Query         psy11667
Match_columns 119
No_of_seqs    121 out of 391
Neff          4.4 
Searched_HMMs 46136
Date          Fri Aug 16 15:47:39 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy11667.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/11667hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3173|consensus               99.9 2.4E-26 5.3E-31  175.8   6.5   69   50-119    99-167 (167)
  2 smart00154 ZnF_AN1 AN1-like Zi  99.5 5.8E-15 1.3E-19   89.3   2.2   38   59-97      1-39  (39)
  3 PF01428 zf-AN1:  AN1-like Zinc  99.1 1.2E-11 2.6E-16   75.5   1.4   38   59-98      1-41  (43)
  4 KOG3183|consensus               97.7 9.6E-06 2.1E-10   66.2  -0.2   45   49-93     91-138 (250)
  5 COG3582 Predicted nucleic acid  97.6 2.8E-05 6.1E-10   60.0   1.7   38   58-97     99-137 (162)
  6 KOG3183|consensus               97.0 0.00027 5.7E-09   57.9   1.1   39   57-97      9-50  (250)
  7 PF01363 FYVE:  FYVE zinc finge  94.0   0.034 7.4E-07   35.7   1.7   31   54-84      7-39  (69)
  8 cd00065 FYVE FYVE domain; Zinc  92.0   0.069 1.5E-06   32.9   0.8   27   57-83      3-31  (57)
  9 PF10571 UPF0547:  Uncharacteri  91.8   0.086 1.9E-06   29.3   1.0   23   57-80      1-24  (26)
 10 smart00064 FYVE Protein presen  91.7     0.1 2.2E-06   33.3   1.4   29   56-84     10-40  (68)
 11 KOG1818|consensus               86.1     0.3 6.5E-06   44.8   0.7   44   54-97    163-219 (634)
 12 PF15135 UPF0515:  Uncharacteri  80.4    0.94   2E-05   37.8   1.4   29   52-81    128-166 (278)
 13 PF00130 C1_1:  Phorbol esters/  80.1     1.2 2.5E-05   27.0   1.5   26   54-80      9-38  (53)
 14 PF02928 zf-C5HC2:  C5HC2 zinc   76.1     1.4 2.9E-05   27.8   0.9   27   59-86      1-29  (54)
 15 KOG0320|consensus               72.7     3.7 8.1E-05   32.7   2.8   47   49-95    124-173 (187)
 16 KOG1729|consensus               72.5    0.85 1.8E-05   38.1  -0.8   34   54-88    166-202 (288)
 17 KOG2807|consensus               70.9     2.7 5.9E-05   36.4   1.8   30   54-83    328-358 (378)
 18 PHA00626 hypothetical protein   68.3     2.6 5.7E-05   27.9   1.0   21   58-81     13-34  (59)
 19 KOG1819|consensus               67.7       3 6.5E-05   38.6   1.5   29   56-84    901-931 (990)
 20 PF13240 zinc_ribbon_2:  zinc-r  67.1     3.2 6.9E-05   22.2   1.0   21   58-79      1-22  (23)
 21 PRK14890 putative Zn-ribbon RN  64.2     2.8 6.2E-05   27.7   0.5   21   56-79     36-57  (59)
 22 COG2888 Predicted Zn-ribbon RN  63.6     2.7 5.9E-05   28.0   0.3   19   57-78     39-58  (61)
 23 PF07975 C1_4:  TFIIH C1-like d  63.3     3.3 7.1E-05   26.5   0.7   36   59-94      2-48  (51)
 24 KOG1812|consensus               59.9     4.7  0.0001   34.6   1.2   32   54-85    304-338 (384)
 25 PRK00398 rpoP DNA-directed RNA  59.3     5.7 0.00012   23.8   1.2   31   57-87      4-38  (46)
 26 PF02148 zf-UBP:  Zn-finger in   58.4     5.8 0.00013   25.2   1.2   23   59-83      1-24  (63)
 27 PF13842 Tnp_zf-ribbon_2:  DDE_  57.6     8.6 0.00019   22.0   1.7   27   58-84      2-30  (32)
 28 COG3582 Predicted nucleic acid  56.1     6.3 0.00014   30.6   1.2   49   59-109     3-52  (162)
 29 PTZ00303 phosphatidylinositol   54.3     6.2 0.00014   38.2   1.1   27   57-83    461-494 (1374)
 30 cd04476 RPA1_DBD_C RPA1_DBD_C:  54.1     5.9 0.00013   29.2   0.8   42   53-94     31-81  (166)
 31 cd00029 C1 Protein kinase C co  52.6     8.3 0.00018   22.4   1.1   24   56-79     11-37  (50)
 32 smart00109 C1 Protein kinase C  52.6     8.9 0.00019   21.9   1.2   25   55-79     10-36  (49)
 33 COG1571 Predicted DNA-binding   52.5     7.3 0.00016   34.4   1.2   52   55-106   349-405 (421)
 34 PF02318 FYVE_2:  FYVE-type zin  52.4     9.9 0.00022   27.1   1.7   33   55-87     53-88  (118)
 35 smart00290 ZnF_UBP Ubiquitin C  52.2     4.9 0.00011   24.0   0.1   24   58-84      1-25  (50)
 36 TIGR00622 ssl1 transcription f  51.8      13 0.00028   27.3   2.3   36   57-94     56-108 (112)
 37 PF13978 DUF4223:  Protein of u  51.5     7.1 0.00015   25.5   0.7   18   80-97     19-36  (56)
 38 PF03107 C1_2:  C1 domain;  Int  51.2      12 0.00026   20.8   1.6   21   58-79      2-24  (30)
 39 COG1996 RPC10 DNA-directed RNA  50.1     8.6 0.00019   24.5   0.9   33   56-88      6-42  (49)
 40 PF05207 zf-CSL:  CSL zinc fing  50.0       8 0.00017   24.5   0.8   12   71-82     18-29  (55)
 41 PF07649 C1_3:  C1-like domain;  49.3     7.9 0.00017   21.3   0.6   23   58-80      2-25  (30)
 42 PF03604 DNA_RNApol_7kD:  DNA d  48.4     8.8 0.00019   22.2   0.7   22   58-79      2-26  (32)
 43 PF01485 IBR:  IBR domain;  Int  47.7      11 0.00023   22.8   1.1   31   57-87     19-57  (64)
 44 PHA02768 hypothetical protein;  47.7     7.9 0.00017   25.1   0.5   13   70-82      4-17  (55)
 45 PF13248 zf-ribbon_3:  zinc-rib  47.7      11 0.00024   20.3   1.1   21   57-78      3-24  (26)
 46 KOG3507|consensus               46.6       5 0.00011   26.8  -0.5   33   51-83     15-50  (62)
 47 PRK07218 replication factor A;  46.5     9.3  0.0002   33.5   0.9   21   56-79    297-318 (423)
 48 PF10367 Vps39_2:  Vacuolar sor  46.0      14  0.0003   24.5   1.6   25   56-80     78-102 (109)
 49 PF09723 Zn-ribbon_8:  Zinc rib  45.7      12 0.00025   22.3   1.0   23   71-93      5-30  (42)
 50 PRK08402 replication factor A;  45.7      10 0.00022   32.5   1.0   30   56-86    212-245 (355)
 51 PHA03073 late transcription fa  45.2     4.2 9.2E-05   31.3  -1.2   21   48-68     41-61  (150)
 52 PF14471 DUF4428:  Domain of un  43.9     8.5 0.00018   24.2   0.2   23   58-80      1-30  (51)
 53 PF04438 zf-HIT:  HIT zinc fing  43.7      12 0.00025   21.2   0.7   23   57-83      3-26  (30)
 54 smart00647 IBR In Between Ring  43.6      15 0.00033   22.2   1.3   32   56-87     18-57  (64)
 55 PF00096 zf-C2H2:  Zinc finger,  43.5      11 0.00023   18.9   0.5   10   72-81      1-11  (23)
 56 KOG1074|consensus               43.4      18  0.0004   34.9   2.4   35   49-83    346-394 (958)
 57 PF01780 Ribosomal_L37ae:  Ribo  43.1     8.6 0.00019   27.3   0.2   36   52-87     31-70  (90)
 58 COG1997 RPL43A Ribosomal prote  41.9      13 0.00029   26.4   0.9   37   51-87     30-70  (89)
 59 smart00659 RPOLCX RNA polymera  41.4      13 0.00028   22.8   0.7   29   57-85      3-34  (44)
 60 KOG3362|consensus               40.6      13 0.00028   28.9   0.8   28   52-83    114-142 (156)
 61 PF10122 Mu-like_Com:  Mu-like   40.5      10 0.00022   24.4   0.2   25   56-80      4-34  (51)
 62 PF13717 zinc_ribbon_4:  zinc-r  40.2      14  0.0003   21.5   0.7   10   71-80     25-35  (36)
 63 PF09538 FYDLN_acid:  Protein o  39.7      18  0.0004   26.0   1.4   29   55-83      8-39  (108)
 64 KOG1842|consensus               39.2     7.5 0.00016   35.0  -0.8   25   57-81    181-207 (505)
 65 PF14446 Prok-RING_1:  Prokaryo  38.7      22 0.00047   23.0   1.5   25   55-80      4-31  (54)
 66 PF01529 zf-DHHC:  DHHC palmito  38.6      34 0.00073   24.7   2.7   46   50-100    42-87  (174)
 67 PF06750 DiS_P_DiS:  Bacterial   38.6      19  0.0004   25.0   1.3   25   54-78     31-66  (92)
 68 PF11781 RRN7:  RNA polymerase   38.0      17 0.00036   21.4   0.8   23   57-79      9-34  (36)
 69 PF13912 zf-C2H2_6:  C2H2-type   37.7      16 0.00034   19.0   0.6   12   71-82      1-13  (27)
 70 PF13894 zf-C2H2_4:  C2H2-type   37.6      15 0.00033   17.7   0.5    9   72-80      1-10  (24)
 71 KOG1074|consensus               37.4      23  0.0005   34.2   2.0   48   49-96    598-672 (958)
 72 PRK12366 replication factor A;  36.8      15 0.00032   33.5   0.7   31   55-86    531-563 (637)
 73 COG1439 Predicted nucleic acid  36.4      15 0.00031   29.0   0.5   30   49-79    132-162 (177)
 74 PF01194 RNA_pol_N:  RNA polyme  36.1      16 0.00035   24.1   0.6   13   56-68      4-16  (60)
 75 PF13824 zf-Mss51:  Zinc-finger  35.7      22 0.00047   23.1   1.2   25   58-82      1-27  (55)
 76 PF13465 zf-H2C2_2:  Zinc-finge  35.4      18 0.00039   19.3   0.6   11   70-80     13-24  (26)
 77 PRK04136 rpl40e 50S ribosomal   35.1      22 0.00048   22.7   1.1   25   53-78     11-36  (48)
 78 PF15227 zf-C3HC4_4:  zinc fing  34.8      22 0.00047   21.1   1.0   22   59-82      1-22  (42)
 79 PF09416 UPF1_Zn_bind:  RNA hel  34.8      20 0.00044   27.6   1.1   26   58-84      2-28  (152)
 80 PLN02569 threonine synthase     34.3      35 0.00076   30.2   2.6   35   52-86     45-80  (484)
 81 COG5574 PEX10 RING-finger-cont  34.3      15 0.00032   30.8   0.3   28   56-86    215-243 (271)
 82 PF08882 Acetone_carb_G:  Aceto  34.0      22 0.00047   26.3   1.1   32   61-95     17-48  (112)
 83 smart00661 RPOL9 RNA polymeras  33.6      28 0.00061   20.7   1.4   22   58-79      2-29  (52)
 84 PRK04016 DNA-directed RNA poly  33.6      15 0.00033   24.5   0.2   13   56-68      4-16  (62)
 85 COG3357 Predicted transcriptio  33.4      16 0.00035   26.3   0.3   18   64-82     52-70  (97)
 86 PF09862 DUF2089:  Protein of u  32.8      21 0.00047   26.1   0.9   28   59-87      1-29  (113)
 87 PRK00464 nrdR transcriptional   32.5      26 0.00055   26.7   1.3   14   72-85     29-43  (154)
 88 TIGR00280 L37a ribosomal prote  32.4      22 0.00047   25.3   0.8   34   52-86     31-69  (91)
 89 PTZ00255 60S ribosomal protein  32.3      24 0.00053   25.0   1.1   34   51-84     31-68  (90)
 90 PF01927 Mut7-C:  Mut7-C RNAse   31.8      34 0.00074   25.1   1.8   29   53-81     88-135 (147)
 91 PF15549 PGC7_Stella:  PGC7/Ste  31.5      27 0.00058   27.2   1.3   20   70-91    122-141 (160)
 92 PF14369 zf-RING_3:  zinc-finge  31.4      26 0.00056   20.4   0.9   23   58-80      4-31  (35)
 93 PF07282 OrfB_Zn_ribbon:  Putat  31.4      34 0.00073   21.6   1.5   25   55-79     27-55  (69)
 94 PRK05978 hypothetical protein;  31.3      26 0.00057   26.7   1.2   27   54-80     31-62  (148)
 95 PRK03976 rpl37ae 50S ribosomal  31.1      25 0.00053   25.0   0.9   31   52-83     32-67  (90)
 96 PLN00032 DNA-directed RNA poly  30.9      18  0.0004   24.7   0.2   13   56-68      4-16  (71)
 97 KOG2462|consensus               30.3      85  0.0019   26.5   4.1   49   51-101   125-199 (279)
 98 PRK12496 hypothetical protein;  30.3      24 0.00051   26.8   0.8   31   49-79    120-152 (164)
 99 TIGR00627 tfb4 transcription f  29.1      39 0.00085   28.0   1.9   28   55-84    241-269 (279)
100 PF13771 zf-HC5HC2H:  PHD-like   29.1      39 0.00084   22.1   1.6   24   50-75     30-53  (90)
101 PRK06386 replication factor A;  28.9      25 0.00055   30.3   0.8   20   56-78    236-256 (358)
102 PF13832 zf-HC5HC2H_2:  PHD-zin  28.6      39 0.00085   23.1   1.6   20   54-75     53-72  (110)
103 PF14835 zf-RING_6:  zf-RING of  28.0      32  0.0007   23.1   1.0   25   57-83      8-33  (65)
104 COG0675 Transposase and inacti  27.5      36 0.00078   26.2   1.4   24   54-79    307-331 (364)
105 TIGR02098 MJ0042_CXXC MJ0042 f  27.3      28 0.00061   19.7   0.6    9   72-80     26-35  (38)
106 smart00834 CxxC_CXXC_SSSS Puta  26.3      31 0.00068   19.4   0.7   23   71-93      5-30  (41)
107 PF02207 zf-UBR:  Putative zinc  26.1      38 0.00083   22.0   1.1   15   71-85     50-71  (71)
108 COG5432 RAD18 RING-finger-cont  25.8      23 0.00051   30.6   0.1   26   56-83     25-50  (391)
109 PRK00432 30S ribosomal protein  25.4      38 0.00083   21.1   1.0   28   54-81     18-48  (50)
110 KOG0193|consensus               25.3      26 0.00057   32.7   0.3   49   59-112   192-243 (678)
111 KOG3497|consensus               24.9      26 0.00056   23.7   0.1   13   56-68      4-16  (69)
112 COG1933 Archaeal DNA polymeras  24.5      28  0.0006   29.0   0.3   26   54-79    165-192 (253)
113 PF06689 zf-C4_ClpX:  ClpX C4-t  24.1      31 0.00068   20.5   0.4   11   57-67      2-12  (41)
114 smart00132 LIM Zinc-binding do  24.0      44 0.00094   17.8   0.9    6   59-64      2-7   (39)
115 PF09779 Ima1_N:  Ima1 N-termin  23.4      47   0.001   24.3   1.3   22   58-79      2-29  (131)
116 TIGR02300 FYDLN_acid conserved  23.4      47   0.001   25.1   1.3   26   55-80      8-36  (129)
117 COG1644 RPB10 DNA-directed RNA  23.2      27 0.00059   23.4  -0.0   13   56-68      4-16  (63)
118 TIGR02605 CxxC_CxxC_SSSS putat  22.8      41 0.00089   20.1   0.7   23   71-93      5-30  (52)
119 PF04236 Transp_Tc5_C:  Tc5 tra  22.2      40 0.00088   22.2   0.7   32   57-92     28-63  (63)
120 PF08646 Rep_fac-A_C:  Replicat  22.1      29 0.00062   25.0  -0.1   32   55-86     17-54  (146)
121 COG3877 Uncharacterized protei  22.0      59  0.0013   24.2   1.5   33   54-87      4-37  (122)
122 TIGR00373 conserved hypothetic  21.6      39 0.00085   25.4   0.6   26   54-79    107-137 (158)
123 COG1656 Uncharacterized conser  20.9      42 0.00091   26.2   0.6   16   53-68     94-109 (165)
124 PF06467 zf-FCS:  MYM-type Zinc  20.8      40 0.00086   19.3   0.4   15   54-68      4-18  (43)
125 PF14803 Nudix_N_2:  Nudix N-te  20.7      49  0.0011   19.2   0.8   11   58-68      2-12  (34)
126 PF00412 LIM:  LIM domain;  Int  20.7      34 0.00074   20.3   0.1   25   58-83     28-52  (58)
127 PF08073 CHDNT:  CHDNT (NUC034)  20.6      36 0.00079   22.1   0.2   20   98-117    21-40  (55)
128 PF12773 DZR:  Double zinc ribb  20.4      70  0.0015   18.9   1.4   26   54-79     10-38  (50)
129 PF00628 PHD:  PHD-finger;  Int  20.4      66  0.0014   18.8   1.3   22   58-79      1-23  (51)
130 PRK08329 threonine synthase; V  20.2      61  0.0013   26.9   1.5   31   57-87      2-32  (347)

No 1  
>KOG3173|consensus
Probab=99.93  E-value=2.4e-26  Score=175.78  Aligned_cols=69  Identities=45%  Similarity=0.962  Sum_probs=64.9

Q ss_pred             ccCCcCCCcccccccccccccceeeccCCcccCCCCCCCCCCCccccHHhhHHHHHHhCCcccccccccC
Q psy11667         50 KKTKHKRSRCAQCNAKLTVCSSFTCRCRKLFCPRHRHPEEHACTFDYKAYGRHLLAATNPLVVADKVVRI  119 (119)
Q Consensus        50 ~~~~~~k~RC~~C~kkl~Ls~~f~CrCg~~FC~~HR~pe~H~C~fDyk~~gr~~Lak~NP~v~~~Kl~ki  119 (119)
                      ....+.++||+.|+|++|| ++|.||||++||..|||+|.|+|.||||.+||+.|+++||+|+++||.||
T Consensus        99 ~~~~~~~~rC~~C~kk~gl-tgf~CrCG~~fC~~HRy~e~H~C~fDyK~~gr~~i~k~nP~v~a~k~~ki  167 (167)
T KOG3173|consen   99 ESKPKKKKRCFKCRKKVGL-TGFKCRCGNTFCGTHRYPEQHDCSFDYKQAGREKIAKANPVVKADKLQKI  167 (167)
T ss_pred             ccccccchhhhhhhhhhcc-cccccccCCcccccccCCccccccccHHHHHHHHHHHhCCeeeccccccC
Confidence            4455677889999999999 78999999999999999999999999999999999999999999999998


No 2  
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=99.51  E-value=5.8e-15  Score=89.32  Aligned_cols=38  Identities=50%  Similarity=1.170  Sum_probs=36.1

Q ss_pred             ccccccccccccceeec-cCCcccCCCCCCCCCCCccccH
Q psy11667         59 CAQCNAKLTVCSSFTCR-CRKLFCPRHRHPEEHACTFDYK   97 (119)
Q Consensus        59 C~~C~kkl~Ls~~f~Cr-Cg~~FC~~HR~pe~H~C~fDyk   97 (119)
                      |+.|+++++| ++|+|+ |+++||+.||++|+|+|++||+
T Consensus         1 C~~C~~~~~l-~~f~C~~C~~~FC~~HR~~e~H~C~~~~k   39 (39)
T smart00154        1 CHFCRKKVGL-TGFKCRHCGNLFCGEHRLPEDHDCPGDYK   39 (39)
T ss_pred             CcccCCcccc-cCeECCccCCccccccCCccccCCccccC
Confidence            7889999999 699999 9999999999999999999985


No 3  
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=99.15  E-value=1.2e-11  Score=75.51  Aligned_cols=38  Identities=42%  Similarity=0.947  Sum_probs=27.7

Q ss_pred             ccc--cccccccccceeec-cCCcccCCCCCCCCCCCccccHH
Q psy11667         59 CAQ--CNAKLTVCSSFTCR-CRKLFCPRHRHPEEHACTFDYKA   98 (119)
Q Consensus        59 C~~--C~kkl~Ls~~f~Cr-Cg~~FC~~HR~pe~H~C~fDyk~   98 (119)
                      |+.  |++++.|  +|.|+ |+..||.+||++++|.|+++++.
T Consensus         1 C~~~~C~~~~~~--~~~C~~C~~~FC~~Hr~~e~H~C~~~~~~   41 (43)
T PF01428_consen    1 CSFPGCKKKDFL--PFKCKHCGKSFCLKHRLPEDHNCSKLQKK   41 (43)
T ss_dssp             -SSTTT--BCTS--HEE-TTTS-EE-TTTHSTTTCT-SSTTSC
T ss_pred             CccCcCcCccCC--CeECCCCCcccCccccCccccCCcchhhc
Confidence            566  9998875  99999 99999999999999999998763


No 4  
>KOG3183|consensus
Probab=97.65  E-value=9.6e-06  Score=66.22  Aligned_cols=45  Identities=40%  Similarity=0.927  Sum_probs=41.1

Q ss_pred             cccCCcCCCcccc--cccccccccceeec-cCCcccCCCCCCCCCCCc
Q psy11667         49 VKKTKHKRSRCAQ--CNAKLTVCSSFTCR-CRKLFCPRHRHPEEHACT   93 (119)
Q Consensus        49 ~~~~~~~k~RC~~--C~kkl~Ls~~f~Cr-Cg~~FC~~HR~pe~H~C~   93 (119)
                      ..+++..+++|..  |++++.+++.+.|+ |+..||.+||++-+|.|.
T Consensus        91 ~~~~k~~t~kc~~~~c~k~~~~~~~~~c~~c~~~~c~khr~~~dhsc~  138 (250)
T KOG3183|consen   91 QKKRKVFTNKCPVPRCKKTLTLANKITCSKCGRNFCLKHRHPLDHSCN  138 (250)
T ss_pred             hhhcccccccCCchhhHHHHHHHHhhhhHhhcchhhhhccCCCCchhh
Confidence            4567788889997  99999998889999 999999999999999998


No 5  
>COG3582 Predicted nucleic acid binding protein containing the AN1-type Zn-finger [General function prediction only]
Probab=97.60  E-value=2.8e-05  Score=60.04  Aligned_cols=38  Identities=29%  Similarity=0.504  Sum_probs=32.0

Q ss_pred             cccccccccccccceeec-cCCcccCCCCCCCCCCCccccH
Q psy11667         58 RCAQCNAKLTVCSSFTCR-CRKLFCPRHRHPEEHACTFDYK   97 (119)
Q Consensus        58 RC~~C~kkl~Ls~~f~Cr-Cg~~FC~~HR~pe~H~C~fDyk   97 (119)
                      .|..|++..+|  .++|. |++.||+.||+++.|+|.+-..
T Consensus        99 ~~~~~g~~s~l--~~~c~~c~g~fc~~h~lp~nhdc~~L~s  137 (162)
T COG3582          99 TPQCTGKGSTL--AGKCNYCTGYFCAEHRLPENHDCNGLGS  137 (162)
T ss_pred             cceeccCCccc--cccccCCCCcceeceecccccccccHHH
Confidence            34447777777  89999 9999999999999999997543


No 6  
>KOG3183|consensus
Probab=96.99  E-value=0.00027  Score=57.90  Aligned_cols=39  Identities=31%  Similarity=0.761  Sum_probs=32.9

Q ss_pred             Cccc--ccccccccccceeec-cCCcccCCCCCCCCCCCccccH
Q psy11667         57 SRCA--QCNAKLTVCSSFTCR-CRKLFCPRHRHPEEHACTFDYK   97 (119)
Q Consensus        57 ~RC~--~C~kkl~Ls~~f~Cr-Cg~~FC~~HR~pe~H~C~fDyk   97 (119)
                      ..|.  .|+..--  ++|+|- |+..||+.||.-+.|.|++-+.
T Consensus         9 kHCs~~~CkqlDF--LPf~Cd~C~~~FC~eHrsye~H~Cp~~~~   50 (250)
T KOG3183|consen    9 KHCSVPYCKQLDF--LPFKCDGCSGIFCLEHRSYESHHCPKGLR   50 (250)
T ss_pred             cccCcchhhhccc--cceeeCCccchhhhccchHhhcCCCcccc
Confidence            3677  5887543  499999 9999999999999999998665


No 7  
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=94.00  E-value=0.034  Score=35.66  Aligned_cols=31  Identities=26%  Similarity=0.773  Sum_probs=17.5

Q ss_pred             cCCCcccccccccccc-cceeec-cCCcccCCC
Q psy11667         54 HKRSRCAQCNAKLTVC-SSFTCR-CRKLFCPRH   84 (119)
Q Consensus        54 ~~k~RC~~C~kkl~Ls-~~f~Cr-Cg~~FC~~H   84 (119)
                      .....|..|+++.++. .-..|| ||.+||+.+
T Consensus         7 ~~~~~C~~C~~~F~~~~rrhhCr~CG~~vC~~C   39 (69)
T PF01363_consen    7 SEASNCMICGKKFSLFRRRHHCRNCGRVVCSSC   39 (69)
T ss_dssp             GG-SB-TTT--B-BSSS-EEE-TTT--EEECCC
T ss_pred             CCCCcCcCcCCcCCCceeeEccCCCCCEECCch
Confidence            4456899999998874 578999 999999654


No 8  
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=91.98  E-value=0.069  Score=32.86  Aligned_cols=27  Identities=33%  Similarity=1.005  Sum_probs=22.7

Q ss_pred             Ccccccccccccc-cceeec-cCCcccCC
Q psy11667         57 SRCAQCNAKLTVC-SSFTCR-CRKLFCPR   83 (119)
Q Consensus        57 ~RC~~C~kkl~Ls-~~f~Cr-Cg~~FC~~   83 (119)
                      ..|..|++.+++. ....|+ ||.+||..
T Consensus         3 ~~C~~C~~~F~~~~rk~~Cr~Cg~~~C~~   31 (57)
T cd00065           3 SSCMGCGKPFTLTRRRHHCRNCGRIFCSK   31 (57)
T ss_pred             CcCcccCccccCCccccccCcCcCCcChH
Confidence            5799999988874 488999 99999874


No 9  
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=91.82  E-value=0.086  Score=29.34  Aligned_cols=23  Identities=30%  Similarity=0.706  Sum_probs=20.2

Q ss_pred             Ccccccccccccccceeec-cCCcc
Q psy11667         57 SRCAQCNAKLTVCSSFTCR-CRKLF   80 (119)
Q Consensus        57 ~RC~~C~kkl~Ls~~f~Cr-Cg~~F   80 (119)
                      .+|..|++.+.+ ....|- ||+.|
T Consensus         1 K~CP~C~~~V~~-~~~~Cp~CG~~F   24 (26)
T PF10571_consen    1 KTCPECGAEVPE-SAKFCPHCGYDF   24 (26)
T ss_pred             CcCCCCcCCchh-hcCcCCCCCCCC
Confidence            379999999988 788999 99887


No 10 
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the KOG1818|consensus
Probab=86.05  E-value=0.3  Score=44.84  Aligned_cols=44  Identities=23%  Similarity=0.658  Sum_probs=33.4

Q ss_pred             cCCCcccccccccccc-cceeec-cCCcccCCCC-----------CCCCCCCccccH
Q psy11667         54 HKRSRCAQCNAKLTVC-SSFTCR-CRKLFCPRHR-----------HPEEHACTFDYK   97 (119)
Q Consensus        54 ~~k~RC~~C~kkl~Ls-~~f~Cr-Cg~~FC~~HR-----------~pe~H~C~fDyk   97 (119)
                      .....|..|+.+.++. ....|| ||.+||..|=           |-+.--|..+|.
T Consensus       163 ~D~~~C~rCr~~F~~~~rkHHCr~CG~vFC~qcss~s~~lP~~Gi~~~VRVCd~C~E  219 (634)
T KOG1818|consen  163 IDSEECLRCRVKFGLTNRKHHCRNCGQVFCGQCSSKSLTLPKLGIEKPVRVCDSCYE  219 (634)
T ss_pred             ccccccceeeeeeeeccccccccccchhhccCccccccCcccccccccceehhhhHH
Confidence            4456899999999985 367999 9999999884           334556766664


No 12 
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=80.36  E-value=0.94  Score=37.83  Aligned_cols=29  Identities=31%  Similarity=0.855  Sum_probs=23.1

Q ss_pred             CCcCCCcccccccc---------cccccceeec-cCCccc
Q psy11667         52 TKHKRSRCAQCNAK---------LTVCSSFTCR-CRKLFC   81 (119)
Q Consensus        52 ~~~~k~RC~~C~kk---------l~Ls~~f~Cr-Cg~~FC   81 (119)
                      ..+..+||..|+++         +|+ .-|.|. |+..|=
T Consensus       128 ~rKeVSRCr~C~~rYDPVP~dkmwG~-aef~C~~C~h~F~  166 (278)
T PF15135_consen  128 QRKEVSRCRKCRKRYDPVPCDKMWGI-AEFHCPKCRHNFR  166 (278)
T ss_pred             cccccccccccccccCCCccccccce-eeeecccccccch
Confidence            35667899999876         777 689997 999873


No 13 
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=80.10  E-value=1.2  Score=27.00  Aligned_cols=26  Identities=19%  Similarity=0.589  Sum_probs=18.8

Q ss_pred             cCCCccccccccc---ccccceeec-cCCcc
Q psy11667         54 HKRSRCAQCNAKL---TVCSSFTCR-CRKLF   80 (119)
Q Consensus        54 ~~k~RC~~C~kkl---~Ls~~f~Cr-Cg~~F   80 (119)
                      .....|..|++.+   ++ .++.|. |+..+
T Consensus         9 ~~~~~C~~C~~~i~g~~~-~g~~C~~C~~~~   38 (53)
T PF00130_consen    9 SKPTYCDVCGKFIWGLGK-QGYRCSWCGLVC   38 (53)
T ss_dssp             SSTEB-TTSSSBECSSSS-CEEEETTTT-EE
T ss_pred             CCCCCCcccCcccCCCCC-CeEEECCCCChH
Confidence            3456899999988   44 799999 98763


No 14 
>PF02928 zf-C5HC2:  C5HC2 zinc finger;  InterPro: IPR004198 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a predicted zinc finger with eight potential zinc ligand binding residues. This domain is found in Jumonji [], and may have a DNA binding function. The mouse jumonji protein is required for neural tube formation, and is essential for normal heart development. It also plays a role in the down-regulation of cell proliferation signalling. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0005634 nucleus
Probab=76.09  E-value=1.4  Score=27.78  Aligned_cols=27  Identities=41%  Similarity=0.926  Sum_probs=22.9

Q ss_pred             ccccccccccccceeecc--CCcccCCCCC
Q psy11667         59 CAQCNAKLTVCSSFTCRC--RKLFCPRHRH   86 (119)
Q Consensus        59 C~~C~kkl~Ls~~f~CrC--g~~FC~~HR~   86 (119)
                      |..|+.-.-| ..+.|.|  +.++|..|-.
T Consensus         1 C~~Ck~~~yL-S~v~C~C~~~~~~CL~H~~   29 (54)
T PF02928_consen    1 CSICKAYCYL-SAVTCSCKPDKVVCLRHAK   29 (54)
T ss_pred             CcccCCchhh-cccccCCCCCcEEccccch
Confidence            7789998888 6889997  8899999954


No 15 
>KOG0320|consensus
Probab=72.71  E-value=3.7  Score=32.68  Aligned_cols=47  Identities=15%  Similarity=0.396  Sum_probs=27.8

Q ss_pred             cccCCcCCCcccccccccccccceeeccCCcccCC---CCCCCCCCCccc
Q psy11667         49 VKKTKHKRSRCAQCNAKLTVCSSFTCRCRKLFCPR---HRHPEEHACTFD   95 (119)
Q Consensus        49 ~~~~~~~k~RC~~C~kkl~Ls~~f~CrCg~~FC~~---HR~pe~H~C~fD   95 (119)
                      .+..+.....|..|-..+.--..+.=+||.+||..   -=+...|.|+.=
T Consensus       124 ~~~~~~~~~~CPiCl~~~sek~~vsTkCGHvFC~~Cik~alk~~~~CP~C  173 (187)
T KOG0320|consen  124 DPLRKEGTYKCPICLDSVSEKVPVSTKCGHVFCSQCIKDALKNTNKCPTC  173 (187)
T ss_pred             cccccccccCCCceecchhhccccccccchhHHHHHHHHHHHhCCCCCCc
Confidence            34445556789998654443234666799999964   223334555543


No 16 
>KOG1729|consensus
Probab=72.48  E-value=0.85  Score=38.08  Aligned_cols=34  Identities=21%  Similarity=0.679  Sum_probs=26.4

Q ss_pred             cCCCccccccc-ccccc-cceeec-cCCcccCCCCCCC
Q psy11667         54 HKRSRCAQCNA-KLTVC-SSFTCR-CRKLFCPRHRHPE   88 (119)
Q Consensus        54 ~~k~RC~~C~k-kl~Ls-~~f~Cr-Cg~~FC~~HR~pe   88 (119)
                      ...+.|..|.+ .-.|+ .--+|| ||.+||. |....
T Consensus       166 ~ea~~C~~C~~~~Ftl~~RRHHCR~CG~ivC~-~Cs~n  202 (288)
T KOG1729|consen  166 SEATECMVCGCTEFTLSERRHHCRNCGDIVCA-PCSRN  202 (288)
T ss_pred             ccceecccCCCccccHHHHHHHHHhcchHhhh-hhhcC
Confidence            35679999999 66664 467899 9999999 76554


No 17 
>KOG2807|consensus
Probab=70.95  E-value=2.7  Score=36.44  Aligned_cols=30  Identities=23%  Similarity=0.788  Sum_probs=23.1

Q ss_pred             cCCCcccccccccccccceeec-cCCcccCC
Q psy11667         54 HKRSRCAQCNAKLTVCSSFTCR-CRKLFCPR   83 (119)
Q Consensus        54 ~~k~RC~~C~kkl~Ls~~f~Cr-Cg~~FC~~   83 (119)
                      ...++|+.|.-.+.-+..|.|. |.++||..
T Consensus       328 ~~~~~Cf~C~~~~~~~~~y~C~~Ck~~FCld  358 (378)
T KOG2807|consen  328 NGSRFCFACQGELLSSGRYRCESCKNVFCLD  358 (378)
T ss_pred             CCCcceeeeccccCCCCcEEchhccceeecc
Confidence            4556799995544444799999 99999974


No 18 
>PHA00626 hypothetical protein
Probab=68.31  E-value=2.6  Score=27.88  Aligned_cols=21  Identities=10%  Similarity=0.195  Sum_probs=14.4

Q ss_pred             cccccccccccccceeec-cCCccc
Q psy11667         58 RCAQCNAKLTVCSSFTCR-CRKLFC   81 (119)
Q Consensus        58 RC~~C~kkl~Ls~~f~Cr-Cg~~FC   81 (119)
                      ||.+|++.   ++.|.|. ||+.|-
T Consensus        13 rcg~cr~~---snrYkCkdCGY~ft   34 (59)
T PHA00626         13 KEKTMRGW---SDDYVCCDCGYNDS   34 (59)
T ss_pred             eeceeccc---CcceEcCCCCCeec
Confidence            55666653   3679999 987774


No 19 
>KOG1819|consensus
Probab=67.65  E-value=3  Score=38.61  Aligned_cols=29  Identities=24%  Similarity=0.808  Sum_probs=20.9

Q ss_pred             CCcccccccccccc-cceeec-cCCcccCCC
Q psy11667         56 RSRCAQCNAKLTVC-SSFTCR-CRKLFCPRH   84 (119)
Q Consensus        56 k~RC~~C~kkl~Ls-~~f~Cr-Cg~~FC~~H   84 (119)
                      -.+|..|....... ....|| ||++||.+-
T Consensus       901 a~~cmacq~pf~afrrrhhcrncggifcg~c  931 (990)
T KOG1819|consen  901 AEQCMACQMPFNAFRRRHHCRNCGGIFCGKC  931 (990)
T ss_pred             chhhhhccCcHHHHHHhhhhcccCceeeccc
Confidence            45888888755432 356899 999999763


No 20 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=67.05  E-value=3.2  Score=22.22  Aligned_cols=21  Identities=24%  Similarity=0.651  Sum_probs=14.3

Q ss_pred             cccccccccccccceeec-cCCc
Q psy11667         58 RCAQCNAKLTVCSSFTCR-CRKL   79 (119)
Q Consensus        58 RC~~C~kkl~Ls~~f~Cr-Cg~~   79 (119)
                      +|..|+..+.- ....|. ||..
T Consensus         1 ~Cp~CG~~~~~-~~~fC~~CG~~   22 (23)
T PF13240_consen    1 YCPNCGAEIED-DAKFCPNCGTP   22 (23)
T ss_pred             CCcccCCCCCC-cCcchhhhCCc
Confidence            47778888766 555577 7653


No 21 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=64.19  E-value=2.8  Score=27.70  Aligned_cols=21  Identities=29%  Similarity=0.751  Sum_probs=13.3

Q ss_pred             CCcccccccccccccceeec-cCCc
Q psy11667         56 RSRCAQCNAKLTVCSSFTCR-CRKL   79 (119)
Q Consensus        56 k~RC~~C~kkl~Ls~~f~Cr-Cg~~   79 (119)
                      -.||..||+   +++.|.|- ||+.
T Consensus        36 I~RC~~CRk---~~~~Y~CP~CGF~   57 (59)
T PRK14890         36 IYRCEKCRK---QSNPYTCPKCGFE   57 (59)
T ss_pred             EeechhHHh---cCCceECCCCCCc
Confidence            346767766   33578885 8763


No 22 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=63.56  E-value=2.7  Score=28.01  Aligned_cols=19  Identities=32%  Similarity=0.936  Sum_probs=11.4

Q ss_pred             Ccccccccccccccceeec-cCC
Q psy11667         57 SRCAQCNAKLTVCSSFTCR-CRK   78 (119)
Q Consensus        57 ~RC~~C~kkl~Ls~~f~Cr-Cg~   78 (119)
                      .||..||+   |++.|.|- ||+
T Consensus        39 ~Rc~~CRk---~g~~Y~Cp~CGF   58 (61)
T COG2888          39 YRCAKCRK---LGNPYRCPKCGF   58 (61)
T ss_pred             ehhhhHHH---cCCceECCCcCc
Confidence            45666665   33577774 775


No 23 
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=63.33  E-value=3.3  Score=26.46  Aligned_cols=36  Identities=28%  Similarity=0.694  Sum_probs=17.1

Q ss_pred             ccccccccccc-------cceeec-cCCcccCC---CCCCCCCCCcc
Q psy11667         59 CAQCNAKLTVC-------SSFTCR-CRKLFCPR---HRHPEEHACTF   94 (119)
Q Consensus        59 C~~C~kkl~Ls-------~~f~Cr-Cg~~FC~~---HR~pe~H~C~f   94 (119)
                      |+.|.+.+...       ..|.|. |+..||..   --+-.-|+|++
T Consensus         2 CfgC~~~~~~~~~~~~~~~~y~C~~C~~~FC~dCD~fiHE~LH~CPG   48 (51)
T PF07975_consen    2 CFGCQKPFPDGPEKKADSSRYRCPKCKNHFCIDCDVFIHETLHNCPG   48 (51)
T ss_dssp             ETTTTEE-TTS-------EEE--TTTT--B-HHHHHTTTTTS-SSST
T ss_pred             CccCCCCCCCcccccccCCeEECCCCCCccccCcChhhhccccCCcC
Confidence            66676666542       479999 99999863   22233377764


No 24 
>KOG1812|consensus
Probab=59.90  E-value=4.7  Score=34.56  Aligned_cols=32  Identities=25%  Similarity=0.744  Sum_probs=25.9

Q ss_pred             cCCCcccccccccccc---cceeeccCCcccCCCC
Q psy11667         54 HKRSRCAQCNAKLTVC---SSFTCRCRKLFCPRHR   85 (119)
Q Consensus        54 ~~k~RC~~C~kkl~Ls---~~f~CrCg~~FC~~HR   85 (119)
                      +.-.+|..|+-.+.++   +-++||||..||..=.
T Consensus       304 ~~wr~CpkC~~~ie~~~GCnhm~CrC~~~fcy~C~  338 (384)
T KOG1812|consen  304 KRWRQCPKCKFMIELSEGCNHMTCRCGHQFCYMCG  338 (384)
T ss_pred             HhcCcCcccceeeeecCCcceEEeeccccchhhcC
Confidence            4556899999877775   5789999999998766


No 25 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=59.26  E-value=5.7  Score=23.85  Aligned_cols=31  Identities=23%  Similarity=0.620  Sum_probs=21.4

Q ss_pred             Ccccccccccccc---cceeec-cCCcccCCCCCC
Q psy11667         57 SRCAQCNAKLTVC---SSFTCR-CRKLFCPRHRHP   87 (119)
Q Consensus        57 ~RC~~C~kkl~Ls---~~f~Cr-Cg~~FC~~HR~p   87 (119)
                      .+|..|+..+.+.   ..+.|. ||..+--++|-+
T Consensus         4 y~C~~CG~~~~~~~~~~~~~Cp~CG~~~~~~~~~~   38 (46)
T PRK00398          4 YKCARCGREVELDEYGTGVRCPYCGYRILFKERPP   38 (46)
T ss_pred             EECCCCCCEEEECCCCCceECCCCCCeEEEccCCC
Confidence            4788888876442   267888 888777666643


No 26 
>PF02148 zf-UBP:  Zn-finger in ubiquitin-hydrolases and other protein;  InterPro: IPR001607 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents UBP-type zinc finger domains, which display some similarity with the Zn-binding domain of the insulinase family. The UBP-type zinc finger domain is found only in a small subfamily of ubiquitin C-terminal hydrolases (deubiquitinases or UBP) [, ], All members of this subfamily are isopeptidase-T, which are known to cleave isopeptide bonds between ubiquitin moieties. Some of the proteins containing an UBP zinc finger include:    Homo sapiens (Human) deubiquitinating enzyme 13 (UBPD) Human deubiquitinating enzyme 5 (UBP5)  Dictyostelium discoideum (Slime mold) deubiquitinating enzyme A (UBPA)  Saccharomyces cerevisiae (Baker's yeast) deubiquitinating enzyme 8 (UBP8) Yeast deubiquitinating enzyme 14 (UBP14)   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3GV4_A 3PHD_B 3C5K_A 2UZG_A 3IHP_B 2G43_B 2G45_D 2I50_A 3MHH_A 3MHS_A ....
Probab=58.45  E-value=5.8  Score=25.24  Aligned_cols=23  Identities=26%  Similarity=0.778  Sum_probs=15.0

Q ss_pred             ccccccccccccceeec-cCCcccCC
Q psy11667         59 CAQCNAKLTVCSSFTCR-CRKLFCPR   83 (119)
Q Consensus        59 C~~C~kkl~Ls~~f~Cr-Cg~~FC~~   83 (119)
                      |..|+.. +- .-+.|- ||.++|..
T Consensus         1 C~~C~~~-~~-~lw~CL~Cg~~~C~~   24 (63)
T PF02148_consen    1 CSVCGST-NS-NLWLCLTCGYVGCGR   24 (63)
T ss_dssp             -SSSHTC-SS-SEEEETTTS-EEETT
T ss_pred             CCCCCCc-CC-ceEEeCCCCcccccC
Confidence            5667755 22 457799 99999994


No 27 
>PF13842 Tnp_zf-ribbon_2:  DDE_Tnp_1-like zinc-ribbon
Probab=57.62  E-value=8.6  Score=22.00  Aligned_cols=27  Identities=26%  Similarity=0.711  Sum_probs=19.1

Q ss_pred             cccccccccc-cccceeec-cCCcccCCC
Q psy11667         58 RCAQCNAKLT-VCSSFTCR-CRKLFCPRH   84 (119)
Q Consensus        58 RC~~C~kkl~-Ls~~f~Cr-Cg~~FC~~H   84 (119)
                      ||..|.++-. -.+.|.|. |+-..|..|
T Consensus         2 rC~vC~~~k~rk~T~~~C~~C~v~lC~~~   30 (32)
T PF13842_consen    2 RCKVCSKKKRRKDTRYMCSKCDVPLCVEP   30 (32)
T ss_pred             CCeECCcCCccceeEEEccCCCCcccCCC
Confidence            6777876432 22689999 987788776


No 28 
>COG3582 Predicted nucleic acid binding protein containing the AN1-type Zn-finger [General function prediction only]
Probab=56.09  E-value=6.3  Score=30.62  Aligned_cols=49  Identities=6%  Similarity=-0.023  Sum_probs=31.5

Q ss_pred             ccccccccccccceeec-cCCcccCCCCCCCCCCCccccHHhhHHHHHHhCC
Q psy11667         59 CAQCNAKLTVCSSFTCR-CRKLFCPRHRHPEEHACTFDYKAYGRHLLAATNP  109 (119)
Q Consensus        59 C~~C~kkl~Ls~~f~Cr-Cg~~FC~~HR~pe~H~C~fDyk~~gr~~Lak~NP  109 (119)
                      |..|...+.|  ++.|. |+.+||..|++.-.|.|.+--..-.|..|++.-|
T Consensus         3 ~~s~~~~~~l--P~r~~~~~kv~s~~~~~~~~~~f~~~i~~~~r~~i~k~~~   52 (162)
T COG3582           3 RDSRVSETRL--PSRGNITAKVSSTDNSLTLFSPFKLFIQLCDRKKIKKPDP   52 (162)
T ss_pred             ccccceeccC--CccccceeeeccCccccccccccchhhhhhhhhccccCCC
Confidence            3445556666  77888 8888888888888888876423333444444433


No 29 
>PTZ00303 phosphatidylinositol kinase; Provisional
Probab=54.26  E-value=6.2  Score=38.25  Aligned_cols=27  Identities=22%  Similarity=0.673  Sum_probs=19.9

Q ss_pred             Cccccccccccc------ccceeec-cCCcccCC
Q psy11667         57 SRCAQCNAKLTV------CSSFTCR-CRKLFCPR   83 (119)
Q Consensus        57 ~RC~~C~kkl~L------s~~f~Cr-Cg~~FC~~   83 (119)
                      ..|..|+++-..      .....|| ||.+||..
T Consensus       461 dtC~~C~kkFfSlsK~L~~RKHHCRkCGrVFC~~  494 (1374)
T PTZ00303        461 DSCPSCGRAFISLSRPLGTRAHHCRSCGIRLCVF  494 (1374)
T ss_pred             CcccCcCCcccccccccccccccccCCccccCcc
Confidence            469999997752      1356799 99988754


No 30 
>cd04476 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds corresponding to the C-terminal OB fold, the ssDNA-binding domain (DBD)-C, of human RPA1 (also called RPA70). RPA1 is the large subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). In addition to DBD-C, RPA1 contains three other OB folds: DBD-A, DBD-B, and RPA1N. The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B. RPA1 DBD-C is involved in DNA binding and trimerization. It contains two structural insertions not found to date in other OB-folds: a zinc ribbon and a three-helix bundle. RPA1 DBD-C also contains a Cys4-type zinc-binding motif, which plays a role in the ssDNA binding fun
Probab=54.10  E-value=5.9  Score=29.18  Aligned_cols=42  Identities=24%  Similarity=0.483  Sum_probs=28.8

Q ss_pred             CcCCCcccccccccccc--cceeec-cCCcc-cCCCCCC-----CCCCCcc
Q psy11667         53 KHKRSRCAQCNAKLTVC--SSFTCR-CRKLF-CPRHRHP-----EEHACTF   94 (119)
Q Consensus        53 ~~~k~RC~~C~kkl~Ls--~~f~Cr-Cg~~F-C~~HR~p-----e~H~C~f   94 (119)
                      .-.-..|..|+|||...  ..|.|. |+..+ =..+||-     .||....
T Consensus        31 ~~~Y~aC~~C~kkv~~~~~~~~~C~~C~~~~~~~~~ry~l~~~i~D~Tg~~   81 (166)
T cd04476          31 NWWYPACPGCNKKVVEEGNGTYRCEKCNKSVPNPEYRYILSLNVADHTGEA   81 (166)
T ss_pred             CeEEccccccCcccEeCCCCcEECCCCCCcCCCccEEEEEEEEEEeCCCCE
Confidence            34445788899999763  368999 88875 4566664     5566553


No 31 
>cd00029 C1 Protein kinase C conserved region 1 (C1) . Cysteine-rich zinc binding domain. Some members of this domain family bind phorbol esters and diacylglycerol, some are reported to bind RasGTP. May occur in tandem arrangement. Diacylglycerol (DAG) is a second messenger, released by activation of Phospholipase D. Phorbol Esters (PE) can act as analogues of DAG and mimic its downstream effects in, for example, tumor promotion. Protein Kinases C are activated by DAG/PE, this activation is mediated by their N-terminal conserved region (C1). DAG/PE binding may be phospholipid dependent. C1 domains may also mediate DAG/PE signals in chimaerins (a family of Rac GTPase activating proteins), RasGRPs (exchange factors for Ras/Rap1), and Munc13 isoforms (scaffolding proteins involved in exocytosis).
Probab=52.63  E-value=8.3  Score=22.40  Aligned_cols=24  Identities=17%  Similarity=0.499  Sum_probs=18.7

Q ss_pred             CCccccccccccc--ccceeec-cCCc
Q psy11667         56 RSRCAQCNAKLTV--CSSFTCR-CRKL   79 (119)
Q Consensus        56 k~RC~~C~kkl~L--s~~f~Cr-Cg~~   79 (119)
                      ...|..|++.+..  ..+++|. |+..
T Consensus        11 ~~~C~~C~~~i~~~~~~~~~C~~C~~~   37 (50)
T cd00029          11 PTFCDVCRKSIWGLFKQGLRCSWCKVK   37 (50)
T ss_pred             CCChhhcchhhhccccceeEcCCCCCc
Confidence            4579999998774  3799999 8654


No 32 
>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains). Some bind phorbol esters and diacylglycerol. Some bind RasGTP. Zinc-binding domains.
Probab=52.60  E-value=8.9  Score=21.95  Aligned_cols=25  Identities=20%  Similarity=0.650  Sum_probs=18.4

Q ss_pred             CCCcccccccccccc-cceeec-cCCc
Q psy11667         55 KRSRCAQCNAKLTVC-SSFTCR-CRKL   79 (119)
Q Consensus        55 ~k~RC~~C~kkl~Ls-~~f~Cr-Cg~~   79 (119)
                      ....|..|++.+... .+++|. |+..
T Consensus        10 ~~~~C~~C~~~i~~~~~~~~C~~C~~~   36 (49)
T smart00109       10 KPTKCCVCRKSIWGSFQGLRCSWCKVK   36 (49)
T ss_pred             CCCCccccccccCcCCCCcCCCCCCch
Confidence            355799999988753 388898 7654


No 33 
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=52.48  E-value=7.3  Score=34.41  Aligned_cols=52  Identities=13%  Similarity=0.349  Sum_probs=29.3

Q ss_pred             CCCcccccccccccc--cceeec-cCCcccCCCCCCCCCCCc--cccHHhhHHHHHH
Q psy11667         55 KRSRCAQCNAKLTVC--SSFTCR-CRKLFCPRHRHPEEHACT--FDYKAYGRHLLAA  106 (119)
Q Consensus        55 ~k~RC~~C~kkl~Ls--~~f~Cr-Cg~~FC~~HR~pe~H~C~--fDyk~~gr~~Lak  106 (119)
                      .+.+|..|+..+.-.  ++|.|+ ||..+=..-+..-.++=.  +++...+|..|.|
T Consensus       349 ~~p~Cp~Cg~~m~S~G~~g~rC~kCg~~~~~~~~~~v~r~l~~g~evp~~arRHLsk  405 (421)
T COG1571         349 VNPVCPRCGGRMKSAGRNGFRCKKCGTRARETLIKEVPRDLEPGVEVPPVARRHLSK  405 (421)
T ss_pred             cCCCCCccCCchhhcCCCCcccccccccCCcccccccccccCCCCcCCchhhhhccC
Confidence            345999999876543  499999 987654333222222221  2234455655544


No 34 
>PF02318 FYVE_2:  FYVE-type zinc finger;  InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A. The small G protein Rab3A plays an important role in the regulation of neurotransmitter release. The crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A shows that the effector domain of rabphilin-3A contacts Rab3A in two distinct areas. The first interface involves the Rab3A switch I and switch II regions, which are sensitive to the nucleotide-binding state of Rab3A. The second interface consists of a deep pocket in Rab3A that interacts with a SGAWFF structural element of rabphilin-3A. Sequence and structure analysis, and biochemical data suggest that this pocket, or Rab complementarity-determining region (RabCDR), establishes a specific interaction between each Rab protein and its effectors. It has been suggested that RabCDRs could be major determinants of effector specificity during vesicle trafficking and fusion [].; GO: 0008270 zinc ion binding, 0017137 Rab GTPase binding, 0006886 intracellular protein transport; PDB: 2CSZ_A 2ZET_C 1ZBD_B 3BC1_B 2CJS_C 2A20_A.
Probab=52.37  E-value=9.9  Score=27.07  Aligned_cols=33  Identities=18%  Similarity=0.515  Sum_probs=24.8

Q ss_pred             CCCcccccccccccc--cceeec-cCCcccCCCCCC
Q psy11667         55 KRSRCAQCNAKLTVC--SSFTCR-CRKLFCPRHRHP   87 (119)
Q Consensus        55 ~k~RC~~C~kkl~Ls--~~f~Cr-Cg~~FC~~HR~p   87 (119)
                      ....|..|.+.+|+.  .+..|. |+..+|.+=+.-
T Consensus        53 ~~~~C~~C~~~fg~l~~~~~~C~~C~~~VC~~C~~~   88 (118)
T PF02318_consen   53 GERHCARCGKPFGFLFNRGRVCVDCKHRVCKKCGVY   88 (118)
T ss_dssp             CCSB-TTTS-BCSCTSTTCEEETTTTEEEETTSEEE
T ss_pred             CCcchhhhCCcccccCCCCCcCCcCCccccCccCCc
Confidence            456899999988874  488999 999999876654


No 35 
>smart00290 ZnF_UBP Ubiquitin Carboxyl-terminal Hydrolase-like zinc finger.
Probab=52.22  E-value=4.9  Score=23.96  Aligned_cols=24  Identities=29%  Similarity=0.755  Sum_probs=17.8

Q ss_pred             cccccccccccccceeec-cCCcccCCC
Q psy11667         58 RCAQCNAKLTVCSSFTCR-CRKLFCPRH   84 (119)
Q Consensus        58 RC~~C~kkl~Ls~~f~Cr-Cg~~FC~~H   84 (119)
                      ||..|.....   -+.|- |+.++|...
T Consensus         1 ~C~~C~~~~~---l~~CL~C~~~~c~~~   25 (50)
T smart00290        1 RCSVCGTIEN---LWLCLTCGQVGCGRY   25 (50)
T ss_pred             CcccCCCcCC---eEEecCCCCcccCCC
Confidence            6888886443   46788 999999764


No 36 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=51.77  E-value=13  Score=27.28  Aligned_cols=36  Identities=25%  Similarity=0.722  Sum_probs=25.1

Q ss_pred             Ccccccccccc-----------cccceeec-cCCccc-----CCCCCCCCCCCcc
Q psy11667         57 SRCAQCNAKLT-----------VCSSFTCR-CRKLFC-----PRHRHPEEHACTF   94 (119)
Q Consensus        57 ~RC~~C~kkl~-----------Ls~~f~Cr-Cg~~FC-----~~HR~pe~H~C~f   94 (119)
                      ..|+.|.+.+.           .+..|.|. |...||     -.|=  .-|+|++
T Consensus        56 ~~C~~C~~~f~~~~~~~~~~~~~~~~y~C~~C~~~FC~dCD~fiHe--~Lh~CPG  108 (112)
T TIGR00622        56 RFCFGCQGPFPKPPVSPFDELKDSHRYVCAVCKNVFCVDCDVFVHE--SLHCCPG  108 (112)
T ss_pred             CcccCcCCCCCCcccccccccccccceeCCCCCCccccccchhhhh--hccCCcC
Confidence            35999988553           23579999 999999     4454  3377764


No 37 
>PF13978 DUF4223:  Protein of unknown function (DUF4223)
Probab=51.46  E-value=7.1  Score=25.53  Aligned_cols=18  Identities=33%  Similarity=0.840  Sum_probs=16.1

Q ss_pred             ccCCCCCCCCCCCccccH
Q psy11667         80 FCPRHRHPEEHACTFDYK   97 (119)
Q Consensus        80 FC~~HR~pe~H~C~fDyk   97 (119)
                      -|.-|-|..+.+|+|||-
T Consensus        19 ~CTG~v~Nk~knCsYDYl   36 (56)
T PF13978_consen   19 ACTGHVENKEKNCSYDYL   36 (56)
T ss_pred             hccceeeccCCCCcceee
Confidence            477899999999999995


No 38 
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=51.22  E-value=12  Score=20.77  Aligned_cols=21  Identities=24%  Similarity=0.591  Sum_probs=16.3

Q ss_pred             ccccccccccccc-ceeec-cCCc
Q psy11667         58 RCAQCNAKLTVCS-SFTCR-CRKL   79 (119)
Q Consensus        58 RC~~C~kkl~Ls~-~f~Cr-Cg~~   79 (119)
                      .|..|++++.- . .|.|. |+..
T Consensus         2 ~C~~C~~~~~~-~~~Y~C~~c~f~   24 (30)
T PF03107_consen    2 WCDVCRRKIDG-FYFYHCSECCFT   24 (30)
T ss_pred             CCCCCCCCcCC-CEeEEeCCCCCe
Confidence            58899998876 5 88998 7644


No 39 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=50.06  E-value=8.6  Score=24.48  Aligned_cols=33  Identities=18%  Similarity=0.519  Sum_probs=24.5

Q ss_pred             CCcccccccccccc---cceeec-cCCcccCCCCCCC
Q psy11667         56 RSRCAQCNAKLTVC---SSFTCR-CRKLFCPRHRHPE   88 (119)
Q Consensus        56 k~RC~~C~kkl~Ls---~~f~Cr-Cg~~FC~~HR~pe   88 (119)
                      ..+|..|++.+.+.   .+..|. ||.-.--+-|-+.
T Consensus         6 ~Y~C~~Cg~~~~~~~~~~~irCp~Cg~rIl~K~R~~~   42 (49)
T COG1996           6 EYKCARCGREVELDQETRGIRCPYCGSRILVKERPKV   42 (49)
T ss_pred             EEEhhhcCCeeehhhccCceeCCCCCcEEEEeccCCc
Confidence            45899999988742   588999 9887766666553


No 40 
>PF05207 zf-CSL:  CSL zinc finger;  InterPro: IPR007872 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a probable zinc binding motif that contains four cysteines and may chelate zinc, known as the DPH-type after the diphthamide (DPH) biosynthesis protein in which it was first characterised, including the proteins DPH3 and DPH4. This domain is also found associated with N-terminal domain of heat shock protein DnaJ IPR001623 from INTERPRO domain.  Diphthamide is a unique post-translationally modified histidine residue found only in translation elongation factor 2 (eEF-2). It is conserved from archaea to humans and serves as the target for diphteria toxin and Pseudomonas exotoxin A. These two toxins catalyse the transfer of ADP-ribose to diphtamide on eEF-2, thus inactivating eEF-2, halting cellular protein synthesis, and causing cell death []. The biosynthesis of diphtamide is dependent on at least five proteins, DPH1 to -5, and a still unidentified amidating enzyme. DPH3 and DPH4 share a conserved region, which encode a putative zinc finger, the DPH-type or CSL-type (after the conserved motif of the final cysteine) zinc finger [, ]. The function of this motif is unknown. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2L6L_A 1WGE_A 2JR7_A 1YOP_A 1YWS_A.
Probab=50.01  E-value=8  Score=24.53  Aligned_cols=12  Identities=42%  Similarity=0.877  Sum_probs=9.9

Q ss_pred             ceeeccCCcccC
Q psy11667         71 SFTCRCRKLFCP   82 (119)
Q Consensus        71 ~f~CrCg~~FC~   82 (119)
                      .+.||||..|-.
T Consensus        18 ~y~CRCG~~f~i   29 (55)
T PF05207_consen   18 SYPCRCGGEFEI   29 (55)
T ss_dssp             EEEETTSSEEEE
T ss_pred             EEcCCCCCEEEE
Confidence            788999998753


No 41 
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=49.34  E-value=7.9  Score=21.29  Aligned_cols=23  Identities=22%  Similarity=0.582  Sum_probs=8.6

Q ss_pred             cccccccccccccceeec-cCCcc
Q psy11667         58 RCAQCNAKLTVCSSFTCR-CRKLF   80 (119)
Q Consensus        58 RC~~C~kkl~Ls~~f~Cr-Cg~~F   80 (119)
                      +|..|++.+.....|.|. |.+.+
T Consensus         2 ~C~~C~~~~~~~~~Y~C~~Cdf~l   25 (30)
T PF07649_consen    2 RCDACGKPIDGGWFYRCSECDFDL   25 (30)
T ss_dssp             --TTTS----S--EEE-TTT----
T ss_pred             cCCcCCCcCCCCceEECccCCCcc
Confidence            688999977643589999 87664


No 42 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=48.41  E-value=8.8  Score=22.18  Aligned_cols=22  Identities=23%  Similarity=0.738  Sum_probs=12.7

Q ss_pred             cccccccccccc--cceeec-cCCc
Q psy11667         58 RCAQCNAKLTVC--SSFTCR-CRKL   79 (119)
Q Consensus        58 RC~~C~kkl~Ls--~~f~Cr-Cg~~   79 (119)
                      .|..|+..+.|.  ....|+ ||+-
T Consensus         2 ~C~~Cg~~~~~~~~~~irC~~CG~R   26 (32)
T PF03604_consen    2 ICGECGAEVELKPGDPIRCPECGHR   26 (32)
T ss_dssp             BESSSSSSE-BSTSSTSSBSSSS-S
T ss_pred             CCCcCCCeeEcCCCCcEECCcCCCe
Confidence            366777766653  356777 7654


No 43 
>PF01485 IBR:  IBR domain;  InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a cysteine-rich (C6HC) zinc finger domain that is present in Triad1, and which is conserved in other proteins encoded by various eukaryotes. The C6HC consensus pattern is:  C-x(4)-C-x(14-30)-C-x(1-4)-C-x(4)-C-x(2)-C-x(4)-H-x(4)-C  The C6HC zinc finger motif is the fourth family member of the zinc-binding RING, LIM, and LAP/PHD fingers. Strikingly, in most of the proteins the C6HC domain is flanked by two RING finger structures IPR001841 from INTERPRO. The novel C6HC motif has been called DRIL (double RING finger linked). The strong conservation of the larger tripartite TRIAD (twoRING fingers and DRIL) structure indicates that the three subdomains are functionally linked and identifies a novel class of proteins []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CT7_A 1WD2_A 2JMO_A 1WIM_A.
Probab=47.70  E-value=11  Score=22.84  Aligned_cols=31  Identities=29%  Similarity=0.686  Sum_probs=18.9

Q ss_pred             Ccccc--cccccccc---cc--eeec-cCCcccCCCCCC
Q psy11667         57 SRCAQ--CNAKLTVC---SS--FTCR-CRKLFCPRHRHP   87 (119)
Q Consensus        57 ~RC~~--C~kkl~Ls---~~--f~Cr-Cg~~FC~~HR~p   87 (119)
                      ..|..  |...+...   ..  +.|. |+..||..++.+
T Consensus        19 ~~Cp~~~C~~~~~~~~~~~~~~~~C~~C~~~fC~~C~~~   57 (64)
T PF01485_consen   19 RWCPNPDCEYIIEKDDGCNSPIVTCPSCGTEFCFKCGEP   57 (64)
T ss_dssp             C--TTSST---ECS-SSTTS--CCTTSCCSEECSSSTSE
T ss_pred             cCCCCCCCcccEEecCCCCCCeeECCCCCCcCccccCcc
Confidence            37876  87655442   23  7899 999999998865


No 44 
>PHA02768 hypothetical protein; Provisional
Probab=47.69  E-value=7.9  Score=25.11  Aligned_cols=13  Identities=15%  Similarity=0.815  Sum_probs=10.1

Q ss_pred             cceeec-cCCcccC
Q psy11667         70 SSFTCR-CRKLFCP   82 (119)
Q Consensus        70 ~~f~Cr-Cg~~FC~   82 (119)
                      .||.|. ||..|-.
T Consensus         4 ~~y~C~~CGK~Fs~   17 (55)
T PHA02768          4 LGYECPICGEIYIK   17 (55)
T ss_pred             cccCcchhCCeecc
Confidence            588888 8888754


No 45 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=47.68  E-value=11  Score=20.27  Aligned_cols=21  Identities=24%  Similarity=0.654  Sum_probs=13.9

Q ss_pred             Ccccccccccccccceeec-cCC
Q psy11667         57 SRCAQCNAKLTVCSSFTCR-CRK   78 (119)
Q Consensus        57 ~RC~~C~kkl~Ls~~f~Cr-Cg~   78 (119)
                      ..|..|++.+.. ....|. ||.
T Consensus         3 ~~Cp~Cg~~~~~-~~~fC~~CG~   24 (26)
T PF13248_consen    3 MFCPNCGAEIDP-DAKFCPNCGA   24 (26)
T ss_pred             CCCcccCCcCCc-ccccChhhCC
Confidence            468888886655 555676 664


No 46 
>KOG3507|consensus
Probab=46.61  E-value=5  Score=26.80  Aligned_cols=33  Identities=21%  Similarity=0.430  Sum_probs=23.7

Q ss_pred             cCCcCCCcccccccccccc--cceeec-cCCcccCC
Q psy11667         51 KTKHKRSRCAQCNAKLTVC--SSFTCR-CRKLFCPR   83 (119)
Q Consensus        51 ~~~~~k~RC~~C~kkl~Ls--~~f~Cr-Cg~~FC~~   83 (119)
                      ....-..-|.-|+.+..|.  ..+.|| ||+-.--+
T Consensus        15 r~~~miYiCgdC~~en~lk~~D~irCReCG~RIlyK   50 (62)
T KOG3507|consen   15 RTATMIYICGDCGQENTLKRGDVIRCRECGYRILYK   50 (62)
T ss_pred             CcccEEEEeccccccccccCCCcEehhhcchHHHHH
Confidence            3445567899999987774  589999 98654433


No 47 
>PRK07218 replication factor A; Provisional
Probab=46.54  E-value=9.3  Score=33.47  Aligned_cols=21  Identities=24%  Similarity=0.613  Sum_probs=16.8

Q ss_pred             CCcccccccccccccceeec-cCCc
Q psy11667         56 RSRCAQCNAKLTVCSSFTCR-CRKL   79 (119)
Q Consensus        56 k~RC~~C~kkl~Ls~~f~Cr-Cg~~   79 (119)
                      -.||..|++.|.   .+.|+ ||.+
T Consensus       297 i~rCP~C~r~v~---~~~C~~hG~v  318 (423)
T PRK07218        297 IERCPECGRVIQ---KGQCRSHGAV  318 (423)
T ss_pred             eecCcCcccccc---CCcCCCCCCc
Confidence            369999999984   47899 8765


No 48 
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=45.99  E-value=14  Score=24.53  Aligned_cols=25  Identities=16%  Similarity=0.460  Sum_probs=16.1

Q ss_pred             CCcccccccccccccceeeccCCcc
Q psy11667         56 RSRCAQCNAKLTVCSSFTCRCRKLF   80 (119)
Q Consensus        56 k~RC~~C~kkl~Ls~~f~CrCg~~F   80 (119)
                      ...|..|+++++.+.-....||.+|
T Consensus        78 ~~~C~vC~k~l~~~~f~~~p~~~v~  102 (109)
T PF10367_consen   78 STKCSVCGKPLGNSVFVVFPCGHVV  102 (109)
T ss_pred             CCCccCcCCcCCCceEEEeCCCeEE
Confidence            4579999999988322223355544


No 49 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=45.73  E-value=12  Score=22.32  Aligned_cols=23  Identities=22%  Similarity=0.544  Sum_probs=17.1

Q ss_pred             ceeec-cCCcccCCCCCCC--CCCCc
Q psy11667         71 SFTCR-CRKLFCPRHRHPE--EHACT   93 (119)
Q Consensus        71 ~f~Cr-Cg~~FC~~HR~pe--~H~C~   93 (119)
                      .|.|. ||..|=..+.+.+  ...|+
T Consensus         5 ey~C~~Cg~~fe~~~~~~~~~~~~CP   30 (42)
T PF09723_consen    5 EYRCEECGHEFEVLQSISEDDPVPCP   30 (42)
T ss_pred             EEEeCCCCCEEEEEEEcCCCCCCcCC
Confidence            58899 9988877777766  55554


No 50 
>PRK08402 replication factor A; Reviewed
Probab=45.71  E-value=10  Score=32.47  Aligned_cols=30  Identities=13%  Similarity=0.346  Sum_probs=20.8

Q ss_pred             CCccccccccccc---ccceeec-cCCcccCCCCC
Q psy11667         56 RSRCAQCNAKLTV---CSSFTCR-CRKLFCPRHRH   86 (119)
Q Consensus        56 k~RC~~C~kkl~L---s~~f~Cr-Cg~~FC~~HR~   86 (119)
                      -.+|..|+|++-.   ...+.|. ||.+-+ .|||
T Consensus       212 y~aCp~CnKkv~~~~~~~~~~Ce~~~~v~p-~~ry  245 (355)
T PRK08402        212 YDACPECRRKVDYDPATDTWICPEHGEVEP-IKIT  245 (355)
T ss_pred             EecCCCCCeEEEEecCCCCEeCCCCCCcCc-ceeE
Confidence            3699999999952   1367888 776544 5664


No 51 
>PHA03073 late transcription factor VLTF-2; Provisional
Probab=45.18  E-value=4.2  Score=31.34  Aligned_cols=21  Identities=24%  Similarity=0.415  Sum_probs=17.1

Q ss_pred             ccccCCcCCCccccccccccc
Q psy11667         48 CVKKTKHKRSRCAQCNAKLTV   68 (119)
Q Consensus        48 ~~~~~~~~k~RC~~C~kkl~L   68 (119)
                      ...+.....+.||+|+..+..
T Consensus        41 ~~l~~ns~~~~CwfC~q~~~~   61 (150)
T PHA03073         41 VRLKTNSDNDYCWFCKQDLII   61 (150)
T ss_pred             hheecccCCCcEEeecccccc
Confidence            456677888999999998876


No 52 
>PF14471 DUF4428:  Domain of unknown function (DUF4428)
Probab=43.90  E-value=8.5  Score=24.19  Aligned_cols=23  Identities=30%  Similarity=0.928  Sum_probs=17.0

Q ss_pred             cccccccccccc------cceeec-cCCcc
Q psy11667         58 RCAQCNAKLTVC------SSFTCR-CRKLF   80 (119)
Q Consensus        58 RC~~C~kkl~Ls------~~f~Cr-Cg~~F   80 (119)
                      +|..|++++||-      .+|-|. |-...
T Consensus         1 ~C~iCg~kigl~~~~k~~DG~iC~~C~~Kl   30 (51)
T PF14471_consen    1 KCAICGKKIGLFKRFKIKDGYICKDCLKKL   30 (51)
T ss_pred             CCCccccccccccceeccCccchHHHHHHh
Confidence            589999999873      367888 75444


No 53 
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=43.73  E-value=12  Score=21.24  Aligned_cols=23  Identities=22%  Similarity=0.836  Sum_probs=15.5

Q ss_pred             Ccccccccccccccceeec-cCCcccCC
Q psy11667         57 SRCAQCNAKLTVCSSFTCR-CRKLFCPR   83 (119)
Q Consensus        57 ~RC~~C~kkl~Ls~~f~Cr-Cg~~FC~~   83 (119)
                      ..|.+|+. .   ..|.|. |+..||+.
T Consensus         3 ~~C~vC~~-~---~kY~Cp~C~~~~CSl   26 (30)
T PF04438_consen    3 KLCSVCGN-P---AKYRCPRCGARYCSL   26 (30)
T ss_dssp             EEETSSSS-E---ESEE-TTT--EESSH
T ss_pred             CCCccCcC-C---CEEECCCcCCceeCc
Confidence            46888988 3   379999 99999974


No 54 
>smart00647 IBR In Between Ring fingers. the domains occurs between pairs og RING fingers
Probab=43.64  E-value=15  Score=22.24  Aligned_cols=32  Identities=38%  Similarity=0.932  Sum_probs=21.8

Q ss_pred             CCccc--cccccccc-----ccceee-ccCCcccCCCCCC
Q psy11667         56 RSRCA--QCNAKLTV-----CSSFTC-RCRKLFCPRHRHP   87 (119)
Q Consensus        56 k~RC~--~C~kkl~L-----s~~f~C-rCg~~FC~~HR~p   87 (119)
                      ...|.  .|..-+.+     .....| .|+..||..++.+
T Consensus        18 ~~~CP~~~C~~~~~~~~~~~~~~v~C~~C~~~fC~~C~~~   57 (64)
T smart00647       18 LKWCPAPDCSAAIIVTEEEGCNRVTCPKCGFSFCFRCKVP   57 (64)
T ss_pred             ccCCCCCCCcceEEecCCCCCCeeECCCCCCeECCCCCCc
Confidence            34576  56543322     247899 6999999998866


No 55 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=43.47  E-value=11  Score=18.86  Aligned_cols=10  Identities=40%  Similarity=1.148  Sum_probs=6.2

Q ss_pred             eeec-cCCccc
Q psy11667         72 FTCR-CRKLFC   81 (119)
Q Consensus        72 f~Cr-Cg~~FC   81 (119)
                      |.|. |+..|=
T Consensus         1 y~C~~C~~~f~   11 (23)
T PF00096_consen    1 YKCPICGKSFS   11 (23)
T ss_dssp             EEETTTTEEES
T ss_pred             CCCCCCCCccC
Confidence            5676 766663


No 56 
>KOG1074|consensus
Probab=43.45  E-value=18  Score=34.86  Aligned_cols=35  Identities=17%  Similarity=0.505  Sum_probs=26.2

Q ss_pred             cccCCcCCCcccccccccccc-------------cceeec-cCCcccCC
Q psy11667         49 VKKTKHKRSRCAQCNAKLTVC-------------SSFTCR-CRKLFCPR   83 (119)
Q Consensus        49 ~~~~~~~k~RC~~C~kkl~Ls-------------~~f~Cr-Cg~~FC~~   83 (119)
                      ..+..-.+++|.+|.|-.|-.             ..|+|+ ||+.|-.+
T Consensus       346 ~~~~~~~khkCr~CakvfgS~SaLqiHlRSHTGERPfqCnvCG~~FSTk  394 (958)
T KOG1074|consen  346 PSEKPFFKHKCRFCAKVFGSDSALQIHLRSHTGERPFQCNVCGNRFSTK  394 (958)
T ss_pred             CCccccccchhhhhHhhcCchhhhhhhhhccCCCCCeeecccccccccc
Confidence            345567788999998866531             289999 99998764


No 57 
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=43.10  E-value=8.6  Score=27.28  Aligned_cols=36  Identities=25%  Similarity=0.645  Sum_probs=22.7

Q ss_pred             CCcCCCccccccccc-c-cc-cceeec-cCCcccCCCCCC
Q psy11667         52 TKHKRSRCAQCNAKL-T-VC-SSFTCR-CRKLFCPRHRHP   87 (119)
Q Consensus        52 ~~~~k~RC~~C~kkl-~-Ls-~~f~Cr-Cg~~FC~~HR~p   87 (119)
                      .+..+..|.+|++.. . .+ .-.+|+ |+.+|-+-=-.|
T Consensus        31 ~q~~ky~Cp~Cgk~~vkR~a~GIW~C~~C~~~~AGGAy~~   70 (90)
T PF01780_consen   31 SQHAKYTCPFCGKTSVKRVATGIWKCKKCGKKFAGGAYTP   70 (90)
T ss_dssp             HHHS-BEESSSSSSEEEEEETTEEEETTTTEEEE-BSSSS
T ss_pred             HHhCCCcCCCCCCceeEEeeeEEeecCCCCCEEeCCCccc
Confidence            346678999999743 1 11 347999 999987654433


No 58 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=41.92  E-value=13  Score=26.44  Aligned_cols=37  Identities=19%  Similarity=0.548  Sum_probs=25.1

Q ss_pred             cCCcCCCcccccccccc--cc-cceeec-cCCcccCCCCCC
Q psy11667         51 KTKHKRSRCAQCNAKLT--VC-SSFTCR-CRKLFCPRHRHP   87 (119)
Q Consensus        51 ~~~~~k~RC~~C~kkl~--Ls-~~f~Cr-Cg~~FC~~HR~p   87 (119)
                      .++..+..|..|+++.-  ++ .--.|+ ||.+|=.---.|
T Consensus        30 ~~~~~~~~Cp~C~~~~VkR~a~GIW~C~kCg~~fAGgay~P   70 (89)
T COG1997          30 AQQRAKHVCPFCGRTTVKRIATGIWKCRKCGAKFAGGAYTP   70 (89)
T ss_pred             HHHhcCCcCCCCCCcceeeeccCeEEcCCCCCeeccccccc
Confidence            34567789999998521  12 346899 999987655444


No 59 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=41.45  E-value=13  Score=22.76  Aligned_cols=29  Identities=21%  Similarity=0.521  Sum_probs=19.5

Q ss_pred             Ccccccccccccc--cceeec-cCCcccCCCC
Q psy11667         57 SRCAQCNAKLTVC--SSFTCR-CRKLFCPRHR   85 (119)
Q Consensus        57 ~RC~~C~kkl~Ls--~~f~Cr-Cg~~FC~~HR   85 (119)
                      .+|..|+..+.+.  .+..|+ ||.-.--+-|
T Consensus         3 Y~C~~Cg~~~~~~~~~~irC~~CG~rIlyK~R   34 (44)
T smart00659        3 YICGECGRENEIKSKDVVRCRECGYRILYKKR   34 (44)
T ss_pred             EECCCCCCEeecCCCCceECCCCCceEEEEeC
Confidence            4688888877664  578887 8765544443


No 60 
>KOG3362|consensus
Probab=40.59  E-value=13  Score=28.89  Aligned_cols=28  Identities=32%  Similarity=0.720  Sum_probs=21.8

Q ss_pred             CCcCCCcccccccccccccceeec-cCCcccCC
Q psy11667         52 TKHKRSRCAQCNAKLTVCSSFTCR-CRKLFCPR   83 (119)
Q Consensus        52 ~~~~k~RC~~C~kkl~Ls~~f~Cr-Cg~~FC~~   83 (119)
                      -++...-|++|+-   . ..|.|- ||..||+.
T Consensus       114 ~KP~r~fCaVCG~---~-S~ysC~~CG~kyCsv  142 (156)
T KOG3362|consen  114 FKPLRKFCAVCGY---D-SKYSCVNCGTKYCSV  142 (156)
T ss_pred             CCCcchhhhhcCC---C-chhHHHhcCCceeec
Confidence            3466778999992   2 468899 99999986


No 61 
>PF10122 Mu-like_Com:  Mu-like prophage protein Com;  InterPro: IPR019294  Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ]. 
Probab=40.48  E-value=10  Score=24.44  Aligned_cols=25  Identities=28%  Similarity=0.753  Sum_probs=18.1

Q ss_pred             CCcccccccccccc-----cceeec-cCCcc
Q psy11667         56 RSRCAQCNAKLTVC-----SSFTCR-CRKLF   80 (119)
Q Consensus        56 k~RC~~C~kkl~Ls-----~~f~Cr-Cg~~F   80 (119)
                      .-||..|++.|..+     ..++|- |+..+
T Consensus         4 eiRC~~CnklLa~~g~~~~leIKCpRC~tiN   34 (51)
T PF10122_consen    4 EIRCGHCNKLLAKAGEVIELEIKCPRCKTIN   34 (51)
T ss_pred             ceeccchhHHHhhhcCccEEEEECCCCCccc
Confidence            45999999987653     366887 87654


No 62 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=40.25  E-value=14  Score=21.51  Aligned_cols=10  Identities=30%  Similarity=1.039  Sum_probs=5.9

Q ss_pred             ceeec-cCCcc
Q psy11667         71 SFTCR-CRKLF   80 (119)
Q Consensus        71 ~f~Cr-Cg~~F   80 (119)
                      ..+|. ||.+|
T Consensus        25 ~v~C~~C~~~f   35 (36)
T PF13717_consen   25 KVRCSKCGHVF   35 (36)
T ss_pred             EEECCCCCCEe
Confidence            35666 66655


No 63 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=39.68  E-value=18  Score=26.03  Aligned_cols=29  Identities=28%  Similarity=0.684  Sum_probs=19.5

Q ss_pred             CCCccccccccccc-c-cceeec-cCCcccCC
Q psy11667         55 KRSRCAQCNAKLTV-C-SSFTCR-CRKLFCPR   83 (119)
Q Consensus        55 ~k~RC~~C~kkl~L-s-~~f~Cr-Cg~~FC~~   83 (119)
                      .|..|..|++|..- . .+..|- ||..|=..
T Consensus         8 tKR~Cp~CG~kFYDLnk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen    8 TKRTCPSCGAKFYDLNKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             CcccCCCCcchhccCCCCCccCCCCCCccCcc
Confidence            46788888886542 1 477788 87776444


No 64 
>KOG1842|consensus
Probab=39.22  E-value=7.5  Score=34.99  Aligned_cols=25  Identities=24%  Similarity=0.895  Sum_probs=21.1

Q ss_pred             Ccccccccccccc-cceeec-cCCccc
Q psy11667         57 SRCAQCNAKLTVC-SSFTCR-CRKLFC   81 (119)
Q Consensus        57 ~RC~~C~kkl~Ls-~~f~Cr-Cg~~FC   81 (119)
                      .-|..|..+.+|+ ..-.|| ||.+.|
T Consensus       181 ~~CP~Ca~~F~l~rRrHHCRLCG~VmC  207 (505)
T KOG1842|consen  181 QFCPECANSFGLTRRRHHCRLCGRVMC  207 (505)
T ss_pred             cccccccchhhhHHHhhhhhhcchHHH
Confidence            3799999999986 477999 999966


No 65 
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=38.71  E-value=22  Score=23.04  Aligned_cols=25  Identities=20%  Similarity=0.644  Sum_probs=19.0

Q ss_pred             CCCccccccccc--ccccceeec-cCCcc
Q psy11667         55 KRSRCAQCNAKL--TVCSSFTCR-CRKLF   80 (119)
Q Consensus        55 ~k~RC~~C~kkl--~Ls~~f~Cr-Cg~~F   80 (119)
                      ...+|..|++++  +. ....|. ||..+
T Consensus         4 ~~~~C~~Cg~~~~~~d-DiVvCp~Cgapy   31 (54)
T PF14446_consen    4 EGCKCPVCGKKFKDGD-DIVVCPECGAPY   31 (54)
T ss_pred             cCccChhhCCcccCCC-CEEECCCCCCcc
Confidence            456899999998  44 567888 87653


No 66 
>PF01529 zf-DHHC:  DHHC palmitoyltransferase;  InterPro: IPR001594 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the DHHC-type zinc finger domain, which is also known as NEW1 []. The DHHC Zn-finger was first isolated in the Drosophila putative transcription factor DNZ1 and was named after a conserved sequence motif []. This domain has palmitoyltransferase activity; this post-translational modification attaches the C16 saturated fatty acid palmitate via a thioester linkage, predominantly to cysteine residues []. This domain is found in the DHHC proteins which are palmitoyl transferases []; the DHHC motif is found within a cysteine-rich domain which is thought to contain the catalytic site. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding
Probab=38.62  E-value=34  Score=24.67  Aligned_cols=46  Identities=22%  Similarity=0.445  Sum_probs=32.2

Q ss_pred             ccCCcCCCcccccccccccccceeeccCCcccCCCCCCCCCCCccccHHhh
Q psy11667         50 KKTKHKRSRCAQCNAKLTVCSSFTCRCRKLFCPRHRHPEEHACTFDYKAYG  100 (119)
Q Consensus        50 ~~~~~~k~RC~~C~kkl~Ls~~f~CrCg~~FC~~HR~pe~H~C~fDyk~~g  100 (119)
                      ........-|..|+..-.. ....|+    +|.+=-+.=||.|++--.=.|
T Consensus        42 ~~~~~~~~~C~~C~~~kp~-Rs~HC~----~C~~CV~~~DHHC~w~~~cIG   87 (174)
T PF01529_consen   42 DDENGELKYCSTCKIIKPP-RSHHCR----VCNRCVLRFDHHCPWLGNCIG   87 (174)
T ss_pred             cccCCCCEECcccCCcCCC-cceecc----ccccccccccccchhhccccc
Confidence            3355667789999987777 799999    444444556799997554444


No 67 
>PF06750 DiS_P_DiS:  Bacterial Peptidase A24 N-terminal domain;  InterPro: IPR010627 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Aspartic endopeptidases 3.4.23. from EC of vertebrate, fungal and retroviral origin have been characterised []. More recently, aspartic endopeptidases associated with the processing of bacterial type 4 prepilin [] and archaean preflagellin have been described [, ]. Structurally, aspartic endopeptidases are bilobal enzymes, each lobe contributing a catalytic Asp residue, with an extended active site cleft localised between the two lobes of the molecule. One lobe has probably evolved from the other through a gene duplication event in the distant past. In modern-day enzymes, although the three-dimensional structures are very similar, the amino acid sequences are more divergent, except for the catalytic site motif, which is very conserved. The presence and position of disulphide bridges are other conserved features of aspartic peptidases. All or most aspartate peptidases are endopeptidases. These enzymes have been assigned into clans (proteins which are evolutionary related), and further sub-divided into families, largely on the basis of their tertiary structure. This domain is found at the N terminus of bacterial aspartic peptidases belonging to MEROPS peptidase family A24 (clan AD), subfamily A24A (type IV prepilin peptidase, IPR000045 from INTERPRO). It's function has not been specifically determined; however some of the family have been characterised as bifunctional [], and this domain may contain the N-methylation activity. The domain consists of an intracellular region between a pair of transmembrane domains. This intracellular region contains an invariant proline and four conserved cysteines. These Cys residues are arranged in a two-pair motif, with the Cys residues of a pair separated (usually) by 2 aa and with each pair separated by 21 largely hydrophilic residues (C-X-X-C...X21...C-X-X-C); they have been shown to be essential to the overall function of the enzyme [, ].   The bifunctional enzyme prepilin peptidase (PilD) from Pseudomonas aeruginosa is a key determinant in both type-IV pilus biogenesis and extracellular protein secretion, in its roles as a leader peptidase and methyl transferase (MTase). It is responsible for endopeptidic cleavage of the unique leader peptides that characterise type-IV pilin precursors, as well as proteins with homologous leader sequences that are essential components of the general secretion pathway found in a variety of Gram-negative pathogens. Following removal of the leader peptides, the same enzyme is responsible for the second posttranslational modification that characterises the type-IV pilins and their homologues, namely N-methylation of the newly exposed N-terminal amino acid residue []. 
Probab=38.61  E-value=19  Score=24.99  Aligned_cols=25  Identities=32%  Similarity=0.677  Sum_probs=18.2

Q ss_pred             cCCCcccccccccccc----------cceeec-cCC
Q psy11667         54 HKRSRCAQCNAKLTVC----------SSFTCR-CRK   78 (119)
Q Consensus        54 ~~k~RC~~C~kkl~Ls----------~~f~Cr-Cg~   78 (119)
                      ..+++|..|+++|..-          ...+|| |+.
T Consensus        31 ~~rS~C~~C~~~L~~~~lIPi~S~l~lrGrCr~C~~   66 (92)
T PF06750_consen   31 FPRSHCPHCGHPLSWWDLIPILSYLLLRGRCRYCGA   66 (92)
T ss_pred             CCCCcCcCCCCcCcccccchHHHHHHhCCCCcccCC
Confidence            3468999999988752          267888 644


No 68 
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=38.04  E-value=17  Score=21.36  Aligned_cols=23  Identities=22%  Similarity=0.694  Sum_probs=16.6

Q ss_pred             Ccccccccccccc--cceee-ccCCc
Q psy11667         57 SRCAQCNAKLTVC--SSFTC-RCRKL   79 (119)
Q Consensus        57 ~RC~~C~kkl~Ls--~~f~C-rCg~~   79 (119)
                      -+|..|+..+..+  .-|.| +||.+
T Consensus         9 ~~C~~C~~~~~~~~dG~~yC~~cG~~   34 (36)
T PF11781_consen    9 EPCPVCGSRWFYSDDGFYYCDRCGHQ   34 (36)
T ss_pred             CcCCCCCCeEeEccCCEEEhhhCceE
Confidence            3699999886654  36789 58865


No 69 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=37.72  E-value=16  Score=18.96  Aligned_cols=12  Identities=42%  Similarity=1.065  Sum_probs=8.6

Q ss_pred             ceeec-cCCcccC
Q psy11667         71 SFTCR-CRKLFCP   82 (119)
Q Consensus        71 ~f~Cr-Cg~~FC~   82 (119)
                      .|+|. |+..|-.
T Consensus         1 ~~~C~~C~~~F~~   13 (27)
T PF13912_consen    1 PFECDECGKTFSS   13 (27)
T ss_dssp             SEEETTTTEEESS
T ss_pred             CCCCCccCCccCC
Confidence            36788 8887754


No 70 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=37.59  E-value=15  Score=17.71  Aligned_cols=9  Identities=56%  Similarity=1.339  Sum_probs=3.7

Q ss_pred             eeec-cCCcc
Q psy11667         72 FTCR-CRKLF   80 (119)
Q Consensus        72 f~Cr-Cg~~F   80 (119)
                      |.|. |+..|
T Consensus         1 ~~C~~C~~~~   10 (24)
T PF13894_consen    1 FQCPICGKSF   10 (24)
T ss_dssp             EE-SSTS-EE
T ss_pred             CCCcCCCCcC
Confidence            4565 65554


No 71 
>KOG1074|consensus
Probab=37.37  E-value=23  Score=34.25  Aligned_cols=48  Identities=19%  Similarity=0.631  Sum_probs=33.0

Q ss_pred             cccCCcCCCcccccccccc------cc-------cceeec-cCCcccCC---------CC----CCCCCCCcccc
Q psy11667         49 VKKTKHKRSRCAQCNAKLT------VC-------SSFTCR-CRKLFCPR---------HR----HPEEHACTFDY   96 (119)
Q Consensus        49 ~~~~~~~k~RC~~C~kkl~------Ls-------~~f~Cr-Cg~~FC~~---------HR----~pe~H~C~fDy   96 (119)
                      ...+....|.|-+|.+-|.      |.       ..|+|+ ||+-|--+         ||    +--.|.|++.|
T Consensus       598 ~~~~~TdPNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~  672 (958)
T KOG1074|consen  598 SENKRTDPNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTF  672 (958)
T ss_pred             cccccCCccceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCccccccccCCchh
Confidence            4556677899999877553      21       389999 99998632         33    34678898543


No 72 
>PRK12366 replication factor A; Reviewed
Probab=36.82  E-value=15  Score=33.51  Aligned_cols=31  Identities=16%  Similarity=0.535  Sum_probs=22.3

Q ss_pred             CCCcccccccccccc-cceeec-cCCcccCCCCC
Q psy11667         55 KRSRCAQCNAKLTVC-SSFTCR-CRKLFCPRHRH   86 (119)
Q Consensus        55 ~k~RC~~C~kkl~Ls-~~f~Cr-Cg~~FC~~HR~   86 (119)
                      .-.+|..|+|||-.. ..|.|. ||.. =..|||
T Consensus       531 ~y~aCp~CnkKv~~~~g~~~C~~c~~~-~p~~~~  563 (637)
T PRK12366        531 ILYLCPNCRKRVEEVDGEYICEFCGEV-EPNELL  563 (637)
T ss_pred             EEecccccCeEeEcCCCcEECCCCCCC-CCcEEE
Confidence            346999999999652 347898 9887 335666


No 73 
>COG1439 Predicted nucleic acid-binding protein, consists of a PIN domain and a Zn-ribbon module [General function prediction only]
Probab=36.42  E-value=15  Score=29.04  Aligned_cols=30  Identities=27%  Similarity=0.543  Sum_probs=24.0

Q ss_pred             cccCCcCCCcccccccccccccceeec-cCCc
Q psy11667         49 VKKTKHKRSRCAQCNAKLTVCSSFTCR-CRKL   79 (119)
Q Consensus        49 ~~~~~~~k~RC~~C~kkl~Ls~~f~Cr-Cg~~   79 (119)
                      ..+..++..||..|++.... ....|- ||..
T Consensus       132 I~~v~~w~~rC~GC~~~f~~-~~~~Cp~CG~~  162 (177)
T COG1439         132 IKKVRKWRLRCHGCKRIFPE-PKDFCPICGSP  162 (177)
T ss_pred             cceEeeeeEEEecCceecCC-CCCcCCCCCCc
Confidence            46677888999999998774 577798 8865


No 74 
>PF01194 RNA_pol_N:  RNA polymerases N / 8 kDa subunit;  InterPro: IPR000268 In eukaryotes, there are three different forms of DNA-dependent RNA polymerases (2.7.7.6 from EC) transcribing different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. In archaebacteria, there is generally a single form of RNA polymerase which also consists of an oligomeric assemblage of 10 to 13 polypeptides. Archaebacterial subunit N (gene rpoN) [] is a small protein of about 8 kDa, it is evolutionary related [] to a 8.3 kDa component shared by all three forms of eukaryotic RNA polymerases (gene RPB10 in yeast and POLR2J in mammals) as well as to African swine fever virus (ASFV) protein CP80R []. There is a conserved region which is located at the N-terminal extremity of these polymerase subunits; this region contains two cysteines that binds a zinc ion [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_N 3HKZ_N 1EF4_A 3H0G_V 2Y0S_N 2R92_J 3M4O_J 3S2D_J 1R9S_J 1Y1W_J ....
Probab=36.11  E-value=16  Score=24.12  Aligned_cols=13  Identities=23%  Similarity=0.547  Sum_probs=9.3

Q ss_pred             CCccccccccccc
Q psy11667         56 RSRCAQCNAKLTV   68 (119)
Q Consensus        56 k~RC~~C~kkl~L   68 (119)
                      +-||++|++-++-
T Consensus         4 PVRCFTCGkvi~~   16 (60)
T PF01194_consen    4 PVRCFTCGKVIGN   16 (60)
T ss_dssp             SSS-STTTSBTCG
T ss_pred             ceecCCCCCChhH
Confidence            4599999998753


No 75 
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=35.71  E-value=22  Score=23.14  Aligned_cols=25  Identities=28%  Similarity=0.782  Sum_probs=19.2

Q ss_pred             cccccccccccccceeec-cCCc-ccC
Q psy11667         58 RCAQCNAKLTVCSSFTCR-CRKL-FCP   82 (119)
Q Consensus        58 RC~~C~kkl~Ls~~f~Cr-Cg~~-FC~   82 (119)
                      .|.+|.+++.....|.|. ||.. +|+
T Consensus         1 ~Cpv~~~~~~~~v~~~Cp~cGipthcS   27 (55)
T PF13824_consen    1 LCPVCKKDLPAHVNFECPDCGIPTHCS   27 (55)
T ss_pred             CCCCCccccccccCCcCCCCCCcCccC
Confidence            488888877766799999 9875 444


No 76 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=35.39  E-value=18  Score=19.27  Aligned_cols=11  Identities=36%  Similarity=1.056  Sum_probs=7.7

Q ss_pred             cceeec-cCCcc
Q psy11667         70 SSFTCR-CRKLF   80 (119)
Q Consensus        70 ~~f~Cr-Cg~~F   80 (119)
                      ..|.|. |+..|
T Consensus        13 k~~~C~~C~k~F   24 (26)
T PF13465_consen   13 KPYKCPYCGKSF   24 (26)
T ss_dssp             SSEEESSSSEEE
T ss_pred             CCCCCCCCcCee
Confidence            467787 77766


No 77 
>PRK04136 rpl40e 50S ribosomal protein L40e; Provisional
Probab=35.07  E-value=22  Score=22.66  Aligned_cols=25  Identities=28%  Similarity=0.667  Sum_probs=20.2

Q ss_pred             CcCCCcccccccccccccceeec-cCC
Q psy11667         53 KHKRSRCAQCNAKLTVCSSFTCR-CRK   78 (119)
Q Consensus        53 ~~~k~RC~~C~kkl~Ls~~f~Cr-Cg~   78 (119)
                      .-.+.-|..|..++.. ..-.|| ||.
T Consensus        11 ~~~k~ICrkC~ARnp~-~A~~CRKCg~   36 (48)
T PRK04136         11 VFNKKICMRCNARNPW-RATKCRKCGY   36 (48)
T ss_pred             hhcccchhcccCCCCc-cccccccCCC
Confidence            3456678899999988 788999 875


No 78 
>PF15227 zf-C3HC4_4:  zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A.
Probab=34.83  E-value=22  Score=21.09  Aligned_cols=22  Identities=23%  Similarity=0.679  Sum_probs=13.4

Q ss_pred             ccccccccccccceeeccCCcccC
Q psy11667         59 CAQCNAKLTVCSSFTCRCRKLFCP   82 (119)
Q Consensus        59 C~~C~kkl~Ls~~f~CrCg~~FC~   82 (119)
                      |..|..-+.  .+..-.||.+||.
T Consensus         1 CpiC~~~~~--~Pv~l~CGH~FC~   22 (42)
T PF15227_consen    1 CPICLDLFK--DPVSLPCGHSFCR   22 (42)
T ss_dssp             ETTTTSB-S--SEEE-SSSSEEEH
T ss_pred             CCccchhhC--CccccCCcCHHHH
Confidence            455555443  3677789999994


No 79 
>PF09416 UPF1_Zn_bind:  RNA helicase (UPF2 interacting domain);  InterPro: IPR018999 UPF1 (or regulator of nonsense transcripts 1 homologue) is an essential RNA helicase that detects mRNAs containing premature stop codons and triggers their degradation. This domain contains 3 zinc binding motifs and forms interactions with another protein (UPF2) that is also involved nonsense-mediated mRNA decay (NMD) []. ; GO: 0003677 DNA binding, 0004386 helicase activity, 0005524 ATP binding, 0008270 zinc ion binding, 0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay, 0005737 cytoplasm; PDB: 2IYK_B 2WJY_A 2WJV_A 2XZL_A.
Probab=34.80  E-value=20  Score=27.60  Aligned_cols=26  Identities=31%  Similarity=0.782  Sum_probs=15.7

Q ss_pred             cccccccccccccceeec-cCCcccCCC
Q psy11667         58 RCAQCNAKLTVCSSFTCR-CRKLFCPRH   84 (119)
Q Consensus        58 RC~~C~kkl~Ls~~f~Cr-Cg~~FC~~H   84 (119)
                      .|..|+-.-.- ...+|. |++.||..-
T Consensus         2 aC~YCG~~~p~-~vv~C~~c~kWFCNg~   28 (152)
T PF09416_consen    2 ACAYCGIHDPS-CVVKCNTCNKWFCNGR   28 (152)
T ss_dssp             S-TTT----CC-CEEEETTTTEEEES--
T ss_pred             CccccCCCCcc-cEeEcCCCCcEeecCC
Confidence            58889865544 468899 999999874


No 80 
>PLN02569 threonine synthase
Probab=34.34  E-value=35  Score=30.15  Aligned_cols=35  Identities=14%  Similarity=0.170  Sum_probs=25.5

Q ss_pred             CCcCCCcccccccccccc-cceeeccCCcccCCCCC
Q psy11667         52 TKHKRSRCAQCNAKLTVC-SSFTCRCRKLFCPRHRH   86 (119)
Q Consensus        52 ~~~~k~RC~~C~kkl~Ls-~~f~CrCg~~FC~~HR~   86 (119)
                      ......+|..|++...+. ..+.|.||..+=..|.|
T Consensus        45 ~~~~~l~C~~Cg~~y~~~~~~~~C~cgg~l~~~~d~   80 (484)
T PLN02569         45 KYVPFLECPLTGEKYSLDEVVYRSKSGGLLDVRHDM   80 (484)
T ss_pred             ccccccEeCCCCCcCCCccccccCCCCCeEEEecch
Confidence            345568999999987764 35789998887666554


No 81 
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=34.30  E-value=15  Score=30.84  Aligned_cols=28  Identities=25%  Similarity=0.589  Sum_probs=21.2

Q ss_pred             CCcccccccccccccceeec-cCCcccCCCCC
Q psy11667         56 RSRCAQCNAKLTVCSSFTCR-CRKLFCPRHRH   86 (119)
Q Consensus        56 k~RC~~C~kkl~Ls~~f~Cr-Cg~~FC~~HR~   86 (119)
                      -.+|+.|-.-.   ..+.|. ||++||+.--+
T Consensus       215 d~kC~lC~e~~---~~ps~t~CgHlFC~~Cl~  243 (271)
T COG5574         215 DYKCFLCLEEP---EVPSCTPCGHLFCLSCLL  243 (271)
T ss_pred             ccceeeeeccc---CCcccccccchhhHHHHH
Confidence            46899997743   467899 99999986433


No 82 
>PF08882 Acetone_carb_G:  Acetone carboxylase gamma subunit;  InterPro: IPR014979 Acetone carboxylase is the key enzyme of bacterial acetone metabolism, catalysing the condensation of acetone and CO2 to form acetoacetate [] according to the following reaction:  CH3COCH3 + CO2 + ATP = CH3COCH2COO- + AMP + 2P(i) + H+   It has the subunit composition: (alpha(2)beta(2)gamma(2) multimers of 85kDa, 78kDa, and 20kDa subunits). It is expressed to high levels (17 to 25% of soluble protein) in cells grown with acetone as the carbon source but are not present at detectable levels in cells grown with other carbon sources []. Acetone carboxylase may enable Helicobacter pylori to survive off acetone in the stomach of humans and other mammals where it is the etiological agent of peptic ulcer disease []. This entry represents the family of gamma subunit-related acetone carboxylase proteins.
Probab=33.95  E-value=22  Score=26.30  Aligned_cols=32  Identities=19%  Similarity=0.323  Sum_probs=23.0

Q ss_pred             ccccccccccceeeccCCcccCCCCCCCCCCCccc
Q psy11667         61 QCNAKLTVCSSFTCRCRKLFCPRHRHPEEHACTFD   95 (119)
Q Consensus        61 ~C~kkl~Ls~~f~CrCg~~FC~~HR~pe~H~C~fD   95 (119)
                      .|+++-.   ..+|.||..||.-+.--..|.--++
T Consensus        17 i~~~~~k---~vkc~CGh~f~d~r~NwK~~alv~v   48 (112)
T PF08882_consen   17 IVQKKDK---VVKCDCGHEFCDARENWKLGALVYV   48 (112)
T ss_pred             EEEecCc---eeeccCCCeecChhcChhhCcEEEe
Confidence            4555441   5789999999998877776665544


No 83 
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=33.63  E-value=28  Score=20.67  Aligned_cols=22  Identities=32%  Similarity=0.720  Sum_probs=13.4

Q ss_pred             cccccccccccc-----cceeec-cCCc
Q psy11667         58 RCAQCNAKLTVC-----SSFTCR-CRKL   79 (119)
Q Consensus        58 RC~~C~kkl~Ls-----~~f~Cr-Cg~~   79 (119)
                      -|..|+..|...     .-+.|. ||+.
T Consensus         2 FCp~Cg~~l~~~~~~~~~~~vC~~Cg~~   29 (52)
T smart00661        2 FCPKCGNMLIPKEGKEKRRFVCRKCGYE   29 (52)
T ss_pred             CCCCCCCccccccCCCCCEEECCcCCCe
Confidence            477787755432     147788 7753


No 84 
>PRK04016 DNA-directed RNA polymerase subunit N; Provisional
Probab=33.58  E-value=15  Score=24.47  Aligned_cols=13  Identities=23%  Similarity=0.598  Sum_probs=10.3

Q ss_pred             CCccccccccccc
Q psy11667         56 RSRCAQCNAKLTV   68 (119)
Q Consensus        56 k~RC~~C~kkl~L   68 (119)
                      +-||++|+|-++-
T Consensus         4 PvRCFTCGkvi~~   16 (62)
T PRK04016          4 PVRCFTCGKVIAE   16 (62)
T ss_pred             CeEecCCCCChHH
Confidence            4599999998754


No 85 
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=33.41  E-value=16  Score=26.32  Aligned_cols=18  Identities=28%  Similarity=0.534  Sum_probs=13.3

Q ss_pred             cccccccceeec-cCCcccC
Q psy11667         64 AKLTVCSSFTCR-CRKLFCP   82 (119)
Q Consensus        64 kkl~Ls~~f~Cr-Cg~~FC~   82 (119)
                      +.|-+ .+-.|+ ||++|=.
T Consensus        52 ~~Llv-~Pa~CkkCGfef~~   70 (97)
T COG3357          52 KRLLV-RPARCKKCGFEFRD   70 (97)
T ss_pred             ceEEe-cChhhcccCccccc
Confidence            34444 688999 9999966


No 86 
>PF09862 DUF2089:  Protein of unknown function (DUF2089);  InterPro: IPR018658  This family consists of various hypothetical prokaryotic proteins. 
Probab=32.79  E-value=21  Score=26.11  Aligned_cols=28  Identities=25%  Similarity=0.666  Sum_probs=22.4

Q ss_pred             ccccccccccccceeec-cCCcccCCCCCC
Q psy11667         59 CAQCNAKLTVCSSFTCR-CRKLFCPRHRHP   87 (119)
Q Consensus        59 C~~C~kkl~Ls~~f~Cr-Cg~~FC~~HR~p   87 (119)
                      |..|+..|-. +..+|. |+-.+-+.-.++
T Consensus         1 CPvCg~~l~v-t~l~C~~C~t~i~G~F~l~   29 (113)
T PF09862_consen    1 CPVCGGELVV-TRLKCPSCGTEIEGEFELP   29 (113)
T ss_pred             CCCCCCceEE-EEEEcCCCCCEEEeeeccc
Confidence            8899999988 899999 988776655443


No 87 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=32.49  E-value=26  Score=26.75  Aligned_cols=14  Identities=36%  Similarity=0.619  Sum_probs=9.7

Q ss_pred             eeec-cCCcccCCCC
Q psy11667         72 FTCR-CRKLFCPRHR   85 (119)
Q Consensus        72 f~Cr-Cg~~FC~~HR   85 (119)
                      ++|. ||+.|=..-+
T Consensus        29 ~~c~~c~~~f~~~e~   43 (154)
T PRK00464         29 RECLACGKRFTTFER   43 (154)
T ss_pred             eeccccCCcceEeEe
Confidence            7788 8888765444


No 88 
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=32.45  E-value=22  Score=25.29  Aligned_cols=34  Identities=24%  Similarity=0.514  Sum_probs=23.0

Q ss_pred             CCcCCCcccccccc----cccccceeec-cCCcccCCCCC
Q psy11667         52 TKHKRSRCAQCNAK----LTVCSSFTCR-CRKLFCPRHRH   86 (119)
Q Consensus        52 ~~~~k~RC~~C~kk----l~Ls~~f~Cr-Cg~~FC~~HR~   86 (119)
                      .+..+..|.+|++.    +.. .--+|+ |+.+|-.-=-.
T Consensus        31 ~q~a~y~CpfCgk~~vkR~a~-GIW~C~~C~~~~AGGAy~   69 (91)
T TIGR00280        31 QQKAKYVCPFCGKKTVKRGST-GIWTCRKCGAKFAGGAYT   69 (91)
T ss_pred             HHhcCccCCCCCCCceEEEee-EEEEcCCCCCEEeCCccc
Confidence            45677899999752    222 346999 99998765433


No 89 
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=32.32  E-value=24  Score=24.97  Aligned_cols=34  Identities=18%  Similarity=0.543  Sum_probs=22.7

Q ss_pred             cCCcCCCcccccccc-ccc-c-cceeec-cCCcccCCC
Q psy11667         51 KTKHKRSRCAQCNAK-LTV-C-SSFTCR-CRKLFCPRH   84 (119)
Q Consensus        51 ~~~~~k~RC~~C~kk-l~L-s-~~f~Cr-Cg~~FC~~H   84 (119)
                      ..+..+..|.+|++. +.- + .--+|+ |+.+|-.-=
T Consensus        31 ~~q~a~y~CpfCgk~~vkR~a~GIW~C~~C~~~~AGGA   68 (90)
T PTZ00255         31 ISQHAKYFCPFCGKHAVKRQAVGIWRCKGCKKTVAGGA   68 (90)
T ss_pred             HHHhCCccCCCCCCCceeeeeeEEEEcCCCCCEEeCCc
Confidence            345678899999752 221 1 346999 999987643


No 90 
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=31.75  E-value=34  Score=25.10  Aligned_cols=29  Identities=31%  Similarity=0.730  Sum_probs=19.2

Q ss_pred             CcCCCcccccccccccc------------------cceeec-cCCccc
Q psy11667         53 KHKRSRCAQCNAKLTVC------------------SSFTCR-CRKLFC   81 (119)
Q Consensus        53 ~~~k~RC~~C~kkl~Ls------------------~~f~Cr-Cg~~FC   81 (119)
                      .....||..|+..|...                  .-+.|. ||.+|=
T Consensus        88 ~~~~sRC~~CN~~L~~v~~~~v~~~vp~~v~~~~~~f~~C~~C~kiyW  135 (147)
T PF01927_consen   88 DPIFSRCPKCNGPLRPVSKEEVKDRVPPYVYETYDEFWRCPGCGKIYW  135 (147)
T ss_pred             CCCCCccCCCCcEeeechhhccccccCccccccCCeEEECCCCCCEec
Confidence            34468999999766331                  135788 888763


No 91 
>PF15549 PGC7_Stella:  PGC7/Stella/Dppa3 domain 
Probab=31.55  E-value=27  Score=27.23  Aligned_cols=20  Identities=40%  Similarity=1.129  Sum_probs=16.3

Q ss_pred             cceeeccCCcccCCCCCCCCCC
Q psy11667         70 SSFTCRCRKLFCPRHRHPEEHA   91 (119)
Q Consensus        70 ~~f~CrCg~~FC~~HR~pe~H~   91 (119)
                      +.|.|.|  .||-.||.+.+-+
T Consensus       122 ~~FrC~C--~yC~~~~~~~~~n  141 (160)
T PF15549_consen  122 NRFRCEC--HYCQSHRNPGERN  141 (160)
T ss_pred             Cceeeee--eeecccCCCcccc
Confidence            4789998  6999999776666


No 92 
>PF14369 zf-RING_3:  zinc-finger
Probab=31.41  E-value=26  Score=20.40  Aligned_cols=23  Identities=35%  Similarity=0.736  Sum_probs=14.9

Q ss_pred             cccccccccccc---ccee-ec-cCCcc
Q psy11667         58 RCAQCNAKLTVC---SSFT-CR-CRKLF   80 (119)
Q Consensus        58 RC~~C~kkl~Ls---~~f~-Cr-Cg~~F   80 (119)
                      =|+.|++.+.+.   .... |- |+..|
T Consensus         4 wCh~C~~~V~~~~~~~~~~~CP~C~~gF   31 (35)
T PF14369_consen    4 WCHQCNRFVRIAPSPDSDVACPRCHGGF   31 (35)
T ss_pred             eCccCCCEeEeCcCCCCCcCCcCCCCcE
Confidence            377888777652   2334 87 87776


No 93 
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=31.39  E-value=34  Score=21.58  Aligned_cols=25  Identities=24%  Similarity=0.611  Sum_probs=17.4

Q ss_pred             CCCccccccccccc--c-cceeec-cCCc
Q psy11667         55 KRSRCAQCNAKLTV--C-SSFTCR-CRKL   79 (119)
Q Consensus        55 ~k~RC~~C~kkl~L--s-~~f~Cr-Cg~~   79 (119)
                      +...|+.|+..+..  . ..|.|. ||..
T Consensus        27 TSq~C~~CG~~~~~~~~~r~~~C~~Cg~~   55 (69)
T PF07282_consen   27 TSQTCPRCGHRNKKRRSGRVFTCPNCGFE   55 (69)
T ss_pred             CccCccCcccccccccccceEEcCCCCCE
Confidence            45689999875544  2 478888 7665


No 94 
>PRK05978 hypothetical protein; Provisional
Probab=31.26  E-value=26  Score=26.69  Aligned_cols=27  Identities=33%  Similarity=0.652  Sum_probs=18.3

Q ss_pred             cCCCccccccc-ccc---cccceeec-cCCcc
Q psy11667         54 HKRSRCAQCNA-KLT---VCSSFTCR-CRKLF   80 (119)
Q Consensus        54 ~~k~RC~~C~k-kl~---Ls~~f~Cr-Cg~~F   80 (119)
                      --+.||..|++ ++-   |...-.|. ||..|
T Consensus        31 Gl~grCP~CG~G~LF~g~Lkv~~~C~~CG~~~   62 (148)
T PRK05978         31 GFRGRCPACGEGKLFRAFLKPVDHCAACGEDF   62 (148)
T ss_pred             HHcCcCCCCCCCcccccccccCCCccccCCcc
Confidence            34579999998 441   22466888 87765


No 95 
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=31.07  E-value=25  Score=24.96  Aligned_cols=31  Identities=19%  Similarity=0.598  Sum_probs=21.7

Q ss_pred             CCcCCCccccccc----ccccccceeec-cCCcccCC
Q psy11667         52 TKHKRSRCAQCNA----KLTVCSSFTCR-CRKLFCPR   83 (119)
Q Consensus        52 ~~~~k~RC~~C~k----kl~Ls~~f~Cr-Cg~~FC~~   83 (119)
                      .+..+..|.+|++    +... .--+|+ |+.+|-.-
T Consensus        32 ~q~a~y~CpfCgk~~vkR~a~-GIW~C~~C~~~~AGG   67 (90)
T PRK03976         32 KMRAKHVCPVCGRPKVKRVGT-GIWECRKCGAKFAGG   67 (90)
T ss_pred             HHhcCccCCCCCCCceEEEEE-EEEEcCCCCCEEeCC
Confidence            4567789999965    2222 346999 99998664


No 96 
>PLN00032 DNA-directed RNA polymerase; Provisional
Probab=30.85  E-value=18  Score=24.69  Aligned_cols=13  Identities=23%  Similarity=0.547  Sum_probs=10.4

Q ss_pred             CCccccccccccc
Q psy11667         56 RSRCAQCNAKLTV   68 (119)
Q Consensus        56 k~RC~~C~kkl~L   68 (119)
                      +-||++|+|-++-
T Consensus         4 PVRCFTCGkvig~   16 (71)
T PLN00032          4 PVRCFTCGKVIGN   16 (71)
T ss_pred             ceeecCCCCCcHH
Confidence            4599999998763


No 97 
>KOG2462|consensus
Probab=30.34  E-value=85  Score=26.49  Aligned_cols=49  Identities=33%  Similarity=0.792  Sum_probs=32.2

Q ss_pred             cCCcCCCccccccccccccc----------------ceeec-cCCcccCC---------CCCCCCCCCccccHHhhH
Q psy11667         51 KTKHKRSRCAQCNAKLTVCS----------------SFTCR-CRKLFCPR---------HRHPEEHACTFDYKAYGR  101 (119)
Q Consensus        51 ~~~~~k~RC~~C~kkl~Ls~----------------~f~Cr-Cg~~FC~~---------HR~pe~H~C~fDyk~~gr  101 (119)
                      ..+..+..|..|+|...-+.                .|.|. ||++|-++         |-++  |.|.|=-|.+-|
T Consensus       125 ~~~~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~l~--c~C~iCGKaFSR  199 (279)
T KOG2462|consen  125 AAKHPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHTLP--CECGICGKAFSR  199 (279)
T ss_pred             cccCCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccCCC--cccccccccccc
Confidence            45666778888998765433                58899 99987653         4444  777765554443


No 98 
>PRK12496 hypothetical protein; Provisional
Probab=30.29  E-value=24  Score=26.83  Aligned_cols=31  Identities=26%  Similarity=0.475  Sum_probs=21.6

Q ss_pred             cccCCcCCCcccccccccccc-cceeec-cCCc
Q psy11667         49 VKKTKHKRSRCAQCNAKLTVC-SSFTCR-CRKL   79 (119)
Q Consensus        49 ~~~~~~~k~RC~~C~kkl~Ls-~~f~Cr-Cg~~   79 (119)
                      .++...|+.+|..|++..... ....|- ||..
T Consensus       120 i~~~~~w~~~C~gC~~~~~~~~~~~~C~~CG~~  152 (164)
T PRK12496        120 IKKVIKWRKVCKGCKKKYPEDYPDDVCEICGSP  152 (164)
T ss_pred             chhheeeeEECCCCCccccCCCCCCcCCCCCCh
Confidence            456667889999999876431 345688 8764


No 99 
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=29.13  E-value=39  Score=28.05  Aligned_cols=28  Identities=29%  Similarity=0.814  Sum_probs=21.9

Q ss_pred             CCCcccccccccccccceeec-cCCcccCCC
Q psy11667         55 KRSRCAQCNAKLTVCSSFTCR-CRKLFCPRH   84 (119)
Q Consensus        55 ~k~RC~~C~kkl~Ls~~f~Cr-Cg~~FC~~H   84 (119)
                      .+..|+ |.+++.. .||.|. |.-.||...
T Consensus       241 ~ra~Cf-Ch~k~v~-~GyvCs~Clsi~C~~p  269 (279)
T TIGR00627       241 YRASCF-CHHQLVS-IGFVCSVCLSVLCQYT  269 (279)
T ss_pred             Ccceee-ecCcccc-ceEECCCccCCcCCCC
Confidence            345775 7887766 799999 999999864


No 100
>PF13771 zf-HC5HC2H:  PHD-like zinc-binding domain
Probab=29.10  E-value=39  Score=22.13  Aligned_cols=24  Identities=17%  Similarity=0.559  Sum_probs=17.4

Q ss_pred             ccCCcCCCcccccccccccccceeec
Q psy11667         50 KKTKHKRSRCAQCNAKLTVCSSFTCR   75 (119)
Q Consensus        50 ~~~~~~k~RC~~C~kkl~Ls~~f~Cr   75 (119)
                      ......+.+|..|+++.|.  ...|.
T Consensus        30 ~~~~~~~~~C~~C~~~~Ga--~i~C~   53 (90)
T PF13771_consen   30 EIKRRRKLKCSICKKKGGA--CIGCS   53 (90)
T ss_pred             HHHHHhCCCCcCCCCCCCe--EEEEe
Confidence            3445667799999999777  55565


No 101
>PRK06386 replication factor A; Reviewed
Probab=28.90  E-value=25  Score=30.25  Aligned_cols=20  Identities=20%  Similarity=0.534  Sum_probs=14.7

Q ss_pred             CCcccccccccccccceeec-cCC
Q psy11667         56 RSRCAQCNAKLTVCSSFTCR-CRK   78 (119)
Q Consensus        56 k~RC~~C~kkl~Ls~~f~Cr-Cg~   78 (119)
                      -.||+.|++.|..   ..|+ ||.
T Consensus       236 i~rCP~C~R~l~~---g~C~~HG~  256 (358)
T PRK06386        236 FTKCSVCNKIIED---GVCKDHPD  256 (358)
T ss_pred             EecCcCCCeEccC---CcCCCCCC
Confidence            3799999999853   3676 654


No 102
>PF13832 zf-HC5HC2H_2:  PHD-zinc-finger like domain
Probab=28.64  E-value=39  Score=23.05  Aligned_cols=20  Identities=15%  Similarity=0.501  Sum_probs=15.6

Q ss_pred             cCCCcccccccccccccceeec
Q psy11667         54 HKRSRCAQCNAKLTVCSSFTCR   75 (119)
Q Consensus        54 ~~k~RC~~C~kkl~Ls~~f~Cr   75 (119)
                      ....+|.+|++..|.  ..+|.
T Consensus        53 ~~~~~C~iC~~~~G~--~i~C~   72 (110)
T PF13832_consen   53 RFKLKCSICGKSGGA--CIKCS   72 (110)
T ss_pred             hcCCcCcCCCCCCce--eEEcC
Confidence            467899999999887  55555


No 103
>PF14835 zf-RING_6:  zf-RING of BARD1-type protein; PDB: 1JM7_B.
Probab=27.96  E-value=32  Score=23.11  Aligned_cols=25  Identities=28%  Similarity=0.689  Sum_probs=10.6

Q ss_pred             Ccccccccccccccce-eeccCCcccCC
Q psy11667         57 SRCAQCNAKLTVCSSF-TCRCRKLFCPR   83 (119)
Q Consensus        57 ~RC~~C~kkl~Ls~~f-~CrCg~~FC~~   83 (119)
                      -||+.|..-+..  ++ .-.|...||+.
T Consensus         8 LrCs~C~~~l~~--pv~l~~CeH~fCs~   33 (65)
T PF14835_consen    8 LRCSICFDILKE--PVCLGGCEHIFCSS   33 (65)
T ss_dssp             TS-SSS-S--SS---B---SSS--B-TT
T ss_pred             cCCcHHHHHhcC--CceeccCccHHHHH
Confidence            589999876544  32 24489999975


No 104
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=27.49  E-value=36  Score=26.23  Aligned_cols=24  Identities=25%  Similarity=0.621  Sum_probs=16.6

Q ss_pred             cCCCcccccccccccccceeec-cCCc
Q psy11667         54 HKRSRCAQCNAKLTVCSSFTCR-CRKL   79 (119)
Q Consensus        54 ~~k~RC~~C~kkl~Ls~~f~Cr-Cg~~   79 (119)
                      .....|+.|+. +.- ..|.|. ||..
T Consensus       307 ~tS~~C~~cg~-~~~-r~~~C~~cg~~  331 (364)
T COG0675         307 YTSKTCPCCGH-LSG-RLFKCPRCGFV  331 (364)
T ss_pred             CCcccccccCC-ccc-eeEECCCCCCe
Confidence            34468999998 322 468898 8765


No 105
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=27.34  E-value=28  Score=19.67  Aligned_cols=9  Identities=22%  Similarity=0.995  Sum_probs=5.0

Q ss_pred             eeec-cCCcc
Q psy11667         72 FTCR-CRKLF   80 (119)
Q Consensus        72 f~Cr-Cg~~F   80 (119)
                      +.|. ||..|
T Consensus        26 v~C~~C~~~~   35 (38)
T TIGR02098        26 VRCGKCGHVW   35 (38)
T ss_pred             EECCCCCCEE
Confidence            4565 65554


No 106
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=26.34  E-value=31  Score=19.40  Aligned_cols=23  Identities=17%  Similarity=0.521  Sum_probs=15.0

Q ss_pred             ceeec-cCCcccCCCCC--CCCCCCc
Q psy11667         71 SFTCR-CRKLFCPRHRH--PEEHACT   93 (119)
Q Consensus        71 ~f~Cr-Cg~~FC~~HR~--pe~H~C~   93 (119)
                      .|.|. ||..|=..+..  .+...|+
T Consensus         5 ~y~C~~Cg~~fe~~~~~~~~~~~~CP   30 (41)
T smart00834        5 EYRCEDCGHTFEVLQKISDDPLATCP   30 (41)
T ss_pred             EEEcCCCCCEEEEEEecCCCCCCCCC
Confidence            68999 99987544433  4455565


No 107
>PF02207 zf-UBR:  Putative zinc finger in N-recognin (UBR box);  InterPro: IPR003126 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The N-end rule-based degradation signal, which targets a protein for ubiquitin-dependent proteolysis, comprises a destabilising amino-terminal residue and a specific internal lysine residue. This entry describes a putative zinc finger in N-recognin, a recognition component of the N-end rule pathway []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0004842 ubiquitin-protein ligase activity, 0008270 zinc ion binding; PDB: 3NY1_B 3NIS_F 3NIM_A 3NIK_A 3NII_A 3NIH_A 3NIL_D 3NIN_B 3NIJ_A 3NIT_A ....
Probab=26.06  E-value=38  Score=22.00  Aligned_cols=15  Identities=33%  Similarity=0.975  Sum_probs=8.4

Q ss_pred             ceeeccCCc-------ccCCCC
Q psy11667         71 SFTCRCRKL-------FCPRHR   85 (119)
Q Consensus        71 ~f~CrCg~~-------FC~~HR   85 (119)
                      ++.|-||..       ||..||
T Consensus        50 ~~~CDCG~~~~~k~~~~C~~H~   71 (71)
T PF02207_consen   50 GGCCDCGDPEAWKKEGFCKKHK   71 (71)
T ss_dssp             CEBB-TT-GGGBSS--S-TTT-
T ss_pred             CeEEeCCCCccccCCCCCCCCC
Confidence            688888876       677775


No 108
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms]
Probab=25.78  E-value=23  Score=30.64  Aligned_cols=26  Identities=23%  Similarity=0.763  Sum_probs=18.5

Q ss_pred             CCcccccccccccccceeeccCCcccCC
Q psy11667         56 RSRCAQCNAKLTVCSSFTCRCRKLFCPR   83 (119)
Q Consensus        56 k~RC~~C~kkl~Ls~~f~CrCg~~FC~~   83 (119)
                      --||..|.-.+..  .-.=.||.+||+.
T Consensus        25 ~lrC~IC~~~i~i--p~~TtCgHtFCsl   50 (391)
T COG5432          25 MLRCRICDCRISI--PCETTCGHTFCSL   50 (391)
T ss_pred             HHHhhhhhheeec--ceecccccchhHH
Confidence            3599999887755  3333499999874


No 109
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=25.43  E-value=38  Score=21.13  Aligned_cols=28  Identities=18%  Similarity=0.511  Sum_probs=18.7

Q ss_pred             cCCCcccccccc-cccc-cceeec-cCCccc
Q psy11667         54 HKRSRCAQCNAK-LTVC-SSFTCR-CRKLFC   81 (119)
Q Consensus        54 ~~k~RC~~C~kk-l~Ls-~~f~Cr-Cg~~FC   81 (119)
                      ....-|..|+.. +... ..+.|. ||.++-
T Consensus        18 ~~~~fCP~Cg~~~m~~~~~r~~C~~Cgyt~~   48 (50)
T PRK00432         18 RKNKFCPRCGSGFMAEHLDRWHCGKCGYTEF   48 (50)
T ss_pred             EccCcCcCCCcchheccCCcEECCCcCCEEe
Confidence            445589899873 3222 478898 888763


No 110
>KOG0193|consensus
Probab=25.34  E-value=26  Score=32.74  Aligned_cols=49  Identities=31%  Similarity=0.582  Sum_probs=27.9

Q ss_pred             ccccccccccccceeec-cCCcc--cCCCCCCCCCCCccccHHhhHHHHHHhCCccc
Q psy11667         59 CAQCNAKLTVCSSFTCR-CRKLF--CPRHRHPEEHACTFDYKAYGRHLLAATNPLVV  112 (119)
Q Consensus        59 C~~C~kkl~Ls~~f~Cr-Cg~~F--C~~HR~pe~H~C~fDyk~~gr~~Lak~NP~v~  112 (119)
                      |..|..++-+ ++|+|+ |++.|  .+.-|.|.  .|. ++ .-.++.+...+|-+.
T Consensus       192 C~~~~~~~l~-~gfrC~~C~~KfHq~Cs~~vp~--~C~-~~-~~~~~~~~~~~~~~~  243 (678)
T KOG0193|consen  192 CDSCCNKFLF-TGFRCQTCGYKFHQSCSPRVPT--SCV-NP-DHLRQLLVFEFPAVG  243 (678)
T ss_pred             hhhhcchhhh-cccccCCCCCccccccCCCCCC--CCC-Cc-chHhhhhhhcccccc
Confidence            4434556645 799999 99976  22334553  343 22 234455666666553


No 111
>KOG3497|consensus
Probab=24.93  E-value=26  Score=23.71  Aligned_cols=13  Identities=23%  Similarity=0.508  Sum_probs=10.1

Q ss_pred             CCccccccccccc
Q psy11667         56 RSRCAQCNAKLTV   68 (119)
Q Consensus        56 k~RC~~C~kkl~L   68 (119)
                      +-||++|+|-+|-
T Consensus         4 PiRCFtCGKvig~   16 (69)
T KOG3497|consen    4 PIRCFTCGKVIGD   16 (69)
T ss_pred             eeEeeeccccccc
Confidence            4599999997763


No 112
>COG1933 Archaeal DNA polymerase II, large subunit [DNA replication, recombination, and repair]
Probab=24.55  E-value=28  Score=29.01  Aligned_cols=26  Identities=27%  Similarity=0.571  Sum_probs=19.5

Q ss_pred             cCCCcccccccccccc-cceeec-cCCc
Q psy11667         54 HKRSRCAQCNAKLTVC-SSFTCR-CRKL   79 (119)
Q Consensus        54 ~~k~RC~~C~kkl~Ls-~~f~Cr-Cg~~   79 (119)
                      .+.-||..|+++++-. +..+|. ||+.
T Consensus       165 rq~~rc~~c~~k~rr~pl~g~c~kcg~~  192 (253)
T COG1933         165 RQEFRCVKCNTKFRRPPLDGKCPICGGK  192 (253)
T ss_pred             hheeehHhhhhhhcCCCccccccccCCe
Confidence            4456899999887743 578888 8875


No 113
>PF06689 zf-C4_ClpX:  ClpX C4-type zinc finger;  InterPro: IPR010603 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The ClpX heat shock protein of Escherichia coli is a member of the universally conserved Hsp100 family of proteins, and possesses a putative zinc finger motif of the C4 type []. This presumed zinc binding domain (ZBD) is found at the N terminus of the ClpX protein. ClpX is an ATPase which functions both as a substrate specificity component of the ClpXP protease and as a molecular chaperone. ZBD is a member of the treble clef zinc finger family, a motif known to facilitate protein-ligand, protein-DNA, and protein-protein interactions and forms a constitutive dimer that is essential for the degradation of some, but not all, ClpX substrates []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0016887 ATPase activity, 0046983 protein dimerization activity, 0006200 ATP catabolic process, 0019538 protein metabolic process; PDB: 2DS8_B 2DS6_B 2DS5_A 1OVX_A 2DS7_A.
Probab=24.07  E-value=31  Score=20.50  Aligned_cols=11  Identities=27%  Similarity=0.733  Sum_probs=5.2

Q ss_pred             Ccccccccccc
Q psy11667         57 SRCAQCNAKLT   67 (119)
Q Consensus        57 ~RC~~C~kkl~   67 (119)
                      .+|++|++...
T Consensus         2 ~~CSFCgr~~~   12 (41)
T PF06689_consen    2 KRCSFCGRPES   12 (41)
T ss_dssp             -B-TTT--BTT
T ss_pred             CCccCCCCCHH
Confidence            58999998553


No 114
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=23.96  E-value=44  Score=17.82  Aligned_cols=6  Identities=50%  Similarity=1.353  Sum_probs=2.6

Q ss_pred             cccccc
Q psy11667         59 CAQCNA   64 (119)
Q Consensus        59 C~~C~k   64 (119)
                      |..|++
T Consensus         2 C~~C~~    7 (39)
T smart00132        2 CAGCGK    7 (39)
T ss_pred             ccccCC
Confidence            444444


No 115
>PF09779 Ima1_N:  Ima1 N-terminal domain;  InterPro: IPR018617  Members of this family of uncharacterised novel proteins have no known function. 
Probab=23.40  E-value=47  Score=24.30  Aligned_cols=22  Identities=32%  Similarity=0.751  Sum_probs=14.7

Q ss_pred             cccccccccccc----cc-eeec-cCCc
Q psy11667         58 RCAQCNAKLTVC----SS-FTCR-CRKL   79 (119)
Q Consensus        58 RC~~C~kkl~Ls----~~-f~Cr-Cg~~   79 (119)
                      +||+|+++..+.    +. |.|. |+.+
T Consensus         2 ~C~fC~~~s~~~~~~~~~~w~C~~C~q~   29 (131)
T PF09779_consen    2 NCWFCGQNSKVPYDNRNSNWTCPHCEQY   29 (131)
T ss_pred             eeccCCCCCCCCCCCCCCeeECCCCCCc
Confidence            699998764432    34 8888 7643


No 116
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=23.35  E-value=47  Score=25.07  Aligned_cols=26  Identities=12%  Similarity=0.192  Sum_probs=19.1

Q ss_pred             CCCcccccccccccc--cceeec-cCCcc
Q psy11667         55 KRSRCAQCNAKLTVC--SSFTCR-CRKLF   80 (119)
Q Consensus        55 ~k~RC~~C~kkl~Ls--~~f~Cr-Cg~~F   80 (119)
                      .|..|..|++|..--  .+..|- ||..|
T Consensus         8 tKr~Cp~cg~kFYDLnk~p~vcP~cg~~~   36 (129)
T TIGR02300         8 TKRICPNTGSKFYDLNRRPAVSPYTGEQF   36 (129)
T ss_pred             ccccCCCcCccccccCCCCccCCCcCCcc
Confidence            467899999875521  578888 88776


No 117
>COG1644 RPB10 DNA-directed RNA polymerase, subunit N (RpoN/RPB10) [Transcription]
Probab=23.23  E-value=27  Score=23.41  Aligned_cols=13  Identities=23%  Similarity=0.557  Sum_probs=10.3

Q ss_pred             CCccccccccccc
Q psy11667         56 RSRCAQCNAKLTV   68 (119)
Q Consensus        56 k~RC~~C~kkl~L   68 (119)
                      +-||+.|++.++-
T Consensus         4 PiRCFsCGkvi~~   16 (63)
T COG1644           4 PVRCFSCGKVIGH   16 (63)
T ss_pred             ceEeecCCCCHHH
Confidence            4599999998764


No 118
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=22.78  E-value=41  Score=20.14  Aligned_cols=23  Identities=17%  Similarity=0.574  Sum_probs=16.5

Q ss_pred             ceeec-cCCcccCCCCCCC--CCCCc
Q psy11667         71 SFTCR-CRKLFCPRHRHPE--EHACT   93 (119)
Q Consensus        71 ~f~Cr-Cg~~FC~~HR~pe--~H~C~   93 (119)
                      .|.|. ||..|=..+.+.+  .-.|+
T Consensus         5 ey~C~~Cg~~fe~~~~~~~~~~~~CP   30 (52)
T TIGR02605         5 EYRCTACGHRFEVLQKMSDDPLATCP   30 (52)
T ss_pred             EEEeCCCCCEeEEEEecCCCCCCCCC
Confidence            68999 9998877766553  34566


No 119
>PF04236 Transp_Tc5_C:  Tc5 transposase C-terminal domain;  InterPro: IPR007350 This domain corresponds to a C-terminal cysteine rich region that probably binds to a metal ion and could be DNA-binding. It is found in association with the DDE superfamily (IPR004875 from INTERPRO) and the Tc5 transposase family (IPR004906 from INTERPRO). More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=22.22  E-value=40  Score=22.18  Aligned_cols=32  Identities=38%  Similarity=0.824  Sum_probs=23.4

Q ss_pred             Ccccc--cccccccccceeec-cCCcccCCCCC-CCCCCC
Q psy11667         57 SRCAQ--CNAKLTVCSSFTCR-CRKLFCPRHRH-PEEHAC   92 (119)
Q Consensus        57 ~RC~~--C~kkl~Ls~~f~Cr-Cg~~FC~~HR~-pe~H~C   92 (119)
                      ..|..  |+.-    .-..|. |.+.+|-.|-+ .+.|.|
T Consensus        28 ~~C~~~gC~~~----s~I~C~~Ckk~~Cf~Hfiv~~~H~C   63 (63)
T PF04236_consen   28 GDCDITGCNNT----SFIRCAYCKKSLCFNHFIVSEYHLC   63 (63)
T ss_pred             CcCCCCCCCCc----CEEEccccCCcccccceeeeeeEcC
Confidence            34554  6552    245798 99999999999 578877


No 120
>PF08646 Rep_fac-A_C:  Replication factor-A C terminal domain;  InterPro: IPR013955 Replication factor A (RP-A) binds and subsequently stabilises single-stranded DNA intermediates and thus prevents complementary DNA from reannealing. It also plays an essential role in several cellular processes in DNA metabolism including replication, recombination and repair of DNA []. Replication factor-A protein is also known as Replication protein A 70 kDa DNA-binding subunit.  This entry is found at the C terminus of Replication factor A.; PDB: 1L1O_F 3U50_C.
Probab=22.05  E-value=29  Score=25.02  Aligned_cols=32  Identities=34%  Similarity=0.728  Sum_probs=19.5

Q ss_pred             CCCccc--ccccccccc--cceeec-cCCcc-cCCCCC
Q psy11667         55 KRSRCA--QCNAKLTVC--SSFTCR-CRKLF-CPRHRH   86 (119)
Q Consensus        55 ~k~RC~--~C~kkl~Ls--~~f~Cr-Cg~~F-C~~HR~   86 (119)
                      .=.-|.  .|+|||...  ..+.|. |+..+ =..+||
T Consensus        17 ~Y~aC~~~~C~kKv~~~~~~~y~C~~C~~~~~~~~~ry   54 (146)
T PF08646_consen   17 YYPACPNEKCNKKVTENGDGSYRCEKCNKTVENPKYRY   54 (146)
T ss_dssp             EEEE-TSTTTS-B-EEETTTEEEETTTTEEESS-EEEE
T ss_pred             EECCCCCccCCCEeecCCCcEEECCCCCCcCCCeeEEE
Confidence            334688  899998763  247997 98775 446776


No 121
>COG3877 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=22.01  E-value=59  Score=24.24  Aligned_cols=33  Identities=24%  Similarity=0.584  Sum_probs=26.2

Q ss_pred             cCCCcccccccccccccceeec-cCCcccCCCCCC
Q psy11667         54 HKRSRCAQCNAKLTVCSSFTCR-CRKLFCPRHRHP   87 (119)
Q Consensus        54 ~~k~RC~~C~kkl~Ls~~f~Cr-Cg~~FC~~HR~p   87 (119)
                      +-.++|..|++++-. +.-+|. |+-+.=+.-|..
T Consensus         4 ~~~~~cPvcg~~~iV-TeL~c~~~etTVrg~F~~s   37 (122)
T COG3877           4 KVINRCPVCGRKLIV-TELKCSNCETTVRGNFKMS   37 (122)
T ss_pred             CCCCCCCccccccee-EEEecCCCCceEecceecc
Confidence            456899999999966 899999 988876666554


No 122
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=21.57  E-value=39  Score=25.38  Aligned_cols=26  Identities=23%  Similarity=0.480  Sum_probs=19.9

Q ss_pred             cCCCccccccccccc----ccceeec-cCCc
Q psy11667         54 HKRSRCAQCNAKLTV----CSSFTCR-CRKL   79 (119)
Q Consensus        54 ~~k~RC~~C~kkl~L----s~~f~Cr-Cg~~   79 (119)
                      ..--.|..|+.+...    ..+|.|- ||..
T Consensus       107 ~~~Y~Cp~c~~r~tf~eA~~~~F~Cp~Cg~~  137 (158)
T TIGR00373       107 NMFFICPNMCVRFTFNEAMELNFTCPRCGAM  137 (158)
T ss_pred             CCeEECCCCCcEeeHHHHHHcCCcCCCCCCE
Confidence            445679999988764    2599999 9886


No 123
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=20.91  E-value=42  Score=26.24  Aligned_cols=16  Identities=38%  Similarity=0.692  Sum_probs=11.9

Q ss_pred             CcCCCccccccccccc
Q psy11667         53 KHKRSRCAQCNAKLTV   68 (119)
Q Consensus        53 ~~~k~RC~~C~kkl~L   68 (119)
                      ....+||..|+-.|..
T Consensus        94 ~~e~~RCp~CN~~L~~  109 (165)
T COG1656          94 FPEFSRCPECNGELEK  109 (165)
T ss_pred             ccccccCcccCCEecc
Confidence            3557899999976654


No 124
>PF06467 zf-FCS:  MYM-type Zinc finger with FCS sequence motif;  InterPro: IPR010507 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  MYM-type zinc fingers were identified in MYM family proteins []. Human protein Q14202 from SWISSPROT is involved in a chromosomal translocation and may be responsible for X-linked retardation in XQ13.1 []. Q9UBW7 from SWISSPROT is also involved in disease. In myeloproliferative disorders it is fused to FGF receptor 1 []; in atypical myeloproliferative disorders it is rearranged []. Members of the family generally are involved in development. This Zn-finger domain functions as a transcriptional trans-activator of late vaccinia viral genes, and orthologues are also found in all nucleocytoplasmic large DNA viruses, NCLDV. This domain is also found fused to the C termini of recombinases from certain prokaryotic transposons []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2L8E_A 2DAS_A.
Probab=20.76  E-value=40  Score=19.28  Aligned_cols=15  Identities=20%  Similarity=0.465  Sum_probs=7.6

Q ss_pred             cCCCccccccccccc
Q psy11667         54 HKRSRCAQCNAKLTV   68 (119)
Q Consensus        54 ~~k~RC~~C~kkl~L   68 (119)
                      ...++|..|++.+..
T Consensus         4 ~~~~~C~~C~~~~~~   18 (43)
T PF06467_consen    4 LKMKTCSYCKKYIPN   18 (43)
T ss_dssp             -SCEE-TTT--EEEC
T ss_pred             CcCCcCcccCCcccC
Confidence            346789999886643


No 125
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=20.72  E-value=49  Score=19.24  Aligned_cols=11  Identities=36%  Similarity=0.757  Sum_probs=4.2

Q ss_pred             ccccccccccc
Q psy11667         58 RCAQCNAKLTV   68 (119)
Q Consensus        58 RC~~C~kkl~L   68 (119)
                      -|..|+..|.+
T Consensus         2 fC~~CG~~l~~   12 (34)
T PF14803_consen    2 FCPQCGGPLER   12 (34)
T ss_dssp             B-TTT--B-EE
T ss_pred             ccccccChhhh
Confidence            36667766654


No 126
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=20.66  E-value=34  Score=20.32  Aligned_cols=25  Identities=24%  Similarity=0.632  Sum_probs=12.3

Q ss_pred             cccccccccccccceeeccCCcccCC
Q psy11667         58 RCAQCNAKLTVCSSFTCRCRKLFCPR   83 (119)
Q Consensus        58 RC~~C~kkl~Ls~~f~CrCg~~FC~~   83 (119)
                      +|..|++.|.. ..|.=.=|..||..
T Consensus        28 ~C~~C~~~l~~-~~~~~~~~~~~C~~   52 (58)
T PF00412_consen   28 KCSKCGKPLND-GDFYEKDGKPYCKD   52 (58)
T ss_dssp             BETTTTCBTTT-SSEEEETTEEEEHH
T ss_pred             ccCCCCCccCC-CeeEeECCEEECHH
Confidence            44457777665 23433334445443


No 127
>PF08073 CHDNT:  CHDNT (NUC034) domain;  InterPro: IPR012958 The CHD N-terminal domain is found in PHD/RING fingers and chromo domain-associated helicases [].; GO: 0003677 DNA binding, 0005524 ATP binding, 0008270 zinc ion binding, 0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=20.57  E-value=36  Score=22.11  Aligned_cols=20  Identities=35%  Similarity=0.376  Sum_probs=15.9

Q ss_pred             HhhHHHHHHhCCcccccccc
Q psy11667         98 AYGRHLLAATNPLVVADKVV  117 (119)
Q Consensus        98 ~~gr~~Lak~NP~v~~~Kl~  117 (119)
                      +.=|-.|+++||++.-.||-
T Consensus        21 q~vRP~l~~~NPk~~~sKl~   40 (55)
T PF08073_consen   21 QHVRPLLAKANPKAPMSKLM   40 (55)
T ss_pred             HHHHHHHHHHCCCCcHHHHH
Confidence            34577889999999888874


No 128
>PF12773 DZR:  Double zinc ribbon
Probab=20.42  E-value=70  Score=18.88  Aligned_cols=26  Identities=23%  Similarity=0.478  Sum_probs=17.1

Q ss_pred             cCCCcccccccccc--cccceeec-cCCc
Q psy11667         54 HKRSRCAQCNAKLT--VCSSFTCR-CRKL   79 (119)
Q Consensus        54 ~~k~RC~~C~kkl~--Ls~~f~Cr-Cg~~   79 (119)
                      .....|..|+.+|.  ......|. ||..
T Consensus        10 ~~~~fC~~CG~~l~~~~~~~~~C~~Cg~~   38 (50)
T PF12773_consen   10 DDAKFCPHCGTPLPPPDQSKKICPNCGAE   38 (50)
T ss_pred             ccccCChhhcCChhhccCCCCCCcCCcCC
Confidence            34567888888887  33456787 6653


No 129
>PF00628 PHD:  PHD-finger;  InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the PHD (homeodomain) zinc finger domain [,], which is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in chromatin-mediated transcriptional regulation. The PHD finger motif is reminiscent of, but distinct from the C3HC4 type RING finger. The function of this domain is not yet known but in analogy with the LIM domain it could be involved in protein-protein interaction and be important for the assembly or activity of multicomponent complexes involved in transcriptional activation or repression. Alternatively, the interactions could be intra-molecular and be important in maintaining the structural integrity of the protein. In similarity to the RING finger and the LIM domain, the PHD finger is thought to bind two zinc ions. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0005515 protein binding; PDB: 3ZVY_A 2LGG_A 3SOW_A 3SOU_B 3ASL_A 3ASK_A 3ZVZ_B 3T6R_A 2LGK_A 3SOX_B ....
Probab=20.37  E-value=66  Score=18.84  Aligned_cols=22  Identities=18%  Similarity=0.554  Sum_probs=12.6

Q ss_pred             cccccccccccccceeec-cCCc
Q psy11667         58 RCAQCNAKLTVCSSFTCR-CRKL   79 (119)
Q Consensus        58 RC~~C~kkl~Ls~~f~Cr-Cg~~   79 (119)
                      +|.+|++......-..|. |+..
T Consensus         1 ~C~vC~~~~~~~~~i~C~~C~~~   23 (51)
T PF00628_consen    1 YCPVCGQSDDDGDMIQCDSCNRW   23 (51)
T ss_dssp             EBTTTTSSCTTSSEEEBSTTSCE
T ss_pred             eCcCCCCcCCCCCeEEcCCCChh
Confidence            366777733333456677 6655


No 130
>PRK08329 threonine synthase; Validated
Probab=20.19  E-value=61  Score=26.86  Aligned_cols=31  Identities=16%  Similarity=0.404  Sum_probs=21.3

Q ss_pred             CcccccccccccccceeeccCCcccCCCCCC
Q psy11667         57 SRCAQCNAKLTVCSSFTCRCRKLFCPRHRHP   87 (119)
Q Consensus        57 ~RC~~C~kkl~Ls~~f~CrCg~~FC~~HR~p   87 (119)
                      -+|..|++.......+.|.||..|=..+.|.
T Consensus         2 l~C~~Cg~~~~~~~~~~C~c~~~l~~~~~~~   32 (347)
T PRK08329          2 LRCTKCGRTYEEKFKLRCDCGGTLLVEREYG   32 (347)
T ss_pred             cCcCCCCCCcCCCCceecCCCCcEEEEeccc
Confidence            4799999877654457899887665554443


Done!