Diaphorina citri psyllid: psy11642


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370--
RPVFKADGKLGNLEPPLEPYKEGPGEGGKAYHLPEAYRAAGDASLGEYGMNMETSNHISFDRTIPDLRMEECKYWDYPLDLPKASVILVFHNEGFSSLMRTVHSIIKRTPAQYLEEIILVDDFSSKADLDQKLEDYIQRFNGKVRLIRNTEREGLIRTRSRGAKESRGEVIVFLDAHCEVGLNWLPPLLAPIYSDRKIMTVPVIDGIDYQTWEFRSVYEPDHHYRGIFEWGMLYKENELPEREAKKRKYNSEPYKSPTHAGGLFAMDRAFFLELGGYDPGLLVWGGENFELSFKIWMCGGSIEWVPCSRIGHVYRSFMPYNFGKLADRVKGPLITYNYKRVIETWFDEKHKAYFYTREPLAMFLDMGDISEQ
cccccccccccccccccccccccccccccEEcccHHHHHHHHHHHHHccccHHHHccccccccccccccccccccccccccccEEEEEEEEccccHHHHHHHHHccccccHHHHcEEEEECcccccHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHccccccccEEEEEEcccccccccHHHHcccccccccEEEEEEEEEEcccccEEEECccccccCEEEEEEEEEEEEECccHHHHHHcccccccccccccccCEEEEEHHHHHHHcccccccccccccccEEEEEEEEEccEEEEEcccCEEEEcccccccccccccccccccHHHcccEEEEEEEcccccccHHHccccccccccccccccc
*P*FKADG**********************Y************SLGEYGMNMETSNHISFDRTIPDLRMEECKYWDYPLDLPKASVILVFHNEGFSSLMRTVHSIIKRTPAQYLEEIILVDDFSSKADLDQKLEDYIQRFNGKVRLIRNTEREGLIRTRSRGAKESRGEVIVFLDAHCEVGLNWLPPLLAPIYSDRKIMTVPVIDGIDYQTWEFRSVYEPDHHYRGIFEWGMLYKENELP**********SEPYKSPTHAGGLFAMDRAFFLELGGYDPGLLVWGGENFELSFKIWMCGGSIEWVPCSRIGHVYRSFMPYNFGKLADRVKGPLITYNYKRVIETWFDEKHKAYFYTREPLAMFLDMGDI***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RPVFKADGKLGNLEPPLEPYKEGPGEGGKAYHLPEAYRAAGDASLGEYGMNMETSNHISFDRTIPDLRMEECKYWDYPLDLPKASVILVFHNEGFSSLMRTVHSIIKRTPAQYLEEIILVDDFSSKADLDQKLEDYIQRFNGKVRLIRNTEREGLIRTRSRGAKESRGEVIVFLDAHCEVGLNWLPPLLAPIYSDRKIMTVPVIDGIDYQTWEFRSVYEPDHHYRGIFEWGMLYKENELPEREAKKRKYNSEPYKSPTHAGGLFAMDRAFFLELGGYDPGLLVWGGENFELSFKIWMCGGSIEWVPCSRIGHVYRSFMPYNFGKLADRVKGPLITYNYKRVIETWFDEKHKAYFYTREPLAMFLDMGDISEQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
N-acetylgalactosaminyltransferase 7 Glycopeptide transferase involved in O-linked oligosaccharide biosynthesis, which catalyzes the transfer of an N-acetyl-D-galactosamine residue to an already glycosylated peptide. In contrast to other proteins of the family, it does not act as a peptide transferase that transfers GalNAc onto serine or threonine residue on the protein receptor, but instead requires the prior addition of a GalNAc on a peptide before adding additional GalNAc moieties. Some peptide transferase activity is however not excluded, considering that its appropriate peptide substrate may remain unidentified. Prefers the monoglycosylated Muc5AC-3 as substrate.confidentQ8MV48
N-acetylgalactosaminyltransferase 7 Glycopeptide transferase involved in O-linked oligosaccharide biosynthesis, which catalyzes the transfer of an N-acetyl-D-galactosamine residue to an already glycosylated peptide. In contrast to other proteins of the family, it does not act as a peptide transferase that transfers GalNAc onto serine or threonine residue on the protein receptor, but instead requires the prior addition of a GalNAc on a peptide before adding additional GalNAc moieties. Some peptide transferase activity is however not excluded, considering that its appropriate peptide substrate may remain unidentified.confidentQ9R0C5
Probable N-acetylgalactosaminyltransferase 7 Probable glycopeptide transferase involved in O-linked oligosaccharide biosynthesis. Glycopeptide transferases catalyze the transfer of an N-acetyl-D-galactosamine residue to an already glycosylated peptide (By similarity). In contrast to other members of the family, it does not act as a peptide transferase that transfers GalNAc onto serine or threonine residue on peptides that have been tested. Some peptide transferase activity is however not excluded, considering that its appropriate peptide substrate may remain unidentified.confidentO61397

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0009312 [BP]oligosaccharide biosynthetic processprobableGO:1901576, GO:0005975, GO:0044238, GO:0009311, GO:0016051, GO:0071704, GO:0009058, GO:0008150, GO:0008152, GO:0044723
GO:0004653 [MF]polypeptide N-acetylgalactosaminyltransferase activityprobableGO:0003824, GO:0016740, GO:0003674, GO:0016757, GO:0016758, GO:0008376, GO:0008194
GO:0044431 [CC]Golgi apparatus partprobableGO:0005737, GO:0005794, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0030145 [MF]manganese ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0018243 [BP]protein O-linked glycosylation via threonineprobableGO:0044237, GO:0044249, GO:0018210, GO:0034645, GO:0009100, GO:0009101, GO:0044267, GO:0044260, GO:0018193, GO:0071704, GO:1901576, GO:0009987, GO:0070085, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0044723, GO:0005975, GO:0044238, GO:0006493, GO:0006486, GO:1901137, GO:1901135, GO:0009058, GO:0009059, GO:0043170, GO:0019538, GO:0043413
GO:0018242 [BP]protein O-linked glycosylation via serineprobableGO:0044249, GO:0044237, GO:0034645, GO:0009100, GO:0009101, GO:0044267, GO:0044260, GO:0018193, GO:0071704, GO:1901576, GO:0009987, GO:0070085, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0044723, GO:0018209, GO:0044238, GO:0006493, GO:0006486, GO:0005975, GO:1901137, GO:1901135, GO:0009058, GO:0009059, GO:0043170, GO:0019538, GO:0043413

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2D7I, chain A
Confidence level:very confident
Coverage over the Query: 20-372
View the alignment between query and template
View the model in PyMOL