Diaphorina citri psyllid: psy11641


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------
MGRTAPAVIGTSYCHGSGSSQLFRLNAEGQLGHGERCVDADKQVISTQKSSLELRKRSSWLKVFKQIRSLGSPLAMFLDMGDISEQVALRDKLHCKDFSWFMKHVAYDVYTKFPELPPNLFWGEAKNLGTQKCLDSMGRTAPAVIGTSYCHGSGSSQLFRLNAEGQLGHGERCVDADKQEKLVEMLKLPVTFCVLAGVKLIFCRLGTVLNLFNCFNSSGTVDGPWRFHNSTRQLEHAILKRCLSVHPETNQLAMLRCDENNSYQQWRFKEVRPDWSS
ccccccccccEEEEECcccEEEEEccccccCEECcccccccccccHHHHHHHccEEEEEccHHHHHHHHcccccccccccccHHHHHHHHHHccccccHHHHHHHcccccccccccccccCEccccccccccccccccccccccEEEECccccccccEEEEcccccCCcccccccccccHHHHHHHccccEEEccccEEEEEEccccCEEEEEcccccccccccEEEEccccEEEEccccccccCCccccccEEEccccccccccEEEECccccccc
*****PA*IGTSYCHGSGSSQLFRLNAEGQLGHGERCVDA*****STQKSSLELRKRSSWLKVFKQIRSLGSPLAMFLDMGDISEQVALRDKLHCKDFSWFMKHVAYDVYTKFPELPPNLFWGEAKNLGTQKCLDSMGRTAPAVIGTSYCHGSGSSQLFRLNAEGQLGHGERCVDADKQEKLVEMLKLPVTFCVLAGVKLIFCRLGTVLNLFNCFNSSGTVDGPWRFHNSTRQLEHAILKRCLSVHPETNQLAMLRCDENNSYQQWRFKEVRP****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRTAPAVIGTSYCHGSGSSQLFRLNAEGQLGHGERCVDADKQVISTQKSSLELRKRSSWLKVFKQIRSLGSPLAMFLDMGDISEQVALRDKLHCKDFSWFMKHVAYDVYTKFPELPPNLFWGEAKNLGTQKCLDSMGRTAPAVIGTSYCHGSGSSQLFRLNAEGQLGHGERCVDADKQEKLVEMLKLPVTFCVLAGVKLIFCRLGTVLNLFNCFNSSGTVDGPWRFHNSTRQLEHAILKRCLSVHPETNQLAMLRCDENNSYQQWRFKEVRPDWSS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
N-acetylgalactosaminyltransferase 7 Glycopeptide transferase involved in O-linked oligosaccharide biosynthesis, which catalyzes the transfer of an N-acetyl-D-galactosamine residue to an already glycosylated peptide. In contrast to other proteins of the family, it does not act as a peptide transferase that transfers GalNAc onto serine or threonine residue on the protein receptor, but instead requires the prior addition of a GalNAc on a peptide before adding additional GalNAc moieties. Some peptide transferase activity is however not excluded, considering that its appropriate peptide substrate may remain unidentified. Prefers the monoglycosylated Muc5AC-3 as substrate.confidentQ8MV48

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004653 [MF]polypeptide N-acetylgalactosaminyltransferase activityprobableGO:0003824, GO:0016740, GO:0003674, GO:0016757, GO:0016758, GO:0008376, GO:0008194
GO:0006493 [BP]protein O-linked glycosylationprobableGO:0044249, GO:0044237, GO:0034645, GO:0009100, GO:0009101, GO:0044267, GO:0044260, GO:0071704, GO:1901576, GO:0009987, GO:0070085, GO:0006464, GO:0009058, GO:0036211, GO:0008150, GO:0008152, GO:0044723, GO:0044238, GO:0005975, GO:0006486, GO:1901137, GO:1901135, GO:0043412, GO:0009059, GO:0043170, GO:0019538, GO:0043413

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2FFU, chain A
Confidence level:very confident
Coverage over the Query: 10-180,205-271
View the alignment between query and template
View the model in PyMOL
Template: 2VSE, chain A
Confidence level:confident
Coverage over the Query: 7-63,94-105,119-180,195-270
View the alignment between query and template
View the model in PyMOL