BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy11631
         (219 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1VPA|A Chain A, Crystal Structure Of 2-C-Methyl-D-Erythritol 4-Phosphate
           Cytidylyltransferase (Tm1393) From Thermotoga Maritima
           At 2.67 A Resolution
 pdb|1VPA|B Chain B, Crystal Structure Of 2-C-Methyl-D-Erythritol 4-Phosphate
           Cytidylyltransferase (Tm1393) From Thermotoga Maritima
           At 2.67 A Resolution
          Length = 234

 Score = 28.1 bits (61), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 30/66 (45%), Gaps = 13/66 (19%)

Query: 77  FLESFSPVYRHAHDFLIAIAEPVCRPEHIHEYKLTAYSLYAAVSVGLET--------HDI 128
           FLE FSP Y   HD     A P  R +H+ E    A    AA ++ L+         +D 
Sbjct: 101 FLEKFSPSYVLVHDS----ARPFLRKKHVSEVLRRARETGAA-TLALKNSDALVRVENDR 155

Query: 129 IEYLKR 134
           IEY+ R
Sbjct: 156 IEYIPR 161


>pdb|2XHL|B Chain B, Structure Of A Functional Derivative Of Clostridium
           Botulinum Neurotoxin Type B
          Length = 433

 Score = 27.3 bits (59), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 103 EHIHEYKLTAYSLYAAVSVGLETHDIIEYLKRLSKTSVPDGIVEFINLCTLSYGKVKLV 161
           E I +Y+   YS     ++ ++ +DI   L      ++ D I  FIN C++SY   K++
Sbjct: 293 EEIIKYRYNIYSEKEKSNINIDFNDINSKLNEGINQAI-DNINNFINGCSVSYLMKKMI 350


>pdb|1EPW|A Chain A, Crystal Structure Of Clostridium Neurotoxin Type B
 pdb|1F31|A Chain A, Crystal Structure Of Clostridium Botulinum Neurotoxin B
           Complexed With A Trisaccharide
 pdb|1I1E|A Chain A, Crystal Structure Of Clostridium Botulinum Neurotoxin B
           Complexed With Doxorubicin
 pdb|1G9A|A Chain A, Crystal Structure Of Clostridium Botulinum Neurotoxin B
           Complexed With An Inhibitor (Experiment 3)
 pdb|1G9B|A Chain A, Crystal Structure Of Clostridium Botulinum Neurotoxin B
           Complexed With An Inhibitor (Experiment 1)
 pdb|1G9C|A Chain A, Crystal Structure Of Clostridium Botulinum Neurotoxin B
           Complexed With An Inhibitor (Experiment 4)
 pdb|1G9D|A Chain A, Crystal Structure Of Clostridium Botulinum Neurotoxin B
           Complexed With An Inhibitor (Experiment 2)
 pdb|1S0B|A Chain A, Crystal Structure Of Botulinum Neurotoxin Type B At Ph 4.0
 pdb|1S0C|A Chain A, Crystal Structure Of Botulinum Neurotoxin Type B At Ph 5.0
 pdb|1S0D|A Chain A, Crystal Structure Of Botulinum Neurotoxin Type B At Ph 5.5
 pdb|1S0E|A Chain A, Crystal Structure Of Botulinum Neurotoxin Type B At Ph 6.0
 pdb|1S0F|A Chain A, Crystal Structure Of Botulinum Neurotoxin Type B At Ph 7.0
 pdb|1S0G|A Chain A, Crystal Structure Of Botulinum Neurotoxin Type B Apo Form
 pdb|2NP0|A Chain A, Crystal Structure Of The Botulinum Neurotoxin Type B
           Complexed With Synaptotagamin-Ii Ectodomain
          Length = 1290

 Score = 26.9 bits (58), Expect = 9.0,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 103 EHIHEYKLTAYSLYAAVSVGLETHDIIEYLKRLSKTSVPDGIVEFINLCTLSYGKVKLV 161
           E I +Y+   YS     ++ ++ +DI   L      ++ D I  FIN C++SY   K++
Sbjct: 730 EEIIKYRYNIYSEKEKSNINIDFNDINSKLNEGINQAI-DNINNFINGCSVSYLMKKMI 787


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.318    0.137    0.402 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,922,947
Number of Sequences: 62578
Number of extensions: 290108
Number of successful extensions: 605
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 605
Number of HSP's gapped (non-prelim): 5
length of query: 219
length of database: 14,973,337
effective HSP length: 95
effective length of query: 124
effective length of database: 9,028,427
effective search space: 1119524948
effective search space used: 1119524948
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 49 (23.5 bits)