Diaphorina citri psyllid: psy11625


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310----
MKWNKGVKSRLLNHLNSCVSGLQQLTPFSLPSSTTAPPPPVTLPPAPSLLEDVNNNEASARLQMISSGIQVIPSRLPTGELALLLSGSSGLFSSPPEVSSSESSSSDRVSAFSVVEHKKPKSPPPSPTSSTDGDVVYLSPHNAEVTSTSTTQDNVFKVPSLQTKAFSSKPSYFSPYTNESSLLMKVPPYHQAEPCSSSILIITALNTVLIWIFQSNKPIMEKRRRARINNCLNELKSLILEAMRKDPARHSKLEKADILEMTVKHLQNVQRQQLSVAVASDPTVLQKFKSGFGDCAVEINRYISRLDGLDTEVC
ccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHcccEEEccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccc
****KGVKSRLLNHLNSCVS************************************************IQVI*******ELALLLSGSSG*FS****************************************************************************************LLMKVPPYHQAEPCSSSILIITALNTVLIWIFQSNKPIMEKRRRARINNCLNELKSLILEAMR***********ADILEMTVKHLQNVQRQQLSVAVASDPTVLQKFKSGFGDCAVEINRYISRLDG******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKWNKGVKSRLLNHLNSCVSGLQQLTPFSLPSSTTAPPPPVTLPPAPSLLEDVNNNEASARLQMISSGIQVIPSRLPTGELALLLSGSSGLFSSPPEVSSSESSSSDRVSAFSVVEHKKPKSPPPSPTSSTDGDVVYLSPHNAEVTSTSTTQDNVFKVPSLQTKAFSSKPSYFSPYTNESSLLMKVPPYHQAEPCSSSILIITALNTVLIWIFQSNKPIMEKRRRARINNCLNELKSLILEAMRKDPARHSKLEKADILEMTVKHLQNVQRQQLSVAVASDPTVLQKFKSGFGDCAVEINRYISRLDGLDTEVC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043565 [MF]sequence-specific DNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0048731 [BP]system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0007275, GO:0044699
GO:0030154 [BP]cell differentiationprobableGO:0032502, GO:0048869, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0003690 [MF]double-stranded DNA bindingprobableGO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0001078 [MF]RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcriptionprobableGO:0001227, GO:0003700, GO:0003674, GO:0001071, GO:0000982, GO:0000981

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1AN4, chain A
Confidence level:confident
Coverage over the Query: 212-273
View the alignment between query and template
View the model in PyMOL
Template: 2DB7, chain A
Confidence level:confident
Coverage over the Query: 287-312
View the alignment between query and template
View the model in PyMOL
Template: 2DB7, chain A
Confidence level:confident
Coverage over the Query: 3-22
View the alignment between query and template
View the model in PyMOL