Query         psy11611
Match_columns 60
No_of_seqs    39 out of 41
Neff          3.1 
Searched_HMMs 46136
Date          Fri Aug 16 23:04:01 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy11611.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/11611hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4403|consensus               99.8 2.6E-22 5.7E-27  157.1   1.4   54    2-56     92-145 (575)
  2 PF12550 GCR1_C:  Transcription  58.0     6.8 0.00015   23.3   1.4   14   28-41      8-21  (81)
  3 TIGR03076 near_not_gcvH Chlamy  38.8      15 0.00033   30.8   1.0   24   14-37    114-137 (686)
  4 KOG3767|consensus               36.9      24 0.00053   27.3   1.8   21   22-42     59-79  (328)
  5 PF07535 zf-DBF:  DBF zinc fing  35.8      12 0.00026   21.4  -0.0   23   13-36     23-45  (49)
  6 PF03820 Mtc:  Tricarboxylate c  28.7      34 0.00074   25.6   1.4   15   28-42     47-61  (308)
  7 PF14641 HTH_44:  Helix-turn-he  28.1      33 0.00072   22.4   1.1   14   27-40     80-93  (121)
  8 PF02281 Dimer_Tnp_Tn5:  Transp  22.2      79  0.0017   20.9   2.0   17   23-40     72-88  (109)
  9 PF14659 Phage_int_SAM_3:  Phag  21.9      73  0.0016   16.3   1.5   14   30-43      1-14  (58)
 10 cd07826 SRPBCC_CalC_Aha1-like_  21.4      45 0.00097   20.6   0.7   20   29-48     10-30  (142)
 11 cd08897 SRPBCC_CalC_Aha1-like_  21.0      48   0.001   20.0   0.8   20   28-47      9-29  (133)
 12 cd08892 SRPBCC_Aha1 Putative h  20.6      50  0.0011   20.1   0.8   19   29-47     10-29  (126)
 13 PTZ00220 Activator of HSP-90 A  20.0      52  0.0011   20.5   0.8   19   29-47      3-22  (132)

No 1  
>KOG4403|consensus
Probab=99.84  E-value=2.6e-22  Score=157.10  Aligned_cols=54  Identities=37%  Similarity=0.716  Sum_probs=48.8

Q ss_pred             chhhhhccCCchHHHHHhhhhcCCCcceeHHHHHHHHhhccceecCccceeeccc
Q psy11611          2 SFLREELKYDDGAEKRQKAFHKNDDMHVSVKELWDVWIKSECCREDAGGQQHGGI   56 (60)
Q Consensus         2 eFLREdl~y~d~~~~r~~~fH~~D~~~ISVedLW~~Wk~Sev~NWT~~~~~~~~~   56 (60)
                      |||||||||+++.++|.++||++|+ ||||+|||++|+.|||||||++++++=-|
T Consensus        92 eFlrEdmky~~~~~kr~~~fH~dD~-~ItVedLWeaW~~Sev~nWT~e~tvqWLi  145 (575)
T KOG4403|consen   92 EFLREDMKYRDSTRKRSEKFHGDDK-HITVEDLWEAWKESEVHNWTNERTVQWLI  145 (575)
T ss_pred             HHHHHHhhcccchhhhhhhccCCcc-ceeHHHHHHHHHhhhhhcchHHHHHHHHH
Confidence            7999999999999777779999777 99999999999999999999999876444


No 2  
>PF12550 GCR1_C:  Transcriptional activator of glycolytic enzymes;  InterPro: IPR022210  This domain family is found in eukaryotes, and is approximately 80 amino acids in length. This family is activates the transcription of glycolytic enzymes. 
Probab=57.98  E-value=6.8  Score=23.33  Aligned_cols=14  Identities=29%  Similarity=0.793  Sum_probs=12.4

Q ss_pred             ceeHHHHHHHHhhc
Q psy11611         28 HVSVKELWDVWIKS   41 (60)
Q Consensus        28 ~ISVedLW~~Wk~S   41 (60)
                      .=||.|||.-|..+
T Consensus         8 ~~TV~dlw~Ew~~g   21 (81)
T PF12550_consen    8 IKTVYDLWREWFTG   21 (81)
T ss_pred             CCcHHHHHHHHhcC
Confidence            56999999999986


No 3  
>TIGR03076 near_not_gcvH Chlamydial GcvH-like protein upstream region protein. The H protein (GcvH) of the glycine cleavage system shuttles the methylamine group of glycine from the P protein to the T protein. Most Chlamydia but lack the P and T proteins, and have a single homolog of GcvH that appears deeply split from canonical GcvH in molecular phylogenetic trees. The protein family modeled here is observed so far only in the Chlamydiae, always as part of a two-gene operon, upstream of the homolog of GcvH. Its function is unknown.
Probab=38.84  E-value=15  Score=30.79  Aligned_cols=24  Identities=25%  Similarity=0.533  Sum_probs=18.6

Q ss_pred             HHHHHhhhhcCCCcceeHHHHHHH
Q psy11611         14 AEKRQKAFHKNDDMHVSVKELWDV   37 (60)
Q Consensus        14 ~~~r~~~fH~~D~~~ISVedLW~~   37 (60)
                      .|+|-..+-|-|.++||+|+.|++
T Consensus       114 KEK~y~~YrrfdapFissEevWks  137 (686)
T TIGR03076       114 KEKSYQGYRRFDAPFISSEEVWKS  137 (686)
T ss_pred             hhhccccccCCCCccccHHHHHhc
Confidence            345555667889999999999975


No 4  
>KOG3767|consensus
Probab=36.91  E-value=24  Score=27.33  Aligned_cols=21  Identities=14%  Similarity=0.128  Sum_probs=15.7

Q ss_pred             hcCCCcceeHHHHHHHHhhcc
Q psy11611         22 HKNDDMHVSVKELWDVWIKSE   42 (60)
Q Consensus        22 H~~D~~~ISVedLW~~Wk~Se   42 (60)
                      |+...+-+|+++||+||+...
T Consensus        59 ~G~~~p~~t~~~lW~Akkl~d   79 (328)
T KOG3767|consen   59 AGKVPPGLTDDELWKAKKLYD   79 (328)
T ss_pred             cCCcCCCCcHHHHHHHHHHHh
Confidence            344555689999999998643


No 5  
>PF07535 zf-DBF:  DBF zinc finger;  InterPro: IPR006572 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  In eukaryotes, initiation of DNA replication requires the assembly of pre-replication complexes (pre-RCs) on chromatin during the G1 phase. In the S phase, pre-RCs are activated by two protein kinases, Cdk2 and Cdc7, which results in the loading of replication factors and the unwinding of replication origins by the MCM helicase complex []. Cdc7 is a serine/threonine kinase that is conserved from yeast to human. It is regulated by its association with a regulatory subunit, the Dbf4 protein. This complex is often referred to as DDK (Dbf4-dependent kinase) []. DBF4 contains an N-terminal BRCT domain and a C-terminal conserved region that could potentially coordinate one zinc atom, the DBF4-type zinc finger. This entry represents the zinc finger, which is important for the interaction with Cdc7 [, ]. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding
Probab=35.76  E-value=12  Score=21.37  Aligned_cols=23  Identities=17%  Similarity=0.368  Sum_probs=18.5

Q ss_pred             hHHHHHhhhhcCCCcceeHHHHHH
Q psy11611         13 GAEKRQKAFHKNDDMHVSVKELWD   36 (60)
Q Consensus        13 ~~~~r~~~fH~~D~~~ISVedLW~   36 (60)
                      .+ .+|..|=.+|.-+..|++|=.
T Consensus        23 ~s-~~Hr~FA~~~~Nf~~lD~li~   45 (49)
T PF07535_consen   23 QS-EKHRKFAENDSNFKELDSLIS   45 (49)
T ss_pred             CC-HHHHHHHcCcccHHHHHHHHH
Confidence            44 599999888887999998843


No 6  
>PF03820 Mtc:  Tricarboxylate carrier;  InterPro: IPR004686 The MTC family consists of a limited number of homologues, all from eukaryotes. One member of the family has been functionally characterised as a tricarboxylate carrier from rat liver mitochondria. The rat liver mitochondrial tricarboxylate carrier has been reported to transport citrate, cis-aconitate, threo-D-isocitrate, D- and L-tartrate, malate, succinate and phosphoenolpyruvate. It presumably functions by a proton symport mechanism. The rest of the characterised proteins appear to be sideroflexins involved in iron transport.; GO: 0008324 cation transmembrane transporter activity, 0006812 cation transport, 0055085 transmembrane transport, 0016020 membrane
Probab=28.66  E-value=34  Score=25.63  Aligned_cols=15  Identities=20%  Similarity=0.335  Sum_probs=12.9

Q ss_pred             ceeHHHHHHHHhhcc
Q psy11611         28 HVSVKELWDVWIKSE   42 (60)
Q Consensus        28 ~ISVedLW~~Wk~Se   42 (60)
                      -+|.++||++|+.++
T Consensus        47 ~~~~~~lw~Ak~l~~   61 (308)
T PF03820_consen   47 GLTDDELWKAKKLYD   61 (308)
T ss_pred             CCCHHHHHHHHHHhh
Confidence            469999999999765


No 7  
>PF14641 HTH_44:  Helix-turn-helix DNA-binding domain of SPT6; PDB: 3PSI_A 3PSF_A.
Probab=28.10  E-value=33  Score=22.42  Aligned_cols=14  Identities=14%  Similarity=0.451  Sum_probs=8.7

Q ss_pred             cceeHHHHHHHHhh
Q psy11611         27 MHVSVKELWDVWIK   40 (60)
Q Consensus        27 ~~ISVedLW~~Wk~   40 (60)
                      +.+|.+|||+-..-
T Consensus        80 ~lL~~~DLWrI~~l   93 (121)
T PF14641_consen   80 PLLNEDDLWRIYDL   93 (121)
T ss_dssp             -B--HHHHHHHHHH
T ss_pred             hhccHHHHHHHHHh
Confidence            37999999986653


No 8  
>PF02281 Dimer_Tnp_Tn5:  Transposase Tn5 dimerisation domain;  InterPro: IPR003201 Transposons are mobile DNA sequences capable of replication and insertion into the chromosome. Typically transposons code for the transposase enzyme, which catalyses insertion, found between terminal inverted repeats []. Tn5 has a unique method of self- regulation in which a truncated version of the transposase enzyme acts as an inhibitor []. More information about these proteins can be found at Protein of the Month: Transposase [].; PDB: 3ECP_A 4DM0_A 1MUS_A 1MUH_A 1MM8_A 1B7E_A.
Probab=22.21  E-value=79  Score=20.95  Aligned_cols=17  Identities=35%  Similarity=0.790  Sum_probs=11.7

Q ss_pred             cCCCcceeHHHHHHHHhh
Q psy11611         23 KNDDMHVSVKELWDVWIK   40 (60)
Q Consensus        23 ~~D~~~ISVedLW~~Wk~   40 (60)
                      ..|- ..++.-||.+|+.
T Consensus        72 KrdG-~pG~~tLW~GW~r   88 (109)
T PF02281_consen   72 KRDG-EPGWKTLWRGWFR   88 (109)
T ss_dssp             TSSS----HHHHHHHHHH
T ss_pred             CCCC-CCchhhHHHHHHH
Confidence            4566 8999999999986


No 9  
>PF14659 Phage_int_SAM_3:  Phage integrase, N-terminal SAM-like domain; PDB: 2KD1_A 2KOB_A 2KHQ_A 3LYS_E 2KIW_A 2KKP_A.
Probab=21.92  E-value=73  Score=16.35  Aligned_cols=14  Identities=14%  Similarity=0.586  Sum_probs=10.8

Q ss_pred             eHHHHHHHHhhccc
Q psy11611         30 SVKELWDVWIKSEC   43 (60)
Q Consensus        30 SVedLW~~Wk~Sev   43 (60)
                      |++++++.|...-.
T Consensus         1 Tf~~~~~~wl~~~~   14 (58)
T PF14659_consen    1 TFSEFFEEWLEEYK   14 (58)
T ss_dssp             BHHHHHHHHHHHHT
T ss_pred             CHHHHHHHHHHHhc
Confidence            68899999987633


No 10 
>cd07826 SRPBCC_CalC_Aha1-like_9 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins. SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain of a functionally uncharacterized subgroup of CalC- and Aha1-like proteins. This group shows similarity to the SRPBCC domains of Micromonospora echinospora CalC (a protein which confers resistance to enediynes) and human Aha1 (one of several co-chaperones which regulate the dimeric chaperone Hsp90), and belongs to the SRPBCC domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands.
Probab=21.35  E-value=45  Score=20.61  Aligned_cols=20  Identities=10%  Similarity=-0.054  Sum_probs=14.6

Q ss_pred             eeHHHHHHHHhhccc-eecCc
Q psy11611         29 VSVKELWDVWIKSEC-CREDA   48 (60)
Q Consensus        29 ISVedLW~~Wk~Sev-~NWT~   48 (60)
                      -+++.||++|...+. -.|..
T Consensus        10 ap~e~Vw~a~Tdpe~l~~W~~   30 (142)
T cd07826          10 APRELVFRAHTDPELVKRWWG   30 (142)
T ss_pred             CCHHHHHHHhCCHHHHhhccC
Confidence            478999999998873 34543


No 11 
>cd08897 SRPBCC_CalC_Aha1-like_4 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins. SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain of a functionally uncharacterized subgroup of CalC- and Aha1-like proteins. This group shows similarity to the SRPBCC domains of Micromonospora echinospora CalC (a protein which confers resistance to enediynes) and human Aha1 (one of several co-chaperones which regulate the dimeric chaperone Hsp90), and belongs to the SRPBCC domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands.
Probab=21.03  E-value=48  Score=20.03  Aligned_cols=20  Identities=15%  Similarity=0.696  Sum_probs=15.3

Q ss_pred             ceeHHHHHHHHhhccc-eecC
Q psy11611         28 HVSVKELWDVWIKSEC-CRED   47 (60)
Q Consensus        28 ~ISVedLW~~Wk~Sev-~NWT   47 (60)
                      ..+++.+|++|...+. ..|.
T Consensus         9 ~ap~e~Vw~a~td~e~~~~W~   29 (133)
T cd08897           9 DAPIEKVWEAWTTPEHITKWN   29 (133)
T ss_pred             CCCHHHHHHHhCCHHHHhhCC
Confidence            3589999999998874 4563


No 12 
>cd08892 SRPBCC_Aha1 Putative hydrophobic ligand-binding SRPBCC domain of the Hsp90 co-chaperone Aha1 and related proteins. This subfamily includes the C-terminal SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain of Aha1, and related domains. Proteins in this group belong to the SRPBCC domain superfamily of proteins which bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. Aha1 is one of several co-chaperones, which regulate the dimeric chaperone Hsp90. Hsp90, Aha1, and other accessory proteins interact in a chaperone cycle driven by ATP binding and hydrolysis. Aha1 promotes dimerization of the N-terminal domains of Hsp90, and stimulates its low intrinsic ATPase activity. One Aha1 molecule binds per Hsp90 dimer. The N- and C- terminal domains of Aha1 cooperatively bind across the dimer interface of Hsp90. The C-terminal domain of Aha1 binds the N-terminal Hsp90 ATPase domain. Aha1 may regulate the dwell time of Hsp90 with client proteins. Aha1 m
Probab=20.57  E-value=50  Score=20.06  Aligned_cols=19  Identities=21%  Similarity=0.277  Sum_probs=13.8

Q ss_pred             eeHHHHHHHHhhcc-ceecC
Q psy11611         29 VSVKELWDVWIKSE-CCRED   47 (60)
Q Consensus        29 ISVedLW~~Wk~Se-v~NWT   47 (60)
                      .+++.+|++|...+ ...|.
T Consensus        10 ap~e~Vw~A~T~~e~l~~W~   29 (126)
T cd08892          10 VPAEELYEALTDEERVQAFT   29 (126)
T ss_pred             CCHHHHHHHHCCHHHHHhhc
Confidence            57899999998875 34454


No 13 
>PTZ00220 Activator of HSP-90 ATPase; Provisional
Probab=20.03  E-value=52  Score=20.53  Aligned_cols=19  Identities=11%  Similarity=0.221  Sum_probs=15.0

Q ss_pred             eeHHHHHHHHhhcccee-cC
Q psy11611         29 VSVKELWDVWIKSECCR-ED   47 (60)
Q Consensus        29 ISVedLW~~Wk~Sev~N-WT   47 (60)
                      .|++.||++|...+-.. |.
T Consensus         3 ap~e~Vw~A~Tdp~~l~~w~   22 (132)
T PTZ00220          3 VPPEVLYNAFLDAYTLTRLS   22 (132)
T ss_pred             CCHHHHHHHHcCHHHHHHHh
Confidence            47899999999988644 64


Done!