFV +       RA+  ++G
Sbjct: 29 VYLAKDKETGQSRGFAFVTFHTREDAERAIEKLNG 63


>gnl|CDD|240794 cd12348, RRM1_SHARP, RNA recognition motif 1 in
          SMART/HDAC1-associated repressor protein (SHARP) and
          similar proteins.  This subfamily corresponds to the
          RRM1 of SHARP, also termed Msx2-interacting protein
          (MINT), or SPEN homolog, an estrogen-inducible
          transcriptional repressor that interacts directly with
          the nuclear receptor corepressor SMRT, histone
          deacetylases (HDACs) and components of the NuRD
          complex. SHARP recruits HDAC activity and binds to the
          steroid receptor RNA coactivator SRA through four
          conserved N-terminal RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), further suppressing
          SRA-potentiated steroid receptor transcription
          activity. Thus, SHARP has the capacity to modulate both
          liganded and nonliganded nuclear receptors. SHARP also
          has been identified as a component of transcriptional
          repression complexes in Notch/RBP-Jkappa signaling
          pathways. In addition to the N-terminal RRMs, SHARP
          possesses a C-terminal SPOC domain (Spen paralog and
          ortholog C-terminal domain), which is highly conserved
          among Spen proteins.  .
          Length = 75

 Score = 24.7 bits (54), Expect = 4.7
 Identities = 15/48 (31%), Positives = 19/48 (39%), Gaps = 10/48 (20%)

Query: 9  KKQSSASAFAFVQYTDIASVVRAMRAMDGEYVGHNRVNLGYGKSLATT 56
          K+ S     AFV + DI S  +A          HN VN    + L T 
Sbjct: 34 KRGSDGGVAAFVDFVDIKSAQKA----------HNAVNKMGDRDLRTD 71


>gnl|CDD|240791 cd12345, RRM2_SECp43_like, RNA recognition motif 2 in tRNA
          selenocysteine-associated protein 1 (SECp43) and
          similar proteins.  This subfamily corresponds to the
          RRM2 in tRNA selenocysteine-associated protein 1
          (SECp43), yeast negative growth regulatory protein NGR1
          (RBP1), yeast protein NAM8, and similar proteins.
          SECp43 is an RNA-binding protein associated
          specifically with eukaryotic selenocysteine tRNA
          [tRNA(Sec)]. It may play an adaptor role in the
          mechanism of selenocysteine insertion. SECp43 is
          located primarily in the nucleus and contains two
          N-terminal RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), and a C-terminal polar/acidic region. Yeast
          proteins, NGR1 and NAM8, show high sequence similarity
          with SECp43. NGR1 is a putative glucose-repressible
          protein that binds both RNA and single-stranded DNA
          (ssDNA). It may function in regulating cell growth in
          early log phase, possibly through its participation in
          RNA metabolism. NGR1 contains three RRMs, two of which
          are followed by a glutamine-rich stretch that may be
          involved in transcriptional activity. In addition, NGR1
          has an asparagine-rich region near the C-terminus which
          also harbors a methionine-rich region. NAM8 is a
          putative RNA-binding protein that acts as a suppressor
          of mitochondrial splicing deficiencies when
          overexpressed in yeast. It may be a non-essential
          component of the mitochondrial splicing machinery. NAM8
          also contains three RRMs.  .
          Length = 80

 Score = 24.9 bits (55), Expect = 4.9
 Identities = 8/33 (24%), Positives = 15/33 (45%)

Query: 17 FAFVQYTDIASVVRAMRAMDGEYVGHNRVNLGY 49
          + FV++ D     RA+  M+G Y     + +  
Sbjct: 46 YGFVRFGDEDERDRALTEMNGVYCSSRPMRVSP 78


>gnl|CDD|240710 cd12264, RRM_AKAP17A, RNA recognition motif found in A-kinase
           anchor protein 17A (AKAP-17A) and similar proteins.
           This subfamily corresponds to the RRM domain of
           AKAP-17A, also termed 721P, or splicing factor,
           arginine/serine-rich 17A (SFRS17A). It was originally
           reported as the pseudoautosomal or X inactivation escape
           gene 7 (XE7) and as B-lymphocyte antigen precursor. It
           has been suggested that AKAP-17A is an alternative
           splicing factor and an SR-related splicing protein that
           interacts with the classical SR protein ASF/SF2 and the
           SR-related factor ZNF265. Additional studies have
           indicated that AKAP-17A is a dual-specific protein
           kinase A anchoring protein (AKAP) that can bind both
           type I and type II protein kinase A (PKA) with high
           affinity and co-localizes with the catalytic subunit of
           PKA in nuclear speckles as well as the splicing factor
           SC35 in splicing factor compartments. It is involved in
           regulation of pre-mRNA splicing possibly by docking a
           pool of PKA in splicing factor compartments. AKAP-17A
           contains an RNA recognition motif (RRM), also termed RBD
           (RNA binding domain) or RNP (ribonucleoprotein domain).
           .
          Length = 121

 Score = 25.3 bits (56), Expect = 5.0
 Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 3/30 (10%)

Query: 18  AFVQYTDIASVVRAMRAMDG---EYVGHNR 44
            +VQY +    V+AM A+ G   +Y G  +
Sbjct: 74  VYVQYEEYDGFVKAMDALRGMKLQYKGDGK 103


>gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding
          protein 45 (RBM45) and similar proteins.  This
          subfamily corresponds to the RRM1 of RBM45, also termed
          developmentally-regulated RNA-binding protein 1 (DRB1),
          a new member of RNA recognition motif (RRM)-type neural
          RNA-binding proteins, which expresses under
          spatiotemporal control. It is encoded by gene drb1 that
          is expressed in neurons, not in glial cells. RBM45
          predominantly localizes in cytoplasm of cultured cells
          and specifically binds to poly(C) RNA. It could play an
          important role during neurogenesis. RBM45 carries four
          RRMs, also known as RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). .
          Length = 81

 Score = 24.6 bits (54), Expect = 5.1
 Identities = 9/24 (37%), Positives = 16/24 (66%)

Query: 18 AFVQYTDIASVVRAMRAMDGEYVG 41
          A+V++   +S  RAM  M+G+ +G
Sbjct: 47 AYVKFAKASSAARAMEEMNGKCLG 70


>gnl|CDD|179118 PRK00771, PRK00771, signal recognition particle protein Srp54;
           Provisional.
          Length = 437

 Score = 25.6 bits (57), Expect = 5.5
 Identities = 10/38 (26%), Positives = 19/38 (50%), Gaps = 4/38 (10%)

Query: 2   VMYFVD--IKKQSSASAFAFVQYTDIASVVRAMRAMDG 37
           V+  +D  I +Q+   A AF +   I  ++  +  +DG
Sbjct: 209 VLLVIDATIGQQAKNQAKAFHEAVGIGGII--ITKLDG 244


>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins
          family, Drosophila sex-lethal (SXL), and similar
          proteins.  This subfamily corresponds to the RRM1 of Hu
          proteins and SXL. The Hu proteins family represents a
          group of RNA-binding proteins involved in diverse
          biological processes. Since the Hu proteins share high
          homology with the Drosophila embryonic lethal abnormal
          vision (ELAV) protein, the Hu family is sometimes
          referred to as the ELAV family. Drosophila ELAV is
          exclusively expressed in neurons and is required for
          the correct differentiation and survival of neurons in
          flies. The neuronal members of the Hu family include
          Hu-antigen B (HuB or ELAV-2 or Hel-N1), Hu-antigen C
          (HuC or ELAV-3 or PLE21), and Hu-antigen D (HuD or
          ELAV-4), which play important roles in neuronal
          differentiation, plasticity and memory. HuB is also
          expressed in gonads. Hu-antigen R (HuR or ELAV-1 or
          HuA) is ubiquitously expressed Hu family member. It has
          a variety of biological functions mostly related to the
          regulation of cellular response to DNA damage and other
          types of stress. Hu proteins perform their cytoplasmic
          and nuclear molecular functions by coordinately
          regulating functionally related mRNAs. In the
          cytoplasm, Hu proteins recognize and bind to AU-rich
          RNA elements (AREs) in the 3' untranslated regions
          (UTRs) of certain target mRNAs, such as GAP-43,
          vascular epithelial growth factor (VEGF), the glucose
          transporter GLUT1, eotaxin and c-fos, and stabilize
          those ARE-containing mRNAs. They also bind and regulate
          the translation of some target mRNAs, such as
          neurofilament M, GLUT1, and p27. In the nucleus, Hu
          proteins function as regulators of polyadenylation and
          alternative splicing. Each Hu protein contains three
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          RRM1 and RRM2 may cooperate in binding to an ARE. RRM3
          may help to maintain the stability of the RNA-protein
          complex, and might also bind to poly(A) tails or be
          involved in protein-protein interactions. This family
          also includes the sex-lethal protein (SXL) from
          Drosophila melanogaster. SXL governs sexual
          differentiation and X chromosome dosage compensation in
          flies. It induces female-specific alternative splicing
          of the transformer (tra) pre-mRNA by binding to the tra
          uridine-rich polypyrimidine tract at the
          non-sex-specific 3' splice site during the
          sex-determination process. SXL binds to its own
          pre-mRNA and promotes female-specific alternative
          splicing. It contains an N-terminal Gly/Asn-rich domain
          that may be responsible for the protein-protein
          interaction, and tandem RRMs that show high preference
          to bind single-stranded, uridine-rich target RNA
          transcripts. .
          Length = 77

 Score = 24.6 bits (54), Expect = 5.5
 Identities = 8/33 (24%), Positives = 17/33 (51%)

Query: 17 FAFVQYTDIASVVRAMRAMDGEYVGHNRVNLGY 49
          + FV Y D     +A+  ++G  + + R+ + Y
Sbjct: 44 YGFVDYVDENDAQKAINTLNGFEIRNKRLKVSY 76


>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous
          nuclear ribonucleoprotein C (hnRNP C)-related proteins.
           This subfamily corresponds to the RRM in the hnRNP
          C-related protein family, including hnRNP C proteins,
          Raly, and Raly-like protein (RALYL). hnRNP C proteins,
          C1 and C2, are produced by a single coding sequence.
          They are the major constituents of the heterogeneous
          nuclear RNA (hnRNA) ribonucleoprotein (hnRNP) complex
          in vertebrates. They bind hnRNA tightly, suggesting a
          central role in the formation of the ubiquitous hnRNP
          complex; they are involved in the packaging of the
          hnRNA in the nucleus and in processing of pre-mRNA such
          as splicing and 3'-end formation. Raly, also termed
          autoantigen p542, is an RNA-binding protein that may
          play a critical role in embryonic development. The
          biological role of RALYL remains unclear. It shows high
          sequence homology with hnRNP C proteins and Raly.
          Members of this family are characterized by an
          N-terminal RNA recognition motif (RRM), also termed RBD
          (RNA binding domain) or RNP (ribonucleoprotein domain),
          and a C-terminal auxiliary domain. The Raly proteins
          contain a glycine/serine-rich stretch within the
          C-terminal regions, which is absent in the hnRNP C
          proteins. Thus, the Raly proteins represent a newly
          identified class of evolutionarily conserved
          autoepitopes. .
          Length = 68

 Score = 24.5 bits (54), Expect = 5.7
 Identities = 9/33 (27%), Positives = 14/33 (42%), Gaps = 6/33 (18%)

Query: 17 FAFVQYTDIASVVRAMRAMDGEYVGHNRVNLGY 49
          + FVQ+ +      A  A+ GE   + R   G 
Sbjct: 37 YGFVQFDNEED---ARAAVAGE---NGREIAGQ 63


>gnl|CDD|240678 cd12232, RRM3_U2AF65, RNA recognition motif 3 found in U2 large
          nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa
          subunit (U2AF65) and similar proteins.  This subfamily
          corresponds to the RRM3 of U2AF65 and dU2AF50. U2AF65,
          also termed U2AF2, is the large subunit of U2 small
          nuclear ribonucleoprotein (snRNP) auxiliary factor
          (U2AF), which has been implicated in the recruitment of
          U2 snRNP to pre-mRNAs and is a highly conserved
          heterodimer composed of large and small subunits.
          U2AF65 specifically recognizes the intron
          polypyrimidine tract upstream of the 3' splice site and
          promotes binding of U2 snRNP to the pre-mRNA
          branchpoint. U2AF65 also plays an important role in the
          nuclear export of mRNA. It facilitates the formation of
          a messenger ribonucleoprotein export complex,
          containing both the NXF1 receptor and the RNA
          substrate. Moreover, U2AF65 interacts directly and
          specifically with expanded CAG RNA, and serves as an
          adaptor to link expanded CAG RNA to NXF1 for RNA
          export. U2AF65 contains an N-terminal RS domain rich in
          arginine and serine, followed by a proline-rich segment
          and three C-terminal RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). The N-terminal RS domain
          stabilizes the interaction of U2 snRNP with the branch
          point (BP) by contacting the branch region, and further
          promotes base pair interactions between U2 snRNA and
          the BP. The proline-rich segment mediates
          protein-protein interactions with the RRM domain of the
          small U2AF subunit (U2AF35 or U2AF1). The RRM1 and RRM2
          are sufficient for specific RNA binding, while RRM3 is
          responsible for protein-protein interactions. The
          family also includes Splicing factor U2AF 50 kDa
          subunit (dU2AF50), the Drosophila ortholog of U2AF65.
          dU2AF50 functions as an essential pre-mRNA splicing
          factor in flies. It associates with intronless mRNAs
          and plays a significant and unexpected role in the
          nuclear export of a large number of intronless mRNAs.
          Length = 89

 Score = 24.4 bits (54), Expect = 7.0
 Identities = 6/21 (28%), Positives = 11/21 (52%)

Query: 17 FAFVQYTDIASVVRAMRAMDG 37
            FV++ D+    +A  A+ G
Sbjct: 58 KVFVEFADVEDAQKAQLALAG 78


>gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and
          cytoplasmic polyadenylated RNA-binding protein PUB1 and
          similar proteins.  This subgroup corresponds to the
          RRM2 of yeast protein PUB1, also termed ARS
          consensus-binding protein ACBP-60, or poly
          uridylate-binding protein, or poly(U)-binding protein.
          PUB1 has been identified as both, a heterogeneous
          nuclear RNA-binding protein (hnRNP) and a cytoplasmic
          mRNA-binding protein (mRNP), which may be stably bound
          to a translationally inactive subpopulation of mRNAs
          within the cytoplasm. It is distributed in both, the
          nucleus and the cytoplasm, and binds to poly(A)+ RNA
          (mRNA or pre-mRNA). Although it is one of the major
          cellular proteins cross-linked by UV light to
          polyadenylated RNAs in vivo, PUB1 is nonessential for
          cell growth in yeast. PUB1 also binds to T-rich single
          stranded DNA (ssDNA). However, there is no strong
          evidence implicating PUB1 in the mechanism of DNA
          replication. PUB1 contains three RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a GAR motif (glycine
          and arginine rich stretch) that is located between RRM2
          and RRM3. .
          Length = 75

 Score = 24.0 bits (52), Expect = 7.8
 Identities = 7/32 (21%), Positives = 15/32 (46%)

Query: 10 KQSSASAFAFVQYTDIASVVRAMRAMDGEYVG 41
          K   +  + FV +        A+  M+G+++G
Sbjct: 36 KSGRSRGYGFVSFRSQQDAENAINEMNGKWLG 67


>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous
          nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA
          recognition motif 1 (hRBMY), testis-specific
          heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T)
          and similar proteins.  This subfamily corresponds to
          the RRM domain of hnRNP G, also termed glycoprotein p43
          or RBMX, an RNA-binding motif protein located on the X
          chromosome. It is expressed ubiquitously and has been
          implicated in the splicing control of several
          pre-mRNAs. Moreover, hnRNP G may function as a
          regulator of transcription for SREBP-1c and GnRH1.
          Research has shown that hnRNP G may also act as a
          tumor-suppressor since it upregulates the Txnip gene
          and promotes the fidelity of DNA end-joining activity.
          In addition, hnRNP G appears to play a critical role in
          proper neural development of zebrafish and frog
          embryos. The family also includes several paralogs of
          hnRNP G, such as hRBMY and hnRNP G-T (also termed
          RNA-binding motif protein, X-linked-like-2). Both,
          hRBMY and hnRNP G-T, are exclusively expressed in
          testis and critical for male fertility. Like hnRNP G,
          hRBMY and hnRNP G-T interact with factors implicated in
          the regulation of pre-mRNA splicing, such as
          hTra2-beta1 and T-STAR. Although members in this family
          share a high conserved N-terminal RNA recognition motif
          (RRM), also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), they appear to recognize
          different RNA targets. For instance, hRBMY interacts
          specifically with a stem-loop structure in which the
          loop is formed by the sequence CA/UCAA. In contrast,
          hnRNP G associates with single stranded RNA sequences
          containing a CCA/C motif. In addition to the RRM, hnRNP
          G contains a nascent transcripts targeting domain (NTD)
          in the middle region and a novel auxiliary RNA-binding
          domain (RBD) in its C-terminal region. The C-terminal
          RBD exhibits distinct RNA binding specificity, and
          would play a critical role in the regulation of
          alternative splicing by hnRNP G. .
          Length = 80

 Score = 24.1 bits (53), Expect = 7.8
 Identities = 6/24 (25%), Positives = 13/24 (54%)

Query: 17 FAFVQYTDIASVVRAMRAMDGEYV 40
          F FV +  +     A+R ++G+ +
Sbjct: 45 FGFVTFESVEDADAAIRDLNGKEL 68


>gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate
          RRM-containing coactivator activator/modulator (CoAA). 
          This subgroup corresponds to the RRM1 of CoAA, also
          termed RNA-binding protein 14 (RBM14), or paraspeckle
          protein 2 (PSP2), or synaptotagmin-interacting protein
          (SYT-interacting protein), a heterogeneous nuclear
          ribonucleoprotein (hnRNP)-like protein identified as a
          nuclear receptor coactivator. It mediates
          transcriptional coactivation and RNA splicing effects
          in a promoter-preferential manner and is enhanced by
          thyroid hormone receptor-binding protein (TRBP). CoAA
          contains two N-terminal RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a TRBP-interacting
          domain. It stimulates transcription through its
          interactions with coactivators, such as TRBP and
          CREB-binding protein CBP/p300, via the TRBP-interacting
          domain and interaction with an RNA-containing complex,
          such as DNA-dependent protein kinase-poly(ADP-ribose)
          polymerase complexes, via the RRMs. .
          Length = 69

 Score = 24.0 bits (52), Expect = 8.0
 Identities = 11/30 (36%), Positives = 15/30 (50%), Gaps = 1/30 (3%)

Query: 17 FAFVQYTDIASVVRAMRAMDG-EYVGHNRV 45
          FAFV     A+  RA+  ++G E  G   V
Sbjct: 36 FAFVHLRGEAAADRAIEELNGRELHGRKLV 65


>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in
          granule-associated RNA binding proteins p40-TIA-1 and
          TIAR.  This subfamily corresponds to the RRM2 of
          nucleolysin TIA-1 isoform p40 (p40-TIA-1 or TIA-1) and
          nucleolysin TIA-1-related protein (TIAR), both of which
          are granule-associated RNA binding proteins involved in
          inducing apoptosis in cytotoxic lymphocyte (CTL) target
          cells. TIA-1 and TIAR share high sequence similarity.
          They are expressed in a wide variety of cell types.
          TIA-1 can be phosphorylated by a serine/threonine
          kinase that is activated during Fas-mediated apoptosis.
          TIAR is mainly localized in the nucleus of
          hematopoietic and nonhematopoietic cells. It is
          translocated from the nucleus to the cytoplasm in
          response to exogenous triggers of apoptosis. Both,
          TIA-1 and TIAR, bind specifically to poly(A) but not to
          poly(C) homopolymers. They are composed of three
          N-terminal highly homologous RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a glutamine-rich
          C-terminal auxiliary domain containing a
          lysosome-targeting motif. TIA-1 and TIAR interact with
          RNAs containing short stretches of uridylates and their
          RRM2 can mediate the specific binding to uridylate-rich
          RNAs. The C-terminal auxiliary domain may be
          responsible for interacting with other proteins. In
          addition, TIA-1 and TIAR share a potential serine
          protease-cleavage site (Phe-Val-Arg) localized at the
          junction between their RNA binding domains and their
          C-terminal auxiliary domains.
          Length = 75

 Score = 23.9 bits (52), Expect = 8.6
 Identities = 8/35 (22%), Positives = 19/35 (54%), Gaps = 1/35 (2%)

Query: 7  DIKKQSSASAFAFVQYTDIASVVRAMRAMDGEYVG 41
          D++   S   + FV +        A+++M+G+++G
Sbjct: 34 DMQTGKS-KGYGFVSFVKKEDAENAIQSMNGQWLG 67


>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor.  This
           model describes the sex-lethal family of splicing
           factors found in Dipteran insects. The sex-lethal
           phenotype, however, may be limited to the Melanogasters
           and closely related species. In Drosophila the protein
           acts as an inhibitor of splicing. This subfamily is most
           closely related to the ELAV/HUD subfamily of splicing
           factors (TIGR01661).
          Length = 346

 Score = 25.0 bits (54), Expect = 8.7
 Identities = 14/48 (29%), Positives = 27/48 (56%), Gaps = 4/48 (8%)

Query: 17  FAFVQYTDIASVVRAMRAMDGEYVGHNRVNLGY----GKSLATTCVWV 60
           +AFV +   A   RA++ ++G  V + R+ + Y    G+S+  T ++V
Sbjct: 151 YAFVDFGSEADSQRAIKNLNGITVRNKRLKVSYARPGGESIKDTNLYV 198


>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter
          pylori HP0827 protein and similar proteins.  This
          subfamily corresponds to the RRM of H. pylori HP0827, a
          putative ssDNA-binding protein 12rnp2 precursor,
          containing one RNA recognition motif (RRM), also termed
          RBD (RNA binding domain) or RNP (ribonucleoprotein
          domain). The ssDNA binding may be important in
          activation of HP0827. .
          Length = 78

 Score = 24.1 bits (53), Expect = 9.2
 Identities = 6/25 (24%), Positives = 10/25 (40%)

Query: 17 FAFVQYTDIASVVRAMRAMDGEYVG 41
          F FV+         A+  ++G   G
Sbjct: 43 FGFVEMETAEEANAAIEKLNGTDFG 67


>gnl|CDD|241090 cd12646, RRM_SRSF7, RNA recognition motif in vertebrate
          serine/arginine-rich splicing factor 7 (SRSF7).  This
          subgroup corresponds to the RRM of SRSF7, also termed
          splicing factor 9G8, is a splicing regulatory
          serine/arginine (SR) protein that plays a crucial role
          in both constitutive splicing and alternative splicing
          of many pre-mRNAs. Its localization and functions are
          tightly regulated by phosphorylation. SRSF7 is
          predominantly present in the nuclear and can shuttle
          between nucleus and cytoplasm. It cooperates with the
          export protein, Tap/NXF1, helps mRNA export to the
          cytoplasm, and enhances the expression of unspliced
          mRNA. SRSF7 inhibits tau E10 inclusion through directly
          interacting with the proximal downstream intron of E10,
          a clustering region for frontotemporal dementia with
          Parkinsonism (FTDP) mutations. SRSF7 contains a single
          N-terminal RNA recognition motif (RRM), also termed RBD
          (RNA binding domain) or RNP (ribonucleoprotein domain),
          followed by a CCHC-type zinc knuckle motif in its
          median region, and a C-terminal RS domain rich in
          serine-arginine dipeptides. The RRM domain is involved
          in RNA binding, and the RS domain has been implicated
          in protein shuttling and protein-protein interactions.
          .
          Length = 77

 Score = 24.2 bits (52), Expect = 9.3
 Identities = 11/33 (33%), Positives = 19/33 (57%)

Query: 15 SAFAFVQYTDIASVVRAMRAMDGEYVGHNRVNL 47
            FAFV++ D      A+R +DG+ +  +RV +
Sbjct: 36 PGFAFVEFEDPRDAEDAVRGLDGKVICGSRVRV 68


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.321    0.134    0.422 

Gapped
Lambda     K      H
   0.267   0.0783    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 4,707,304
Number of extensions: 364992
Number of successful extensions: 421
Number of sequences better than 10.0: 1
Number of HSP's gapped: 421
Number of HSP's successfully gapped: 86
Length of query: 99
Length of database: 10,937,602
Length adjustment: 65
Effective length of query: 34
Effective length of database: 8,054,592
Effective search space: 273856128
Effective search space used: 273856128
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 53 (24.1 bits)