RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy11691
         (271 letters)



>gnl|CDD|188784 cd09400, LIM_like_1, LIM domain in proteins of unknown function.
           LIM domain in proteins of unknown function: LIM domains
           are identified in a diverse group of proteins with wide
           variety of biological functions, including gene
           expression regulation, cell fate determination,
           cytoskeleton organization, tumor formation, and
           development. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes. They perform their functions through
           interactions with other protein partners. The LIM
           domains are 50-60 amino acids in size and share two
           characteristic highly conserved zinc finger motifs. The
           two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. The consensus sequence of LIM domain
           has been defined as
           C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,
           21)-C-x(2,3)-[CHD] (where X denotes any amino acid).
          Length = 61

 Score = 85.2 bits (211), Expect = 1e-21
 Identities = 32/61 (52%), Positives = 41/61 (67%)

Query: 94  KLNSCSLCGEKVYLAQRFAFNARLFHRTCFKCARCQSQLTCINAYETHTGQFCCEVCPDE 153
           +   C+ CG  V+LA+R     +++HRTCFKCARC  QLT  + YET  G +CCE CPDE
Sbjct: 1   RREPCASCGLPVFLAERLLIEGKVYHRTCFKCARCGVQLTPGSFYETEYGSYCCETCPDE 60

Query: 154 E 154
           E
Sbjct: 61  E 61


>gnl|CDD|188744 cd09358, LIM_Mical_like, The LIM domain of Mical (molecule
           interacting with CasL) like family.  The LIM domain of
           Mical (molecule interacting with CasL) like family:
           Known members of this family includes  LIM domain
           containing proteins; Mical (molecule interacting with
           CasL), pollen specific protein SF3, Eplin, xin
           actin-binding repeat-containing protein 2 (XIRP2) and
           Ltd-1. The members of this family function mainly at the
           cytoskeleton and focal adhesions. They interact with
           transcription factors or other signaling molecules to
           play roles in muscle development, neuronal
           differentiation, cell growth and mobility.  Eplin has
           also found to be tumor suppressor. As in other LIM
           domains, this domain family is 50-60 amino acids in size
           and shares two characteristic zinc finger motifs.. The
           two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein.
          Length = 53

 Score = 58.8 bits (143), Expect = 6e-12
 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 98  CSLCGEKVYLAQRFAFNARLFHRTCFKCARCQSQLTCINAYETHTGQFCCEV 149
           C++CG+ VY  +R   + +LFH++CF+C+ C   L   N Y +  G+  C+ 
Sbjct: 1   CAVCGKTVYPMERLVADGKLFHKSCFRCSHCNKTLRLGN-YASLEGKLYCKP 51


>gnl|CDD|188828 cd09444, LIM_Mical_like_1, This domain belongs to the LIM domain
           family which are found on Mical (molecule interacting
           with CasL) like proteins.  The LIM domain on proteins of
           unknown function: This domain belongs to the LIM domain
           family which are found on Mical (molecule interacting
           with CasL) like proteins. Known members of the
           Mical-like family includes single LIM domain containing
           proteins, Mical (molecule interacting with CasL), pollen
           specific protein SF3, Eplin, xin actin-binding
           repeat-containing protein 2 (XIRP2), and Ltd-1. The
           members of this family function mainly at the
           cytoskeleton and focal adhesions. They interact with
           transcription factors or other signaling molecules to
           play roles in muscle development, neuronal
           differentiation, cell growth, and mobility.  As in other
           LIM domains, this domain family is 50-60 amino acids in
           size and shares two characteristic zinc finger motifs.
           The two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein.
          Length = 55

 Score = 48.6 bits (116), Expect = 3e-08
 Identities = 16/35 (45%), Positives = 23/35 (65%)

Query: 98  CSLCGEKVYLAQRFAFNARLFHRTCFKCARCQSQL 132
           C+ CG+ V+L QR   + +L+HR CF+C  C S L
Sbjct: 1   CAACGQHVHLVQRHLVDGKLYHRNCFRCKECSSTL 35


>gnl|CDD|188785 cd09401, LIM_TLP_like, The  LIM domains of thymus LIM protein
           (TLP).  The LIM domain of thymus LIM protein (TLP) like
           proteins:  This family includes the LIM domains of TLP
           and CRIP (Cysteine-Rich Intestinal Protein). TLP is the
           distant member of the CRP family of proteins. TLP has
           two isomers (TLP-A and TLP-B) and sharing approximately
           30% with each of the three other CRPs.  Like CRP1, CRP2
           and CRP3/MLP, TLP has two LIM domains, connected by a
           flexible linker region. Unlike the CRPs, TLP lacks the
           nuclear targeting signal (K/R-K/R-Y-G-P-K) and is
           localized solely in the cytoplasm. TLP is specifically
           expressed in the thymus in a subset of cortical
           epithelial cells.  TLP has a role in development of
           normal thymus and in controlling the development and
           differentiation of thymic epithelial cells. CRIP is a
           short LIM protein with only one LIM domain. CRIP gene is
           developmentally regulated and can be induced by
           glucocorticoid hormones during the first three postnatal
           weeks. The domain shows close sequence homology to LIM
           domain of thymus LIM protein. However, unlike the TLP
           proteins which have two LIM domains, the members of this
           family have only one LIM domain. LIM domains are 50-60
           amino acids in size and share two characteristic zinc
           finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 53

 Score = 46.6 bits (111), Expect = 2e-07
 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 1/53 (1%)

Query: 98  CSLCGEKVYLAQRFAFNARLFHRTCFKCARCQSQLTCINAYETHTGQFCCEVC 150
           C  CG+ VY A++     R +H+ C +C +C+  LT    +  H G+  C  C
Sbjct: 1   CPKCGKPVYFAEKKTSLGRDWHKPCLRCEKCKKTLTPGQ-HSEHEGKPYCNKC 52


>gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1,
           Mec-3.  Zinc-binding domain family. Some LIM domains
           bind protein partners via tyrosine-containing motifs.
           LIM domains are found in many key regulators of
           developmental pathways.
          Length = 54

 Score = 44.7 bits (106), Expect = 8e-07
 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 4/56 (7%)

Query: 97  SCSLCGEKVYLAQRFAFNA--RLFHRTCFKCARCQSQLTCINAYETHTGQFCCEVC 150
            C+ CG+ +Y        A  +++H  CFKCA C   L+    +E   G+  C+ C
Sbjct: 1   KCAGCGKPIY-GTERVLRALGKVWHPECFKCATCGKPLSGDTFFE-KDGKLYCKDC 54


>gnl|CDD|188823 cd09439, LIM_Mical, The LIM domain of Mical (molecule interacting
           with CasL).  The LIM domain of Mical (molecule
           interacting with CasL): MICAL is a large, multidomain,
           cytosolic protein with a single LIM domain, a calponin
           homology (CH) domain and a flavoprotein monooxygenase
           domain. In Drosophila, MICAL is expressed in axons,
           interacts with the neuronal A (PlexA)  receptor and is
           required for Semapho-rin 1a (Sema-1a)-PlexA-mediated
           repulsive axon guidance.  The LIM domain and calporin
           homology domain are known for interactions with the
           cytoskeleton, cytoskeletal adaptor proteins, and other
           signaling proteins. The flavoprotein monooxygenase (MO)
           is required for semaphorin-plexin repulsive axon
           guidance during axonal pathfinding in the Drosophila
           neuromuscular system. In addition, MICAL was
           characterized to interact with Rab13 and Rab8 to
           coordinate the assembly of tight junctions and adherens
           junctions in epithelial cells. Thus, MICAL was also
           named junctional Rab13-binding protein (JRAB). As in
           other LIM domains, this domain family is 50-60 amino
           acids in size and shares two characteristic zinc finger
           motifs. The two zinc fingers contain eight conserved
           residues, mostly cysteines and histidines, which
           coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein.
          Length = 55

 Score = 43.8 bits (104), Expect = 2e-06
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 98  CSLCGEKVYLAQRFAFNARLFHRTCFKCARCQSQLTCIN-AYETHTGQFCCE 148
           C  C ++VY+ +R +     FHR+CFKC+ C + L     A++   G+F C+
Sbjct: 1   CYFCKKRVYVMERLSAEGLFFHRSCFKCSYCGTTLRLGAYAFDRDDGKFYCK 52


>gnl|CDD|188866 cd09482, LIM2_CRP3, The second LIM domain of Cysteine Rich Protein
           3 (CRP3/MLP).  The second LIM domain of Cysteine Rich
           Protein 3 (CRP3/MLP):  Cysteine-rich proteins (CRPs) are
           characterized by the presence of two LIM domains linked
           to short glycine-rich repeats (GRRs). The CRP family
           members include CRP1, CRP2, CRP3/MLP and TLPCRP1, CRP2
           and CRP3 share a conserved nuclear targeting signal
           (K/R-K/R-Y-G-P-K), which supports the fact that these
           proteins function not only in the cytoplasm but also in
           the nucleus. CRPs control regulatory pathways during
           cellular differentiation, and involve in complex
           transcription circuits, and the organization as well as
           the arrangement of the myofibrillar/cytoskeletal
           network.CRP3 also called Muscle LIM Protein (MLP), which
           is a striated muscle-specific factor that enhances
           myogenic differentiation. The second LIM domain of
           CRP3/MLP interacts with cytoskeletal protein
           beta-spectrin. CRP3/MLP also interacts with the basic
           helix-loop-helix myogenic transcription factors MyoD,
           myogenin, and MRF4 thereby increasing their affinity for
           specific DNA regulatory elements. LIM domains are 50-60
           amino acids in size and share two characteristic zinc
           finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 54

 Score = 43.5 bits (102), Expect = 2e-06
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 98  CSLCGEKVYLAQRFAFNARLFHRTCFKCARCQSQLTCINAYETHTGQFCCEVC 150
           C  CG+ VY A++     + +H+TCF+CA C   L      +   G+  C+VC
Sbjct: 1   CPRCGKSVYAAEKVMGGGKPWHKTCFRCAICGKSLESTTVTDKD-GELYCKVC 52


>gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain,
           containing two zinc fingers.  LIM domains are identified
           in a diverse group of proteins with wide variety of
           biological functions, including gene expression
           regulation, cell fate determination, cytoskeleton
           organization, tumor formation and development. LIM
           domains function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes. They perform
           their functions through interactions with other protein
           partners. LIM domains are 50-60 amino acids in size and
           share two characteristic highly conserved zinc finger
           motifs. The two zinc fingers contain eight conserved
           residues, mostly cysteines and histidines, which
           coordinately bond to two zinc atoms. The consensus
           sequence of LIM domain has been defined as
           C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,
           21)-C-x(2,3)-[CHD] (where X denotes any amino acid).
          Length = 53

 Score = 43.1 bits (102), Expect = 3e-06
 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 1/53 (1%)

Query: 98  CSLCGEKVYLAQRFAFNARLFHRTCFKCARCQSQLTCINAYETHTGQFCCEVC 150
           C+ CG+ +   +      + +H  CFKC+ C   L   + YE   G+  CE C
Sbjct: 1   CAGCGKPIEGRELLRALGKKWHPECFKCSVCGKPLGGDSFYE-KDGKPYCEKC 52


>gnl|CDD|188788 cd09404, LIM1_MLP84B_like, The LIM domain of Mlp84B and Mlp60A.
           The LIM domain of Mlp84B and Mlp60A: Mlp84B and Mlp60A
           belong to the CRP LIM domain protein family. The Mlp84B
           protein contains five copies of the LIM domains, each
           followed by a Glycin Rich Region (GRR). However, only
           the first LIM domain of Mlp84B is in this family. Mlp60A
           exhibits only one LIM domain linked to a glycin-rich
           region. Mlp84B and Mlp60A are muscle specific proteins
           and have been implicated in muscle differentiation.
           While Mlp84B transcripts are enriched at the terminal
           ends of muscle fibers, Mlp60A transcripts are found
           throughout the muscle fibers. All LIM domains are 50-60
           amino acids in size and share two characteristic zinc
           finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 54

 Score = 42.9 bits (101), Expect = 4e-06
 Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 1/53 (1%)

Query: 98  CSLCGEKVYLAQRFAFNARLFHRTCFKCARCQSQLTCINAYETHTGQFCCEVC 150
           C  CG+ VY A+        +H+ CFKC  C   L   N  E H G+  C+ C
Sbjct: 2   CPKCGKSVYAAEERLAGGYKWHKMCFKCGMCNKLLDSTNCAE-HEGELYCKQC 53


>gnl|CDD|188826 cd09442, LIM_Eplin_like, The Lim domain of Epithelial Protein Lost
           in Neoplasm (Eplin) like proteins.  The Lim domain of
           Epithelial Protein Lost in Neoplasm (Eplin) like
           proteins: This family contains Epithelial Protein Lost
           in Neoplasm in Neoplasm (Eplin), xin actin-binding
           repeat-containing protein 2 (XIRP2) and a group of
           protein with unknown function.  The members of this
           family all contain a single LIM domain. Epithelial
           Protein Lost in Neoplasm is a cytoskeleton-associated
           tumor suppressor whose expression inversely correlates
           with cell growth, motility, invasion and cancer
           mortality.  Eplin interacts and stabilizes F-actin
           filaments and stress fibers, which correlates with its
           ability to suppress anchorage independent growth. In
           epithelial cells, Eplin is required for formation of the
           F-actin adhesion belt by binding to the
           E-cadherin-catenin complex through alpha-catenin. Eplin
           is expressed in two isoforms, a longer Eplin-beta and a
           shorter Eplin-alpha. Eplin-alpha mRNA is detected in
           various tissues and cell lines, but is absent or down
           regulated in cancer cells. Xirp2 contains a LIM domain
           and Xin re peats for binding to and stabilising F-actin.
           Xirp2 is expressed in muscles and is significantly
           induced in the heart in response to systemic
           administration of angiotensin II. Xirp2 is an important
           effector of the Ang II signaling pathway in the heart.
           The expression of Xirp2 is activated by myocyte enhancer
           factor (MEF)2A, whose  transcriptional activity is
           stimulated by angiotersin II. Thus, Xirp2 plays
           important pathological roles in the angiotensin II
           induced hypertension. As in other LIM domains, this
           domain family is 50-60 amino acids in size and shares
           two characteristic zinc finger motifs. The two zinc
           fingers contain eight conserved residues, mostly
           cysteines and histidines, which coordinately bond to two
           zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein.
          Length = 53

 Score = 42.5 bits (100), Expect = 6e-06
 Identities = 17/50 (34%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 98  CSLCGEKVYLAQRFAFNARLFHRTCFKCARCQSQLTCINAYETHTGQFCC 147
           C++C ++VY  +R   + + FH++CF+C  C S+L+  N    H G+  C
Sbjct: 1   CTVCQKRVYPMERLIADKQNFHKSCFRCEHCNSKLSLGNYASLH-GRIYC 49


>gnl|CDD|188865 cd09481, LIM1_CRP3, The first LIM domain of Cysteine Rich Protein 3
           (CRP3/MLP).  The first LIM domain of Cysteine Rich
           Protein 3 (CRP3/MLP): Cysteine-rich proteins (CRPs) are
           characterized by the presence of two LIM domains linked
           to short glycine-rich repeats (GRRs). The CRP family
           members include CRP1, CRP2, CRP3/MLP and TLPCRP1, CRP2
           and CRP3 share a conserved nuclear targeting signal
           (K/R-K/R-Y-G-P-K), which supports the fact that these
           proteins function not only in the cytoplasm but also in
           the nucleus. CRPs control regulatory pathways during
           cellular differentiation, and involve in complex
           transcription circuits, and the organization as well as
           the arrangement of the myofibrillar/cytoskeletal
           network.CRP3 also called Muscle LIM Protein (MLP), which
           is a striated muscle-specific factor that enhances
           myogenic differentiation. CRP3/MLP interacts with
           cytoskeletal protein beta-spectrin. CRP3/MLP also
           interacts with the basic helix-loop-helix myogenic
           transcriptio n factors MyoD, myogenin, and MRF4 thereby
           increasing their affinity for specific DNA regulatory
           elements. LIM domains are 50-60 amino acids in size and
           share two characteristic zinc finger motifs. The two
           zinc fingers contain eight conserved residues, mostly
           cysteines and histidines, which coordinately bond to two
           zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 54

 Score = 42.0 bits (98), Expect = 8e-06
 Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 1/53 (1%)

Query: 98  CSLCGEKVYLAQRFAFNARLFHRTCFKCARCQSQLTCINAYETHTGQFCCEVC 150
           C  C + VY A+    N R FH+TCF C  C+  L        H  +  C+ C
Sbjct: 2   CGACEKTVYHAEEIQCNGRSFHKTCFICMACRKALDSTTV-AAHESEIYCKTC 53


>gnl|CDD|188871 cd09840, LIM2_CRP2, The second LIM domain of Cysteine Rich Protein
           2 (CRP2).  The second LIM domain of Cysteine Rich
           Protein 2 (CRP2):  Cysteine-rich proteins (CRPs) are
           characterized by the presence of two LIM domains linked
           to short glycine-rich repeats (GRRs). The CRP family
           members include CRP1, CRP2, CRP3/MLP and TLPCRP1, CRP2
           and CRP3 share a conserved nuclear targeting signal
           (K/R-K/R-Y-G-P-K), which supports the fact that these
           proteins function not only in the cytoplasm but also in
           the nucleus. CRPs control regulatory pathways during
           cellular differentiation, and involve in complex
           transcription circuits, and the organization as well as
           the arrangement of the myofibrillar/cytoskeletal
           network.CRP3 also called Muscle LIM Protein (MLP), which
           is a striated muscle-specific factor that enhances
           myogenic differentiation. The second LIM domain of
           CRP3/MLP interacts with cytoskeletal protein
           beta-spectrin. CRP3/MLP also interacts with the basic
           helix-loop-helix myogenic transcription factors MyoD,
           myogenin, and MRF4 thereby increasing their affinity for
           specific DNA regulatory elements. LIM domains are 50-60
           amino acids in size and share two characteristic zinc
           finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 54

 Score = 42.0 bits (98), Expect = 9e-06
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 98  CSLCGEKVYLAQRFAFNARLFHRTCFKCARCQSQLTCINAYETHTGQFCCEVC 150
           CS CG+ VY A++     + +H+ CF+CA+C   L      E   G+  C+ C
Sbjct: 1   CSRCGDSVYAAEKIMGAGKPWHKNCFRCAKCGKSLESTTLTEKE-GEIYCKGC 52


>gnl|CDD|215907 pfam00412, LIM, LIM domain.  This family represents two copies of
           the LIM structural domain.
          Length = 58

 Score = 41.9 bits (99), Expect = 1e-05
 Identities = 14/54 (25%), Positives = 26/54 (48%), Gaps = 2/54 (3%)

Query: 98  CSLCGEKVYLAQRF-AFNARLFHRTCFKCARCQSQLTCINAYETHTGQFCCEVC 150
           C+ CG+ +Y  +       +++H  CF+CA C   L   + +E   G+  C+  
Sbjct: 1   CAGCGKPIYDRELVRRALGKVWHPECFRCAVCGKPLGPGDFFE-KDGKLYCKHD 53


>gnl|CDD|188829 cd09445, LIM_Mical_like_2, This domain belongs to the LIM domain
           family which are found on Mical (molecule interacting
           with CasL) like proteins.  The LIM domain on proteins of
           unknown function: This domain belongs to the LIM domain
           family which are found on Mical (molecule interacting
           with CasL)-like proteins. Known members of the
           Mical-like family includes single LIM domain containing
           proteins, Mical (molecule interacting with CasL), pollen
           specific protein SF3, Eplin, xin actin-binding
           repeat-containing protein 2 (XIRP2), and Ltd-1. The
           members of this family function mainly at the
           cytoskeleton and focal adhesions. They interact with
           transcription factors or other signaling molecules to
           play roles in muscle development, neuronal
           differentiation, cell growth, and mobility.  As in other
           LIM domains, this domain family is 50-60 amino acids in
           size and shares two characteristic zinc finger motifs.
           The two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein.
          Length = 53

 Score = 41.3 bits (97), Expect = 1e-05
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 98  CSLCGEKVYLAQRFAFNARLFHRTCFKCARCQSQLTCINAYETHTGQFCCEV 149
           C  CG+ VY  +       ++H+ CF+C  C  QL  ++ Y++H G   C+V
Sbjct: 1   CRSCGKPVYKMEEIIAEKHIYHKNCFRCKDCNKQLK-VDNYQSHEGNLYCKV 51


>gnl|CDD|188786 cd09402, LIM1_CRP, The first LIM domain of Cysteine Rich Protein
           (CRP).  The first LIM domain of Cysteine Rich Protein
           (CRP): Cysteine-rich proteins (CRPs) are characterized
           by the presence of two LIM domains linked to a short
           glycine-rich repeats (GRRs). The CRP family members
           include CRP1, CRP2, CRP3/MLP. CRP1, CRP2 and CRP3 share
           a conserved nuclear targeting signal (K/R-K/R-Y-G-P-K),
           which supports the fact that these proteins function not
           only in the cytoplasm but also in the nucleus. CRPs
           control regulatory pathways during cellular
           differentiation, and involve in complex transcription
           control, and the organization as well as the arrangement
           of the myofibrillar/cytoskeletal network. It is evident
           that CRP1, CRP2, and CRP3/MLP are involved in promoting
           protein assembly along the actin-based cytoskeleton.
           Although members of the CRP family share common binding
           partners, they are also capable of recognizing different
           and specific targets. LIM domains are 50-60 amino acids
           in size and share two characteristic zinc finger motifs.
           The two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 53

 Score = 41.5 bits (97), Expect = 1e-05
 Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 1/53 (1%)

Query: 98  CSLCGEKVYLAQRFAFNARLFHRTCFKCARCQSQLTCINAYETHTGQFCCEVC 150
           C  C + VY A+      R FH++CF C  C+  L        H  +  C+ C
Sbjct: 1   CGACEKTVYHAEEVQCEGRSFHKSCFLCMVCRKNLDSTTV-AAHEDEIYCKSC 52


>gnl|CDD|188787 cd09403, LIM2_CRP, The second LIM domain of Cysteine Rich Protein
           (CRP).  The second LIM domain of Cysteine Rich Protein
           (CRP): Cysteine-rich proteins (CRPs) are characterized
           by the presence of two LIM domains linked to a short
           glycine-rich repeats (GRRs). The CRP family members
           include CRP1, CRP2, CRP3/MLP. CRP1, CRP2 and CRP3 share
           a conserved nuclear targeting signal (K/R-K/R-Y-G-P-K),
           which supports the fact that these proteins function not
           only in the cytoplasm but also in the nucleus. CRPs
           control regulatory pathways during cellular
           differentiation, and involve in complex transcription
           control, and the organization as well as the arrangement
           of the myofibrillar/cytoskeletal network. It is evident
           that CRP1, CRP2, and CRP3/MLP are involved in promoting
           protein assembly along the actin-based cytoskeleton.
           Although members of the CRP family share common binding
           partners, they are also capable of recognizing different
           and specific targets. LIM domains are 50-60 amino acids
           in size and share two characteristic zinc finger motifs.
           The two zinc fingers contain eight conserved residu es,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 54

 Score = 41.4 bits (97), Expect = 2e-05
 Identities = 16/53 (30%), Positives = 27/53 (50%), Gaps = 1/53 (1%)

Query: 98  CSLCGEKVYLAQRFAFNARLFHRTCFKCARCQSQLTCINAYETHTGQFCCEVC 150
           C  CG+ VY A++     + +H+ CF+CA+C   L      +   G+  C+ C
Sbjct: 1   CPRCGKSVYAAEKIIGAGKPWHKNCFRCAKCGKSLESTTLAD-KDGEIYCKGC 52


>gnl|CDD|188869 cd09485, LIM_Eplin_alpha_beta, The Lim domain of Epithelial Protein
           Lost in Neoplasm (Eplin).  The Lim domain of Epithelial
           Protein Lost in Neoplasm (Eplin): Epithelial Protein
           Lost in Neoplasm is a cytoskeleton-associated tumor
           suppressor whose expression inversely correlates with
           cell growth, motility, invasion and cancer mortality.
           Eplin interacts and stabilizes F-actin filaments and
           stress fibers, which correlates with its ability to
           suppress anchorage independent growth. In epithelial
           cells, Eplin is required for formation of the F-actin
           adhesion belt by binding to the E-cadherin-catenin
           complex through alpha-catenin. Eplin is expressed in two
           isoforms, a longer Eplin-beta and a shorter Eplin-alpha.
           Eplin-alpha mRNA is detected in various tissues and cell
           lines, but is absent or down regulated in cancer cells.
           As in other LIM domains, this domain family is 50-60
           amino acids in size and shares two characteristic zinc
           finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein.
          Length = 53

 Score = 40.6 bits (95), Expect = 2e-05
 Identities = 14/49 (28%), Positives = 26/49 (53%)

Query: 98  CSLCGEKVYLAQRFAFNARLFHRTCFKCARCQSQLTCINAYETHTGQFC 146
           C  C + VY  +R   N +++H +CF+C+ C ++L+       H   +C
Sbjct: 1   CVSCQKTVYPLERLVANQQIYHNSCFRCSYCNTKLSLGTYASLHGNIYC 49


>gnl|CDD|188863 cd09479, LIM1_CRP1, The first LIM domain of Cysteine Rich Protein 1
           (CRP1).  The first LIM domain of Cysteine Rich Protein 1
           (CRP1): Cysteine-rich proteins (CRPs) are characterized
           by the presence of two LIM domains linked to a short
           glycine-rich repeats (GRRs). The CRP family members
           include CRP1, CRP2, CRP3/MLP and TLP. CRP1, CRP2 and
           CRP3 share a conserved nuclear targeting signal
           (K/R-K/R-Y-G-P-K), which supports the fact that these
           proteins function not only in the cytoplasm but also in
           the nucleus. CRPs control regulatory pathways during
           cellular differentiation, and involve in complex
           transcription circuits, and the organization as well as
           the arrangement of the myofibrillar/cytoskeletal
           network. CRP1 can associate with the actin cytoskeleton
           and are capable of interacting with alpha-actinin and
           zyxin. CRP1 was shown to regulate actin filament
           bundling by interaction with alpha-actinin and direct
           binding to actin filaments. LIM domains are 50-60 amino
           acids in size and share two characteristic zinc finger
           motifs. The two zinc fingers contain eight conserved
           residues, mostly cysteines and histidines, which
           coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 56

 Score = 39.2 bits (91), Expect = 9e-05
 Identities = 16/55 (29%), Positives = 24/55 (43%), Gaps = 1/55 (1%)

Query: 96  NSCSLCGEKVYLAQRFAFNARLFHRTCFKCARCQSQLTCINAYETHTGQFCCEVC 150
             C +C + VY A+      R FH++CF C  C+  L        H  +  C+ C
Sbjct: 1   KKCGVCQKTVYFAEEVQCEGRSFHKSCFLCMVCKKNLDSTTV-AVHGEEIYCKSC 54


>gnl|CDD|188861 cd09477, LIM2_TLP, The second LIM domain of thymus LIM protein
           (TLP).  The second LIM domain of thymus LIM protein
           (TLP):  TLP is the distant member of the CRP family of
           proteins. TLP has two isomers (TLP-A and TLP-B) and
           sharing approximately 30% with each of the three other
           CRPs.  Like CRP1, CRP2 and CRP3/MLP, TLP has two LIM
           domains, connected by a flexible linker region. Unlike
           the CRPs, TLP lacks the nuclear targeting signal
           (K/R-K/R-Y-G-P-K) and is localized solely in the
           cytoplasm. TLP is specifically expressed in the thymus
           in a subset of cortical epithelial cells. TLP has a role
           in development of normal thymus and in controlling the
           development and differentiation of thymic epithelial
           cells. LIM domains are 50-60 amino acids in size and
           share two characteristic zinc finger motifs. The two
           zinc fingers contain eight conserved residues, mostly
           cysteines and histidines, which coordinately bond to two
           zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 54

 Score = 38.8 bits (90), Expect = 1e-04
 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 1/52 (1%)

Query: 98  CSLCGEKVYLAQRFAFNARLFHRTCFKCARCQSQLTCINAYETHTGQFCCEV 149
           C  CG+ VY A++     R +HR C +C RC+  LT    +  H G   C V
Sbjct: 1   CPGCGKPVYFAEKVMSLGRNWHRPCLRCQRCKKTLTA-GGHAEHDGSPYCHV 51


>gnl|CDD|188870 cd09486, LIM_Eplin_like_1, a LIM domain subfamily on a group of
           proteins with unknown function.  This model represents a
           LIM domain subfamily of Eplin-like family.  This family
           shows highest homology to the LIM domains on Eplin and
           XIRP2 protein families. Epithelial Protein Lost in
           Neoplasm is a cytoskeleton-associated tumor suppressor
           whose expression inversely correlates with cell growth,
           motility, invasion and cancer mortality. Xirp2 is
           expressed in muscles and is an important effector of the
           Ang II signaling pathway in the heart. As in other LIM
           domains, this domain family is 50-60 amino acids in size
           and shares two characteristic zinc finger motifs. The
           two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein.
          Length = 53

 Score = 38.8 bits (90), Expect = 1e-04
 Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 98  CSLCGEKVYLAQRFAFNARLFHRTCFKCARCQSQLTCINAYETHTGQFCCE 148
           CS C + VY  +R   +  +FH +CF C  C ++L+ + +Y    G+F C+
Sbjct: 1   CSSCQKTVYPMERLVADKLVFHNSCFCCKHCNAKLS-LGSYAALHGEFYCK 50


>gnl|CDD|188824 cd09440, LIM1_SF3, The first Lim domain of pollen specific protein
           SF3.  The first Lim domain of pollen specific protein
           SF3: SF3 is a Lim protein that is found exclusively in
           mature plant pollen grains. It contains two LIM domains.
           The exact function of SF3 is unknown. It may be a
           transcription factor required for the expression of late
           pollen genes. It is possible that SF3 protein is
           involved in controlling pollen-specific processes such
           as male gamete maturation, pollen tube formation, or
           even fertilization. As in other LIM domains, this domain
           family is 50-60 amino acids in size and shares two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein.
          Length = 63

 Score = 39.0 bits (91), Expect = 1e-04
 Identities = 11/35 (31%), Positives = 22/35 (62%)

Query: 98  CSLCGEKVYLAQRFAFNARLFHRTCFKCARCQSQL 132
           C  C + VYL  + + +  ++H++CF+C+ C+  L
Sbjct: 5   CKACDKTVYLVDQLSADGVVYHKSCFRCSHCKGTL 39


>gnl|CDD|188712 cd09326, LIM_CRP_like, The LIM domains of Cysteine Rich Protein
           (CRP) family.  The LIM domains of Cysteine Rich Protein
           (CRP) family: Cysteine-rich proteins (CRPs) are
           characterized by the presence of two LIM domains linked
           to a short glycine-rich repeats (GRRs). The known CRP
           family members include CRP1, CRP2, and CRP3/MLP. CRP1,
           CRP2 and CRP3 share a conserved nuclear targeting signal
           (K/R-K/R-Y-G-P-K), which supports the fact that these
           proteins function not only in the cytoplasm but also in
           the nucleus. CRPs control regulatory pathways during
           cellular differentiation, and involve in complex
           transcription control, and the organization as well as
           the arrangement of the myofibrillar/cytoskeletal
           network. CRP1, CRP2, and CRP3/MLP are involved in
           promoting protein assembly along the actin-based
           cytoskeleton. All LIM domains are 50-60 amino acids in
           size and share two characteristic zinc finger motifs.
           The two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 53

 Score = 38.7 bits (91), Expect = 1e-04
 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 1/53 (1%)

Query: 98  CSLCGEKVYLAQRFAFNARLFHRTCFKCARCQSQLTCINAYETHTGQFCCEVC 150
           C  CG+ VY A+      + +H++CF CA C  +L      E H G+  C+ C
Sbjct: 1   CPRCGKSVYAAEEVIAAGKSWHKSCFTCAVCNKRLDSTTLAE-HDGEIYCKSC 52


>gnl|CDD|188735 cd09349, LIM1_Zyxin, The first LIM domain of Zyxin.  The first LIM
           domain of Zyxin: Zyxin exhibits three copies of the LIM
           domain, an extensive proline-rich domain and a nuclear
           export signal.  Localized at sites of cell substratum
           adhesion in fibroblasts, Zyxin interacts with
           alpha-actinin, members of the cysteine-rich protein
           (CRP) family, proteins that display Src homology 3 (SH3)
           domains and Ena/VASP family members. Zyxin and its
           partners have been implicated in the spatial control of
           actin filament assembly as well as in pathways important
           for cell differentiation. In addition to its functions
           at focal adhesion plaques, recent work has shown that
           zyxin moves from the sites of cell contacts to the
           nucleus, where it directly participates in the
           regulation of gene expression. As in other LIM domains,
           this domain family is 50-60 amino acids in size and
           shares two characteristic zinc finger motifs. The two
           zinc fingers contain eight conserved residues, mostly
           cysteines and histidines, which coordinately bond to two
           zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein.
          Length = 87

 Score = 38.7 bits (90), Expect = 2e-04
 Identities = 23/69 (33%), Positives = 32/69 (46%), Gaps = 6/69 (8%)

Query: 84  QPPSTLPGSLKLNSCSLCGEKVYLAQRFAFNA--RLFHRTCFKCARCQSQLTCINAYETH 141
            PP+    + +L  C +CG+ +   Q  A  A   LFH TCF C +C+ QL     Y   
Sbjct: 22  HPPAAEAATNEL--CGICGQPLSRTQP-AVRALGHLFHVTCFTCHQCEQQLQGQQFYSLE 78

Query: 142 TGQFCCEVC 150
              + CE C
Sbjct: 79  GKPY-CEEC 86


>gnl|CDD|188780 cd09394, LIM1_Rga, The first LIM domain of  Rga GTPase-Activating
           Proteins.  The first LIM domain of  Rga
           GTPase-Activating Proteins: The members of this family
           contain two tandem repeats of LIM domains and a Rho-type
           GTPase activating protein (RhoGap) domain. Rga activates
           GTPases during polarized morphogenesis. In yeast, a
           known regulating target of Rga is  CDC42p, a small
           GTPase. The LIM domain is 50-60 amino acids in size and
           shares two characteristic zinc finger motifs. The two
           zinc fingers contain eight conserved residues, mostly
           cysteines and histidines, which coordinately bond to two
           zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein.
          Length = 55

 Score = 37.7 bits (88), Expect = 3e-04
 Identities = 11/37 (29%), Positives = 17/37 (45%)

Query: 98  CSLCGEKVYLAQRFAFNARLFHRTCFKCARCQSQLTC 134
           C  C E +     +      +H  CFKC +C  +L+C
Sbjct: 1   CVGCKESITEGHAYELGGDRWHIHCFKCYKCDKKLSC 37


>gnl|CDD|188862 cd09478, LIM_CRIP, The LIM domain of Cysteine-Rich Intestinal
           Protein (CRIP).  The LIM domain of Cysteine-Rich
           Intestinal Protein (CRIP): CRIP is a short protein with
           only one LIM domain. CRIP gene is developmentally
           regulated and can be induced by glucocorticoid hormones
           during the first three postnatal weeks. The domain shows
           close sequence homology to LIM domain of thymus LIM
           protein. However, unlike the TLP proteins which have two
           LIM domains, the members of this family have only one
           LIM domain. LIM domains are 50-60 amino acids in size
           and share two characteristic zinc finger motifs. The two
           zinc fingers contain eight conserved residues, mostly
           cysteines and histidines, which coordinately bond to two
           zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 54

 Score = 37.2 bits (86), Expect = 4e-04
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 98  CSLCGEKVYLAQRFAFNARLFHRTCFKCARCQSQLTCINAYETHTGQFCC 147
           C  C ++VY A+R     + +HR C KC +C   LT   ++  H G+  C
Sbjct: 1   CPKCDKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTP-GSHAEHDGKPYC 49


>gnl|CDD|188827 cd09443, LIM_Ltd-1, The LIM domain of LIM and transglutaminase
           domains protein (Ltd-1).  The LIM domain of LIM and
           transglutaminase domains protein (Ltd-1): This family
           includes mouse Ky protein and Caenorhabditis elegans
           Ltd-1 protein. The members of this family consists a
           N-terminal  Lim domain and a C-terminal transglutaminase
           domain. The mouse Ky protein has  putative function in
           muscle development. The mouse with ky mutant exhibits
           combined posterior and lateral curvature of the spine.
           The Ltd-1 gene in C. elegans is expressed in developing
           hypodermal cells from the twofold stage embryo through
           adulthood. These data define the ltd-1 gene as a novel
           marker for C. elegans epithelial cell development. As in
           other LIM domains, this domain family is 50-60 amino
           acids in size and shares two characteristic zinc finger
           motifs. The two zinc fingers contain eight conserved
           residues, mostly cysteines and histidines, which
           coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein.
          Length = 55

 Score = 37.4 bits (87), Expect = 4e-04
 Identities = 12/36 (33%), Positives = 20/36 (55%)

Query: 98  CSLCGEKVYLAQRFAFNARLFHRTCFKCARCQSQLT 133
           C  CG+  Y A+    +   +H+ CFKC  C ++L+
Sbjct: 1   CPRCGKTAYPAESVDKDGTFYHKGCFKCRECGTRLS 36


>gnl|CDD|188825 cd09441, LIM2_SF3, The second Lim domain of pollen specific protein
           SF3.  The second Lim domain of pollen specific protein
           SF3: SF3 is a Lim protein that is found exclusively in
           mature plant pollen grains. It contains two LIM domains.
           The exact function of SF3 is unknown. It may be a
           transcription factor required for the expression of late
           pollen genes. It is possible that SF3 protein is
           involved in controlling pollen-specific processes such
           as male gamete maturation, pollen tube formation, or
           even fertilization. As in other LIM domains, this domain
           family is 50-60 amino acids in size and shares two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein.
          Length = 61

 Score = 37.1 bits (86), Expect = 5e-04
 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 1/50 (2%)

Query: 98  CSLCGEKVYLAQRFAFNARLFHRTCFKCARCQSQLTCINAYETHTGQFCC 147
           C  CG+ VY  ++       +H++CFKC+     ++  N Y  H G+  C
Sbjct: 1   CVACGKTVYPIEKVTVEGTSYHKSCFKCSHGGCTISPSN-YAAHEGRLYC 49


>gnl|CDD|188864 cd09480, LIM1_CRP2, The first LIM domain of Cysteine Rich Protein 2
           (CRP2).  The first LIM domain of Cysteine Rich Protein 2
           (CRP2): The CRP family members include CRP1, CRP2,
           CRP3/MLP and TLP. CRP1, CRP2 and CRP3 share a conserved
           nuclear targeting signal (K/R-K/R-Y-G-P-K), which
           supports the fact that these proteins function not only
           in the cytoplasm but also in the nucleus. CRPs control
           regulatory pathways during cellular differentiation, and
           involve in complex transcription circuits, and the
           organization as well as the arrangement of the
           myofibrillar/cytoskeletal network. CRP2 specifically
           binds to protein inhibitor of activated STAT-1 (PIAS1)
           and a novel human protein designed CRP2BP (for CRP2
           binding partner). PIAS1 specifically inhibits the STAT-1
           pathway and CRP2BP is homologous to members of the
           histone acetyltransferase family raising the possibility
           that CRP2 is a modulator of cytokine-controlled pathways
           or is functionally active in the transcriptional
           regulatory network. LIM domains are 50-60 amino acids in
           size and share two characteristic zinc finger motifs.
           The two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 55

 Score = 35.3 bits (81), Expect = 0.002
 Identities = 17/53 (32%), Positives = 23/53 (43%), Gaps = 1/53 (1%)

Query: 98  CSLCGEKVYLAQRFAFNARLFHRTCFKCARCQSQLTCINAYETHTGQFCCEVC 150
           C  CG  VY A+    + R FH+ CF C  C+  L        H  +  C+ C
Sbjct: 2   CGACGRTVYHAEEVQCDGRSFHKCCFLCMVCRKNLDS-TTVAIHDQEIYCKSC 53


>gnl|CDD|188860 cd09476, LIM1_TLP, The first LIM domain of thymus LIM protein
           (TLP).  The first LIM domain of thymus LIM protein
           (TLP):  TLP is the distant member of the CRP family of
           proteins. TLP has two isomers (TLP-A and TLP-B) and
           sharing approximately 30% with each of the three other
           CRPs.  Like CRP1, CRP2 and CRP3/MLP, TLP has two LIM
           domains, connected by a flexible linker region. Unlike
           the CRPs, TLP lacks the nuclear targeting signal
           (K/R-K/R-Y-G-P-K) and is localized solely in the
           cytoplasm. TLP is specifically expressed in the thymus
           in a subset of cortical epithelial cells.  TLP has a
           role in development of normal thymus and in controlling
           the development and differentiation of thymic epithelial
           cells. LIM domains are 50-60 amino acids in size and
           share two characteristic zinc finger motifs. The two
           zinc fingers contain eight conserved residues, mostly
           cysteines and histidines, which coordinately bond to two
           zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 54

 Score = 34.9 bits (80), Expect = 0.003
 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 98  CSLCGEKVYLAQRFAFNARLFHRTCFKCARCQSQLTCINAYETHTGQ-FCCEVC 150
           C  C + VY A++ +   + +HR C KC RC   L+    +  H G+ +C + C
Sbjct: 1   CPRCDKTVYFAEKVSSLGKNWHRFCLKCERCSKILSP-GGHAEHDGKPYCHKPC 53


>gnl|CDD|188830 cd09446, LIM_N_RAP, The LIM domain of N-RAP.  The LIM domain of
           N-RAP:  N-RAP is a muscle-specific protein concentrated
           at myotendinous junctions in skeletal muscle and
           intercalated disks in cardiac muscle. LIM domain is
           found at the N-terminus of N-RAP and the C-terminal of
           N-RAP contains a region with multiple of nebulin
           repeats. N-RAP functions as a scaffolding protein that
           organizes alpha-actinin and actin into symmetrical I-Z-I
           structures in developing myofibrils. Nebulin repeat is
           known as actin binding domain. The N-RAP is hypothesized
           to form antiparallel dimerization via its LIM domain. As
           in other LIM domains, this domain family is 50-60 amino
           acids in size and shares two characteristic zinc finger
           motifs. The two zinc fingers contain eight conserved
           residues, mostly cysteines and histidines, which
           coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein.
          Length = 53

 Score = 34.5 bits (79), Expect = 0.004
 Identities = 16/52 (30%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 98  CSLCGEKVYLAQRFAFNARLFHRTCFKCARCQSQLTCINAYETHTGQFCCEV 149
           C+ CG  VY A++     + +H+ CF C  C+  LT +N + +H  +  C+ 
Sbjct: 1   CARCGYGVYPAEKINCIDQTWHKACFHCEVCKMMLT-VNNFVSHQKKPYCQA 51


>gnl|CDD|188847 cd09463, LIM1_LIMK2, The first LIM domain of LIMK2 (LIM domain
           Kinase 2).  The first LIM domain of LIMK2 (LIM domain
           Kinase 2): LIMK2 is a member of the LIMK protein family,
           which comprises LIMK1 and LIMK2. LIMK contains two LIM
           domains, a PDZ domain, and a kinase domain. LIMK is
           involved in the regulation of actin polymerization and
           microtubule disassembly. LIMK influences architecture of
           the actin cytoskeleton by regulating the activity of the
           cofilin family proteins cofilin1, cofilin2, and destrin.
           The mechanism of the activation is to phosphorylates
           cofilin on serine 3 and inactivates its actin-severing
           activity, altering the rate of actin depolymerization.
           LIMK activity is activated by phosphorylation of a
           threonine residue within the activation loop of the
           kinase by p21-activated kinases 1 and 4 and by Rho
           kinase. LIMKs can function in both cytoplasm and
           nucleus. Both LIMK1 and LIMK2 can act in the nucleus to
           suppress Rac/Cdc42-dependent cyclin D1 expression. LIMK2
           is expressed in all tissues. While LIMK1 localizes
           mainly at focal adhesions, LIMK2 is found in cytoplasmic
           punctae, suggesting that they may have different
           cellular functions. The activity of LIM kinase 2 to
           regulate cofilin phosphorylation is inhibited by the
           direct binding of Par-3. LIMK2 activation promotes cell
           cycle progression. The phenotype of Limk2 knockout mice
           shows a defect in spermatogenesis. The LIM domains have
           been shown to play an important role in regulating
           kinase activity and likely also contribute to LIMK
           function by acting as sites of protein-to-protein
           interactions. All LIM domains are 50-60 amino acids in
           size and share two characteristic zinc finger motifs.
           The two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 53

 Score = 33.7 bits (77), Expect = 0.008
 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 98  CSLCGEKVYLAQRFAFNARLFHRTCFKCARCQSQLTCINAYETHTGQFCC 147
           C+ CG ++  +  +      +H +CF+C+ CQ  LT  N Y    G+  C
Sbjct: 1   CTGCGGRIQDSFHYRVVQEAWHNSCFQCSVCQDLLT--NWYYEKDGKLYC 48


>gnl|CDD|188745 cd09359, LIM_LASP_like, The LIM domain of LIM and SH3 Protein
           (LASP)-like proteins.  The LIM domain of LIM and SH3
           Protein (LASP) like proteins:  This family contains two
           types of LIM containing proteins; LASP and N-RAP. LASP
           family contains two highly homologous members, LASP-1
           and LASP-2. LASP contains a LIM motif at its amino
           terminus, a src homology 3 (SH3) domains at its
           C-terminal part, and a nebulin-like region in the
           middle. LASP-1 and -2 are highly conserved in their LIM,
           nebulin-like, and SH3 domains, but differ significantly
           at their linker regions. Both proteins are ubiquitously
           expressed and involved in cytoskeletal architecture,
           especially in the organization of focal adhesions.
           LASP-1 and LASP-2, are important during early embryo-
           and fetogenesis and are highly expressed in the central
           nervous system of the adult. However, only LASP-1 seems
           to participate significantly in neuronal differentiation
           and plays an important functional role in migration and
           proliferation of certain cancer cells while the role of
           LASP-2 is more structural. The expression of LASP-1 in
           breast tumors is increased significantly.  N-RAP is a
           muscle-specific protein concentrated at myotendinous
           junctions in skeletal muscle and intercalated disks in
           cardiac muscle. LIM domain is found at the N-terminus of
           N-RAP and the C-terminal of N-RAP contains a region with
           multiple of nebulin repeats. N-RAP functions as a
           scaffolding protein that organizes alpha-actinin and
           actin into symmetrical I-Z-I structures in developing
           myofibrils. Nebulin repeat is known as actin binding
           domain. The N-RAP is hypothesized to form antiparallel
           dimerization via its LIM domain. As in other LIM
           domains, this domain family is 50-60 amino acids in size
           and shares two characteristic zinc finger motifs. The
           two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein.
          Length = 53

 Score = 32.6 bits (74), Expect = 0.019
 Identities = 14/50 (28%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 98  CSLCGEKVYLAQRFAFNARLFHRTCFKCARCQSQLTCINAYETHTGQFCC 147
           C+ CG+ VY  ++     + +H+ CF C  C+  L  +N Y+ +  +  C
Sbjct: 1   CARCGKIVYPTEKVNCLDKTWHKACFHCEVCKMTLN-MNNYKGYQKKPYC 49


>gnl|CDD|188738 cd09352, LIM1_Ajuba_like, The first LIM domain of Ajuba-like
           proteins.  The first LIM domain of Ajuba-like proteins:
           Ajuba like LIM protein family includes three highly
           homologous proteins Ajuba, Limd1, and WTIP. Members of
           the family contain three tandem C-terminal LIM domains
           and a proline-rich N-terminal region. This family of
           proteins functions as scaffolds, participating in the
           assembly of numerous protein complexes. In the
           cytoplasm, Ajuba binds Grb2 to modulate serum-stimulated
           ERK activation. Ajuba also recruits the TNF
           receptor-associated factor 6 (TRAF6) to p62 and
           activates PKCKappa activity. Ajuba interacts with
           alpha-catenin and F-actin to contribute to the formation
           or stabilization of adheren junctions by linking
           adhesive receptors to the actin cytoskeleton. Although
           Ajuba is a cytoplasmic protein, it can shuttle into the
           nucleus. In nucleus, Ajuba functions as a corepressor
           for the zinc finger-protein Snail. It binds to the SNAG
           repression domain of Snail through its LIM region.
           Arginine methyltransferase-5 (Prmt5), a protein in the
           complex, is recruited to Snai l through an interaction
           with Ajuba. This ternary complex functions to repress
           E-cadherin, a Snail target gene. In addition, Ajuba
           contains functional nuclear-receptor interacting motifs
           and selectively interacts with retinoic acid receptors
           (RARs) and rexinoid receptor (RXRs) to negatively
           regulate retinoic acid signaling. Wtip, the
           Wt1-interacting protein, was originally identified as an
           interaction partner of the Wilms tumour protein 1 (WT1).
           Wtip is involved in kidney and neural crest development.
           Wtip interacts with the receptor tyrosine kinase Ror2
           and inhibits canonical Wnt signaling. LIMD1 was reported
           to inhibit cell growth and metastases. The inhibition
           may be mediated through an interaction with the protein
           barrier-to-autointegration (BAF), a component of SWI/SNF
           chromatin-remodeling protein; or through the interaction
           with retinoblastoma protein (pRB), resulting in
           inhibition of E2F-mediated transcription, and expression
           of the majority of genes with E2F1- responsive elements.
           Recently, Limd1 was shown to interact with the
           p62/sequestosome protein and influence IL-1 and RANKL
           signaling by facilitating the assembly of a
           p62/TRAF6/a-PKC multi-protein complex. The Limd1-p62
           interaction affects both NF-kappaB and AP-1 activity in
           epithelial cells and osteoclasts. Moreover, LIMD1
           functions as tumor repressor to block lung tumor cell
           line in vitro and in vivo. Recent studies revealed that
           LIM proteins Wtip, LIMD1 and Ajuba interact with
           components of RNA induced silencing complexes (RISC) as
           well as eIF4E and the mRNA m7GTP cap-protein complex and
           are required for microRNA-mediated gene silencing.  As
           in other LIM domains, this domain family is 50-60 amino
           acids in size and shares two characteristic zinc finger
           motifs. The two zinc fingers contain eight conserved
           residues, mostly cysteines and histidines, which
           coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein.
          Length = 54

 Score = 32.4 bits (74), Expect = 0.023
 Identities = 18/53 (33%), Positives = 23/53 (43%), Gaps = 3/53 (5%)

Query: 98  CSLCGEKVYLAQRFAFNA--RLFHRTCFKCARCQSQLTCINAYETHTGQFCCE 148
           C  CG+ VY A + A  A   L+H  CF C  C   L     Y  +   +C E
Sbjct: 1   CVKCGKGVYGASQ-ACQAMGNLYHTNCFTCCSCGRTLRGKAFYNVNGKVYCEE 52


>gnl|CDD|188772 cd09386, LIM1_LMO4, The first LIM domain of LMO4 (LIM domain only
           protein 4).  The first LIM domain of LMO4 (LIM domain
           only protein 4): LMO4 is a nuclear protein that plays
           important roles in transcriptional regulation and
           development. LMO4 is involved in various functions in
           tumorigenesis and cellular differentiation. LMO4
           proteins regulate gene expression by interacting with a
           wide variety of transcription factors and cofactors to
           form large transcription complexes. It can interact with
           Smad proteins, and associate with the promoter of the
           PAI-1 (plasminogen activator inhibitor-1) gene in a
           TGFbeta (transforming growth factor beta)-dependent
           manner. LMO4 can also form a complex with transcription
           regulator CREB (cAMP response element-binding protein)
           and interact with CLIM1 and CLIM2. In breast tissue,
           LMO4 interacts with multiple proteins, including the
           cofactor CtIP [CtBP (C-terminal binding
           protein)-interacting protein], the breast and ovarian
           tumor suppressor BRCA1 (breast-cancer susceptibility
           gene 1) and the LIM-domain-binding protein LDB1.
           Functionally, LMO4 is shown to repress BRCA1-mediated
           transcription activation, thus invoking a potential role
           for LMO4 as a negative regulator of BRCA1 in sporadic
           breast cancer.  LMO4 also forms complex to both ERa
           (oestrogen receptor alpha), MTA1 (metastasis tumor
           antigen 1), and HDACs (histone deacetylases), implying
           that LMO4 is also a component of the MTA1 corepressor
           complex. Over-expressed LMO4 represses ERa
           transactivation functions in an HDAC-dependent manner,
           and contributes to the process of breast cancer
           progression by allowing the development of Era-negative
           phenotypes. All LIM domains are 50-60 amino acids in
           size and share two characteristic zinc finger motifs.
           The two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 55

 Score = 32.0 bits (73), Expect = 0.030
 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 4/37 (10%)

Query: 98  CSLCGEKVYLAQRFAFNA--RLFHRTCFKCARCQSQL 132
           C+ CG K+    RF  +A  R +H  C KC+ CQ+QL
Sbjct: 1   CAGCGGKI--VDRFLLHALDRYWHNGCLKCSCCQAQL 35


>gnl|CDD|188729 cd09343, LIM1_FHL, The first LIM domain of Four and a half LIM
           domains protein (FHL).  The first LIM domain of Four and
           a half LIM domains protein (FHL): LIM-only protein
           family consists of five members, designated FHL1, FHL2,
           FHL3, FHL5 and LIMPETin. The first four members are
           composed of four complete LIM domains arranged in tandem
           and  an N-terminal single zinc finger domain with a
           consensus sequence equivalent to the C-terminal half of
           a LIM domain. LIMPETin is an exception, containing six
           LIM domains. FHL1, 2 and 3 are predominantly expressed
           in muscle tissues, and FHL5 is highly expressed in male
           germ cells.  FHL proteins exert their roles as
           transcription co-activators or co-repressors through a
           wide array of interaction partners. For example, FHL1
           binds to Myosin-binding protein C, regulating myosin
           filament formation and sarcomere assembly. FHL2 has
           shown to interact with more than 50 different proteins,
           including receptors, structural proteins, transcription
           factors and cofactors, signal transducers, splicing
           factors, DNA replication and repair enzymes, and
           metabolic enzymes. FHL3 int eracts with many
           transcription factors, such as CREB, BKLF/KLF3, CtBP2,
           MyoD, and MZF_1. FHL5 is a tissue-specific coactivator
           of CREB/CREM family transcription factors. LIM domains
           are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 59

 Score = 32.0 bits (73), Expect = 0.033
 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 96  NSCSLCGEKVYLAQR-FAFNARLFHRTCFKCARCQSQL 132
           N+C  C +K+    +  ++  R +H  CFKC +CQ  L
Sbjct: 3   NTCEECKKKIGCDSKDLSYKDRHWHEGCFKCFKCQRSL 40


>gnl|CDD|188781 cd09395, LIM2_Rga, The second LIM domain of  Rga GTPase-Activating
           Proteins.  The second LIM domain of  Rga
           GTPase-Activating Proteins: The members of this family
           contain two tandem repeats of LIM domains and a Rho-type
           GTPase activating protein (RhoGap) domain. Rga activates
           GTPases during polarized morphogenesis. In yeast, a
           known regulating target of Rga is CDC42p, a small
           GTPase. The LIM domain is 50-60 amino acids in size and
           shares two characteristic zinc finger motifs. The two
           zinc fingers contain eight conserved residues, mostly
           cysteines and histidines, which coordinately bond to two
           zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein.
          Length = 53

 Score = 31.7 bits (72), Expect = 0.036
 Identities = 14/49 (28%), Positives = 22/49 (44%)

Query: 98  CSLCGEKVYLAQRFAFNARLFHRTCFKCARCQSQLTCINAYETHTGQFC 146
           C  CG+K+        +   +   CF+C RC   +T +   +T  G FC
Sbjct: 1   CKNCGKKIDDTAILLSSDEAYCSDCFRCRRCSRDITDLKYAKTKRGLFC 49


>gnl|CDD|188773 cd09387, LIM2_LMO4, The second LIM domain of LMO4 (LIM domain only
           protein 4).  The second LIM domain of LMO4 (LIM domain
           only protein 4): LMO4 is a nuclear protein that plays
           important roles in transcriptional regulation and
           development. LMO4 is involved in various functions in
           tumorigenesis and cellular differentiation. LMO4
           proteins regulate gene expression by interacting with a
           wide variety of transcription factors and cofactors to
           form large transcription complexes. It can interact with
           Smad proteins, and associate with the promoter of the
           PAI-1 (plasminogen activator inhibitor-1) gene in a
           TGFbeta (transforming growth factor beta)-dependent
           manner. LMO4 can also form a complex with transcription
           regulator CREB (cAMP response element-binding protein)
           and interact with CLIM1 and CLIM2. In breast tissue,
           LMO4 interacts with multiple proteins, including the
           cofactor CtIP [CtBP (C-terminal binding
           protein)-interacting protein], the breast and ovarian
           tumor suppressor BRCA1 (breast-cancer susceptibility
           gene 1) and the LIM-domain-binding protein LDB1.
           Functionally, LMO4 is shown to repress BRCA1-mediated
           transcription activation, thus invoking a potential role
           for LMO4 as a negative regulator of BRCA1 in sporadic
           breast cancer.  LMO4 also forms complex to both ERa
           (oestrogen receptor alpha), MTA1 (metastasis tumor
           antigen 1), and HDACs (histone deacetylases), implying
           that LMO4 is also a component of the MTA1 corepressor
           complex. Over-expressed LMO4 represses ERa
           transactivation functions in an HDAC-dependent manner,
           and contributes to the process of breast cancer
           progression by allowing the development of Era-negative
           phenotypes. All LIM domains are 50-60 amino acids in
           size and share two characteristic zinc finger motifs.
           The two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 55

 Score = 31.7 bits (72), Expect = 0.037
 Identities = 18/57 (31%), Positives = 24/57 (42%), Gaps = 11/57 (19%)

Query: 98  CSLCG------EKVYLAQRFAFNARLFHRTCFKCARCQSQLTCINAYETHTGQFCCE 148
           CS CG      E V  AQ       ++H  CF C+ C +QL   + +    G   CE
Sbjct: 1   CSACGQSIPASELVMRAQ-----GNVYHLKCFTCSTCHNQLVPGDRFHYVNGSLFCE 52


>gnl|CDD|188750 cd09364, LIM1_LIMK, The first LIM domain of LIMK (LIM domain Kinase
           ).  The first LIM domain of LIMK (LIM domain Kinase ):
           LIMK protein family is  comprised of two members LIMK1
           and LIMK2. LIMK contains two LIM domains, a PDZ domain
           and a kinase domain. LIMK is involved in the regulation
           of actin polymerization and microtubule disassembly.
           LIMK influences architecture of the actin cytoskeleton
           by regulating the activity of the cofilin family
           proteins cofilin1, cofilin2, and destrin. The mechanism
           of the activation is to phosphorylates cofilin on serine
           3 and inactivates its actin-severing activity, and
           altering the rate of actin depolymerisation. LIMKs can
           function in both cytoplasm and nucleus and are expressed
           in all tissues. Both LIMK1 and LIMK2 can act in the
           nucleus to suppress Rac/Cdc42-dependent cyclin D1
           expression. However, LIMK1 and LIMk2 have different
           cellular locations. While LIMK1 localizes mainly at
           focal adhesions, LIMK2 is found in cytoplasmic punctae,
           suggesting that they may have different cellular
           functions. The LIM domains of LIMK have been shown to
           play an important role in regulating kinase activity and
           likely also contribute to LIMK function by acting as
           sites of protein-to-protein interactions. All LIM
           domains are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 53

 Score = 31.7 bits (72), Expect = 0.039
 Identities = 14/50 (28%), Positives = 23/50 (46%), Gaps = 2/50 (4%)

Query: 98  CSLCGEKVYLAQRFAFNARLFHRTCFKCARCQSQLTCINAYETHTGQFCC 147
           C+ C  K+  +Q      + +H  CF+C+ C   L+  N Y    G+  C
Sbjct: 1   CAGCRGKILDSQYVQALNQDWHCDCFRCSVCSDSLS--NWYFEKDGKLYC 48


>gnl|CDD|188846 cd09462, LIM1_LIMK1, The first LIM domain of LIMK1 (LIM domain
           Kinase 1).  The first LIM domain of LIMK1 (LIM domain
           Kinase 1): LIMK1 belongs to the LIMK protein family,
           which comprises LIMK1 and LIMK2. LIMK contains two LIM
           domains, a PDZ domain, and a kinase domain. LIMK is
           involved in the regulation of actin polymerization and
           microtubule disassembly. LIMK influences architecture of
           the actin cytoskeleton by regulating the activity of the
           cofilin family proteins cofilin1, cofilin2, and destrin.
           The mechanism of the activation is to phosphorylates
           cofilin on serine 3 and inactivates its actin-severing
           activity, and altering the rate of actin
           depolymerization. LIMKs can function in both cytoplasm
           and nucleus. Both LIMK1 and LIMK2 can act in the nucleus
           to suppress Rac/Cdc42-dependent cyclin D1 expression.
           LIMK1 is expressed in all tissues and is localized to
           focal adhesions in the cell. LIMK1 can form homodimers
           upon binding of HSP90 and is activated by Rho effector
           Rho kinase and MAPKAPK2. LIMK1 is important for normal
           central nervous system development, and its deletion has
           been implicated in the development of the human genetic
           disorder Williams syndrome. Moreover, LIMK1 up-regulates
           the promoter activity of urokinase type plasminogen
           activator and induces its mRNA and protein expression in
           breast cancer cells. The LIM domains have been shown to
           play an important role in regulating kinase activity and
           likely also contribute to LIMK function by acting as
           sites of protein-to-protein interactions. All LIM
           domains are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 74

 Score = 32.2 bits (73), Expect = 0.040
 Identities = 15/58 (25%), Positives = 25/58 (43%), Gaps = 2/58 (3%)

Query: 91  GSLKLNSCSLCGEKVYLAQRFAFNARLFHRTCFKCARCQSQLTCINAYETHTGQFCCE 148
               L  C+ CG+ +Y  Q        +H  CF+C  C + L+  + Y    G+  C+
Sbjct: 15  EGNVLPVCASCGQSIYDGQYLQALNSDWHADCFRCCECGASLS--HWYYEKDGRLFCK 70


>gnl|CDD|188717 cd09331, LIM1_PINCH, The first LIM domain of protein PINCH.  The
           first LIM domain of paxillin: Paxillin is an adaptor
           protein, which recruits key components of the
           signal-transduction machinery to specific sub-cellular
           locations to respond to environmental changes rapidly.
           The C-terminal region of paxillin contains four LIM
           domains which target paxillin to focal adhesions,
           presumably through a direct association with the
           cytoplasmic tail of beta-integrin. The N-terminal of
           paxillin is leucine-rich LD-motifs. Paxillin is found at
           the interface between the plasma membrane and the actin
           cytoskeleton. The binding partners of paxillin are
           diverse and include protein tyrosine kinases, such as
           Src and FAK, structural proteins, such as vinculin and
           actopaxin, and regulators of actin organization.
           Paxillin recruits these proteins to their function sites
           to control the dynamic changes in cell adhesion,
           cytoskeletal reorganization and gene expression. LIM
           domains are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 59

 Score = 31.5 bits (72), Expect = 0.052
 Identities = 14/50 (28%), Positives = 20/50 (40%), Gaps = 1/50 (2%)

Query: 98  CSLCGEKVYLAQR-FAFNARLFHRTCFKCARCQSQLTCINAYETHTGQFC 146
           C  C E     ++    N  L+H  CF CA+C         YE    ++C
Sbjct: 1   CERCREGFEPDEKIVNSNGELYHEQCFVCAQCFQPFPDGLFYEFEGRKYC 50


>gnl|CDD|188768 cd09382, LIM2_Lhx6, The second LIM domain of Lhx6.  The second LIM
           domain of Lhx6. Lhx6 is a member of LHX protein family,
           which features two tandem N-terminal LIM domains and a
           C-terminal DNA binding homeodomain. Members of LHX
           family are found in the nucleus and act as transcription
           factors or cofactors. LHX proteins are critical for the
           development of specialized cells in multiple tissue
           types, including the nervous system, skeletal muscle,
           the heart, the kidneys, and endocrine organs such as the
           pituitary gland and the pancreas. Lhx6 functions in
           brain and nervous system.  It is expressed at high
           levels in several regions of the embryonic mouse CNS,
           including the telencephalon and hypothalamus, and the
           first branchial arch. Lhx6 is proposed to have a role in
           patterning of the mandible and maxilla, and in signaling
           during odontogenesis. In brain sections, knockdown of
           Lhx6 gene blocks the normal migration of neurons to the
           cortex. As in other LIM domains, this domain family is
           50-60 amino acids in size and shares two characteristic
           zinc finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 55

 Score = 30.8 bits (69), Expect = 0.090
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 3/38 (7%)

Query: 98  CSLCGEKVYLAQRFAFNAR--LFHRTCFKCARCQSQLT 133
           C+ CG ++Y A  +   AR   +H  CF C  C+ QL+
Sbjct: 1   CARCGRQIY-ASDWVRRARGNAYHLACFACFSCKRQLS 37


>gnl|CDD|188831 cd09447, LIM_LASP, The LIM domain of LIM and SH3 Protein (LASP).
           The LIM domain of LIM and SH3 Protein (LASP):  LASP
           family contains two highly homologous members, LASP-1
           and LASP-2. LASP contains a LIM motif at its amino
           terminus, a src homology 3 (SH3) domains at its
           C-terminal part, and a nebulin-like region in the
           middle. LASP-1 and -2 are highly conserved in their LIM,
           nebulin-like, and SH3 domains ,but differ significantly
           at their linker regions. Both proteins are ubiquitously
           expressed and involved in cytoskeletal architecture,
           especially in the organization of focal adhesions.
           LASP-1 and LASP-2, are important during early embryo-
           and fetogenesis and are highly expressed in the central
           nervous system of the adult. However, only LASP-1 seems
           to participate significantly in neuronal differentiation
           and plays an important functional role in migration and
           proliferation of certain cancer cells while the role of
           LASP-2 is more structural. The expression of LASP-1 in
           breast tumors is increased significantly. As in other
           LIM domains, this domain family is 50-60 amino acids in
           size and shares two characteristic zinc finger motifs.
           The two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein.
          Length = 53

 Score = 30.0 bits (68), Expect = 0.13
 Identities = 12/36 (33%), Positives = 20/36 (55%)

Query: 98  CSLCGEKVYLAQRFAFNARLFHRTCFKCARCQSQLT 133
           C+ CG+ VY  ++     +++H+ CFKC  C   L 
Sbjct: 1   CARCGKTVYPTEKLNCLDKIWHKGCFKCEVCGMTLN 36


>gnl|CDD|188818 cd09434, LIM4_FHL3, The fourth LIM domain of Four and a half LIM
           domains protein 3 (FHL3).  The fourth LIM domain of Four
           and a half LIM domains protein 3 (FHL3):  FHL3 is highly
           expressed in the skeleton and cardiac muscles and
           possesses the transactivation and repression activities.
           FHL3 interacts with many transcription factors, such as
           CREB, BKLF/KLF3, CtBP2, MyoD, and MZF_1. Moreover, FHL3
           interacts with alpha- and beta-subunits of the muscle
           alpha7beta1 integrin receptor. FHL3 was also proved to
           possess the auto-activation ability and was confirmed
           that the second zinc finger motif in fourth LIM domain
           was responsible for the auto-activation of FHL3. LIM
           domains are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 56

 Score = 30.1 bits (68), Expect = 0.17
 Identities = 10/21 (47%), Positives = 14/21 (66%)

Query: 112 AFNARLFHRTCFKCARCQSQL 132
           +F  R +H+ CFKC+RC   L
Sbjct: 18  SFEDRQWHQPCFKCSRCSVSL 38


>gnl|CDD|188733 cd09347, LIM4_FHL, The fourth LIM domain of Four and a half LIM
           domains protein (FHL).  The fourth LIM domain of Four
           and a half LIM domains protein (FHL): LIM-only protein
           family consists of five members, designated FHL1, FHL2,
           FHL3, FHL5 and LIMPETin. The first four members are
           composed of four complete LIM domains arranged in tandem
           and an N-terminal single zinc finger domain with a
           consensus sequence equivalent to the C-terminal half of
           a LIM domain. LIMPETin is an exception, containing six
           LIM domains. FHL1, 2 and 3 are predominantly expressed
           in muscle tissues, and FHL5 is highly expressed in male
           germ cells.  FHL proteins exert their roles as
           transcription co-activators or co-repressors through a
           wide array of interaction partners. For example, FHL1
           binds to Myosin-binding protein C, regulating myosin
           filament formation and sarcomere assembly. FHL2 has
           shown to interact with more than 50 different proteins,
           including receptors, structural proteins, transcription
           factors and cofactors, signal transducers, splicing
           factors, DNA replication and repair enzymes, and
           metabolic enzymes. FHL3 interacts with many
           transcription factors, such as CREB, BKLF/KLF3, CtBP2,
           MyoD, and MZF_1. FHL5 is a tissue-specific coactivator
           of CREB/CREM family transcription factors. LIM domains
           are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 56

 Score = 29.6 bits (67), Expect = 0.21
 Identities = 8/20 (40%), Positives = 10/20 (50%)

Query: 113 FNARLFHRTCFKCARCQSQL 132
           F  R +H  CF C +C   L
Sbjct: 19  FEERQWHSDCFNCGKCSVSL 38


>gnl|CDD|188713 cd09327, LIM1_abLIM, The first LIM domain of actin binding LIM
           (abLIM) proteins.  The first LIM domain of actin binding
           LIM (abLIM) proteins:  Three homologous members of the
           abLIM protein family have been identified; abLIM-1,
           abLIM-2 and abLIM-3. The N-terminal of abLIM consists of
           four tandem repeats of LIM domains and the C-terminal of
           acting binding LIM protein is a villin headpiece domain,
           which has strong actin binding activity. The abLIM-1,
           which is expressed in retina, brain, and muscle tissue,
           has been indicated to function as a tumor suppressor.
           AbLIM-2 and -3, mainly expressed in muscle and neuronal
           tissue, bind to F-actin strongly.  They may serve as a
           scaffold for signaling modules of the actin cytoskeleton
           and thereby modulate transcription. It has shown that
           LIM domains of abLIMs interact with STARS (striated
           muscle activator of Rho signaling), which directly binds
           actin and stimulates serum-response factor
           (SRF)-dependent transcription. All LIM domains are 50-60
           amino acids in size and share two characteristic highly
           conserved zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 52

 Score = 29.5 bits (67), Expect = 0.22
 Identities = 13/39 (33%), Positives = 15/39 (38%), Gaps = 9/39 (23%)

Query: 98  CSLCGEK----VYLAQRFAFNARLFHRTCFKCARCQSQL 132
           C  CG+K    V   Q      + FH  CF C  C   L
Sbjct: 1   CYKCGKKCKGEVLRVQ-----DKYFHIKCFTCKVCGCDL 34


>gnl|CDD|188798 cd09414, LIM1_LIMPETin, The first LIM domain of protein LIMPETin.
           The first LIM domain of protein LIMPETin: LIMPETin
           contains 6 LIM domains at the C-terminal and an
           N-terminal PET domain. Four of the six LIM domains are
           highly homologous to the four and half LIM domain
           protein family and two of them show sequence similarity
           to the LIM domains of the Testin family. Thus, LIMPETin
           may be the recombinant product of genes coding testin
           and FHL proteins.  In Schistosoma mansoni, where
           LIMPETin was first identified, LIMPETin is down
           regulated in sexually mature adult Schistosoma females
           compared to sexually immature adult females and adult
           male. Its differential expression indicates that it is a
           transcription regulator. LIM domains are 50-60 amino
           acids in size and share two characteristic zinc finger
           motifs. The two zinc fingers contain eight conserved
           residues, mostly cysteines and histidines, which
           coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 58

 Score = 29.3 bits (66), Expect = 0.26
 Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 1/32 (3%)

Query: 117 LFHRTCFKCARCQSQLTCINAYETHTGQFCCE 148
           L+H  CF+C+ C+  L  +  Y  H  Q  CE
Sbjct: 25  LWHPACFRCSTCEELLVDL-TYCVHDDQIYCE 55


>gnl|CDD|188715 cd09329, LIM3_abLIM, The third LIM domain of actin binding LIM
           (abLIM) proteins.  The third LIM domain of actin binding
           LIM (abLIM) proteins: Three homologous members of the
           abLIM protein family have been identified; abLIM-1,
           abLIM-2 and abLIM-3. The N-terminal of abLIM consists of
           four tandem repeats of LIM domains and the C-terminal of
           acting binding LIM protein is a villin headpiece domain,
           which has strong actin binding activity. The abLIM-1,
           which is expressed in retina, brain, and muscle tissue,
           has been indicated to function as a tumor suppressor.
           AbLIM-2 and -3, mainly expressed in muscle and neuronal
           tissue, bind to F-actin strongly.  They may serve as a
           scaffold for signaling modules of the actin cytoskeleton
           and thereby modulate transcription. It has shown that
           LIM domains of abLIMs interact with STARS (striated
           muscle activator of Rho signaling), which directly binds
           actin and stimulates serum-response factor
           (SRF)-dependent transcription. All LIM domains are 50-60
           amino acids in size and share two characteristic highly
           conserved zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 52

 Score = 29.2 bits (66), Expect = 0.29
 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 2/51 (3%)

Query: 98  CSLCGEKVYLAQRFAFNARLFHRTCFKCARCQSQLTCINAYETHTGQFCCE 148
           C+ CG+++   Q      + +H  CFKC  C   LT    Y    G+  CE
Sbjct: 1   CAGCGQEIKNGQALLALDKQWHVWCFKCKECGKVLT--GEYMGKDGKPYCE 49


>gnl|CDD|188755 cd09369, LIM1_Lhx2_Lhx9, The first LIM domain of Lhx2 and Lhx9
           family.  The first LIM domain of Lhx2 and Lhx9 family:
           Lhx2 and Lhx9 are highly homologous LHX regulatory
           proteins. They belong to the LHX protein family, which
           features two tandem N-terminal LIM domains and a
           C-terminal DNA binding homeodomain. Members of LHX
           family are found in the nucleus and act as transcription
           factors or cofactors. LHX proteins are critical for the
           development of specialized cells in multiple tissue
           types, including the nervous system, skeletal muscle,
           the heart, the kidneys, and endocrine organs, such as
           the pituitary gland and the pancreas.  Although Lhx2 and
           Lhx9 are highly homologous, they seems to play
           regulatory roles in different organs.  In animals, Lhx2
           plays important roles in eye, cerebral cortex, limb, the
           olfactory organs, and erythrocyte development. Lhx2 gene
           knockout mice exhibit impaired patterning of the
           cortical hem and the telencephalon of the developing
           brain, and a lack of development in olfactory
           structures. Lhx9 is expressed in several regions of the
           developing mouse brain , the spinal cord, the pancreas,
           in limb mesenchyme, and in the urogenital region. Lhx9
           plays critical roles in gonad development.  Homozygous
           mice lacking functional Lhx9 alleles exhibit numerous
           urogenital defects, such as gonadal agenesis,
           infertility, and undetectable levels of testosterone and
           estradiol coupled with high FSH levels. Lhx9 null mice
           are phenotypically female, even those that are
           genotypically male. As in other LIM domains, this domain
           family is 50-60 amino acids in size and shares two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein.
          Length = 54

 Score = 29.2 bits (66), Expect = 0.31
 Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 8/43 (18%)

Query: 98  CSLCGEKVYLAQRFAFNA--RLFHRTCFKCARC----QSQLTC 134
           C+ CGEK+    RF   A  R +H +C KC  C     S+L+C
Sbjct: 1   CAGCGEKI--QDRFYLLAVDRQWHASCLKCCECRLPLDSELSC 41


>gnl|CDD|188807 cd09423, LIM1_FHL3, The first LIM domain of Four and a half LIM
           domains protein 3 (FHL3).  The first LIM domain of Four
           and a half LIM domains protein 3 (FHL3):  FHL3 is highly
           expressed in the skeleton and cardiac muscles and
           possesses the transactivation and repression activities.
           FHL3 interacts with many transcription factors, such as
           CREB, BKLF/KLF3, CtBP2, MyoD, and MZF_1. Moreover, FHL3
           interacts with alpha- and beta-subunits of the muscle
           alpha7beta1 integrin receptor. FHL3 was also proved to
           possess the auto-activation ability and was confirmed
           that the second zinc finger motif in fourth LIM domain
           was responsible for the auto-activation of FHL3. LIM
           domains are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 59

 Score = 29.1 bits (65), Expect = 0.32
 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 5/58 (8%)

Query: 96  NSCSLCGEKV-YLAQRFAFNARLFHRTCFKCARCQSQLTCINAYETHTGQFCCEVCPD 152
           N+C  C E + + ++   +  R +H  CF+C RC   L    A E  T Q    +C D
Sbjct: 3   NTCDECKELIGHDSRELYYEDRHYHEHCFRCFRCDRSL----ADEPFTCQDEELLCND 56


>gnl|CDD|188771 cd09385, LIM2_LMO2, The second LIM domain of LMO2 (LIM domain only
           protein 2).  The second LIM domain of LMO2 (LIM domain
           only protein 2): LMO2 is a nuclear protein that  plays
           important roles in transcriptional regulation and
           development. The two tandem LIM domains of LMO2 support
           the assembly of a crucial cell-regulatory complex by
           interacting with both the TAL1-E47 and GATA1
           transcription factors to form a DNA-binding complex that
           is capable of transcriptional activation. LMOs have also
           been shown to be involved in oncogenesis. LMO1 and LMO2
           are activated in T-cell acute lymphoblastic leukemia by
           distinct chromosomal translocations. LMO2 was also shown
           to be involved in erythropoiesis and is required for the
           hematopoiesis in the adult animals. All LIM domains are
           50-60 amino acids in size and share two characteristic
           zinc finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 56

 Score = 29.2 bits (65), Expect = 0.33
 Identities = 11/33 (33%), Positives = 15/33 (45%)

Query: 116 RLFHRTCFKCARCQSQLTCINAYETHTGQFCCE 148
           +++H  CFKCA CQ      + Y        CE
Sbjct: 20  KVYHLECFKCAACQKHFCVGDRYLLINSDIVCE 52


>gnl|CDD|220484 pfam09943, DUF2175, Uncharacterized protein conserved in archaea
           (DUF2175).  This domain, found in various hypothetical
           archaeal proteins, has no known function.
          Length = 101

 Score = 29.7 bits (67), Expect = 0.44
 Identities = 7/28 (25%), Positives = 13/28 (46%), Gaps = 1/28 (3%)

Query: 98  CSLCGEKVYLAQRFAFNAR-LFHRTCFK 124
           C +CG+ +   + F F ++   H  C  
Sbjct: 5   CYICGKPIIEGELFTFTSKGPVHYECLV 32


>gnl|CDD|188737 cd09351, LIM1_LPP, The first LIM domain of lipoma preferred partner
           (LPP).  The first LIM domain of lipoma preferred partner
           (LPP): LPP is a member of the zyxin LIM protein family
           and contains three LIM zinc-binding domains at the
           C-terminal and proline-rich region at the N-terminal.
           LPP initially identified as the most frequent
           translocation partner of HMGA2 (High Mobility Group A2)
           in a subgroup of benign tumors of adipose tissue
           (lipomas). It was also shown to be rearranged in a
           number of other soft tissues, as well as in a case of
           acute monoblastic leukemia. In addition to its
           involvement in tumors, LPP was inedited as a smooth
           muscle restricted LIM protein that plays an important
           role in SMC migration. LPP is localized at sites of cell
           adhesion, cell-cell contacts and transiently in the
           nucleus. In nucleus, it acts as a coactivator for the
           ETS domain transcription factor PEA3. In addition to
           PEA3, it interacts with alpha-actinin,vasodilator
           stimulated phosphoprotein (VASP),Palladin, and Scrib.
           The  LIM domains are the main focal adhesion targeting
           elements and that the proline- rich region, which
           harbors binding sites for alpha-actinin and vasodilator-
           stimulated phosphoprotein (VASP), has a weak targeting
           capacity. As in other LIM domains, this domain family is
           50-60 amino acids in size and shares two characteristic
           zinc finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein.
          Length = 54

 Score = 28.5 bits (64), Expect = 0.49
 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 3/37 (8%)

Query: 98  CSLCGEKVYLAQRFAFNA--RLFHRTCFKCARCQSQL 132
           C  CGEKV L +     A  +++H +CF C +CQ  L
Sbjct: 1   CVKCGEKV-LGEGSGCTAMDQVYHISCFTCHQCQINL 36


>gnl|CDD|188872 cd09841, LIM1_Prickle_3, The first LIM domain of Prickle 3.  The
           first LIM domain of Prickle 3/LIM domain only 6 (LM06):
           Prickle contains three C-terminal LIM domains and a
           N-terminal PET domain.  Prickles have been implicated in
           roles of regulating tissue polarity or planar cell
           polarity (PCP).  PCP establishment requires the
           conserved Frizzled/Dishevelled PCP pathway. Prickle
           interacts with Dishevelled, thereby modulating
           Frizzled/Dishevelled activity and PCP signaling. Four
           forms of prickles have been identified: prickle 1-4. The
           best characterized is prickle 1 and prickle 2 which are
           differentially expressed. While prickle 1 is expressed
           in fetal heart and hematological malignancies, prickle 2
           is found in fetal brain, adult cartilage, pancreatic
           islet, and some types of timorous cells. Mutations in
           prickle 1 have been linked to progressive myoclonus
           epilepsy. LIM domains are 50-60 amino acids in size and
           share two characteristic zinc finger motifs. The two
           zinc fingers contain eight conserved residues, mostly
           cysteines and histidines, which coordinately bond to two
           zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 59

 Score = 28.3 bits (63), Expect = 0.68
 Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 6/55 (10%)

Query: 98  CSLCGEKVYLAQRFAFNAR-----LFHRTCFKCARCQSQLTCINAYETHTGQFCC 147
           C  CG ++       F +R      +H  CF+CA CQ +L     Y    G+  C
Sbjct: 1   CQQCGRQICGGDIAVFASRAGLGACWHPQCFQCASCQ-ELLVDLIYFYQDGKIYC 54


>gnl|CDD|188728 cd09342, LIM3_Testin_like, The third LIM domain of Testin-like
           family.  The third LIM domain of Testin_like family:
           This family includes testin, prickle, dyxin and
           LIMPETin. Structurally, testin and prickle proteins
           contain three LIM domains at C-terminal; LIMPETin has
           six LIM domains; and dyxin presents only two LIM
           domains. However, all members of the family contain a
           PET protein-protein interaction domain. Testin is a
           cytoskeleton associated focal adhesion protein that
           localizes along actin stress fibers, at
           cell-cell-contact areas, and at focal adhesion plaques.
           Testin interacts with a variety of cytoskeletal
           proteins, including zyxin, mena, VASP, talin, and actin
           and it is involved in cell motility and adhesion events.
           Prickles have been implicated in roles of regulating
           tissue polarity or planar cell polarity (PCP).  Dyxin
           involves in lung and heart development by interaction
           with GATA6 and blocking GATA6 activated target genes.
           LIMPETin might be the recombinant product of genes
           coding testin and four and half LIM proteins and its
           function is not well understood. As in other LIM
           domains, this domain family is 50-60 amino acids in size
           and shares two characteristic zinc finger motifs. The
           two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 57

 Score = 28.1 bits (63), Expect = 0.69
 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 3/38 (7%)

Query: 98  CSLCGEKVYL-AQRFAFNARLFHRT--CFKCARCQSQL 132
           C  CGE +    QR A N + +H T  CF C+ C+  L
Sbjct: 1   CDACGEPIGPDVQRVAHNGQHWHATEECFCCSNCKKSL 38


>gnl|CDD|188806 cd09422, LIM1_FHL2, The first LIM domain of Four and a half LIM
           domains protein 2 (FHL2).  The first LIM domain of Four
           and a half LIM domains protein 2 (FHL2):  FHL2 is one of
           the best studied FHL proteins. FHL2 expression is most
           abundant in the heart, and in brain, liver and lung at
           lesser extent. FHL2 participates in a wide range of
           cellular processes, such as transcriptional regulation,
           signal transduction, and cell survival by binding to
           various protein partners. FHL2 has shown to interact
           with more than 50 different proteins, including
           receptors, structural proteins, transcription factors
           and cofactors, signal transducers, splicing factors, DNA
           replication and repair enzymes, and metabolic enzymes.
           Although FHL2 is abundantly expressed in heart, the fhl2
           null mice are viable and had no detectable abnormal
           cardiac phenotype. LIM domains are 50-60 amino acids in
           size and share two characteristic zinc finger motifs.
           The two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 62

 Score = 28.3 bits (63), Expect = 0.71
 Identities = 10/38 (26%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 96  NSCSLCGEKV-YLAQRFAFNARLFHRTCFKCARCQSQL 132
           N+C  C + +    +  ++  R +H +CF C +C++ L
Sbjct: 3   NTCEECKKPIGCDCKDLSYKDRHWHESCFHCFQCKNSL 40


>gnl|CDD|238698 cd01407, SIR2-fam, SIR2 family of proteins includes silent
           information regulator 2 (Sir2) enzymes which catalyze
           NAD+-dependent protein/histone deacetylation, where the
           acetyl group from the lysine epsilon-amino group is
           transferred to the ADP-ribose moiety of NAD+, producing
           nicotinamide and the novel metabolite
           O-acetyl-ADP-ribose. Sir2 proteins, also known as
           sirtuins, are found in all eukaryotes and many archaea
           and prokaryotes and have been shown to regulate gene
           silencing, DNA repair, metabolic enzymes, and life span.
           The most-studied function, gene silencing, involves the
           inactivation of chromosome domains containing key
           regulatory genes by packaging them into a specialized
           chromatin structure that is inaccessible to DNA-binding
           proteins. The oligomerization state of Sir2 appears to
           be organism-dependent, sometimes occurring as a monomer
           and sometimes as a multimer.
          Length = 218

 Score = 30.2 bits (69), Expect = 0.78
 Identities = 14/53 (26%), Positives = 20/53 (37%), Gaps = 3/53 (5%)

Query: 80  RAPSQPPSTLPGSLKLNSCSLCGEKVYLAQRFAFNARLFHRTCFKCARCQSQL 132
           RA S     L GSL    C+ CG++          A +      +C +C   L
Sbjct: 94  RAGSPKVIELHGSLFRVRCTKCGKEYPRD---ELQADIDREEVPRCPKCGGLL 143


>gnl|CDD|218116 pfam04503, SSDP, Single-stranded DNA binding protein, SSDP.  This
           is a family of eukaryotic single-stranded DNA binding
           proteins with specificity to a pyrimidine-rich element
           found in the promoter region of the alpha2(I) collagen
           gene.
          Length = 293

 Score = 30.4 bits (68), Expect = 0.85
 Identities = 22/63 (34%), Positives = 25/63 (39%), Gaps = 8/63 (12%)

Query: 39  FHSIDLGDQLTNSNTDNPLSLPGVDVP--QKTTSPAHREPGAPRA----PSQPPSTLPGS 92
           F     G Q     T    S P +     Q   SP  R PG PR     P+QPP  +PGS
Sbjct: 40  FFQGAGGKQHQQKKTPQSGSTPQMQNTTSQPFMSP--RYPGGPRPPLRMPNQPPGGVPGS 97

Query: 93  LKL 95
             L
Sbjct: 98  QPL 100


>gnl|CDD|188759 cd09373, LIM1_AWH, The first LIM domain of Arrowhead (AWH).  The
           first LIM domain of Arrowhead (AWH): Arrowhead belongs
           to the LHX protein family, which features two tandem
           N-terminal LIM domains and a C-terminal DNA binding
           homeodomain. Members of LHX family are found in the
           nucleus and act as transcription factors or cofactors.
           LHX proteins are critical for the development of
           specialized cells in multiple tissue types, including
           the nervous system, skeletal muscle, the heart, the
           kidneys, and endocrine organs, such as the pituitary
           gland and the pancreas. During embryogenesis of
           Drosophila, Arrowhead is expressed in each abdominal
           segment and in the labial segment. Late in embryonic
           development, expression of arrowhead is refined to the
           abdominal histoblasts and salivary gland imaginal ring
           cells themselves. The Arrowhead gene required for
           establishment of a subset of imaginal tissues: the
           abdominal histoblasts and the salivary gland imaginal
           rings. As in other LIM domains, this domain family is
           50-60 amino acids in size and shares two characteristic
           zinc finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein.
          Length = 54

 Score = 27.7 bits (62), Expect = 0.89
 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 4/37 (10%)

Query: 98  CSLCGEKVYLAQRFAF--NARLFHRTCFKCARCQSQL 132
           C+ CGE +    RF    + R +H +C +C  CQ+ L
Sbjct: 1   CTGCGEPI--TDRFLLKVSGRSWHVSCLRCCVCQTPL 35


>gnl|CDD|188736 cd09350, LIM1_TRIP6, The first LIM domain of Thyroid
           receptor-interacting protein 6 (TRIP6).  The first LIM
           domain of Thyroid receptor-interacting protein 6
           (TRIP6): TRIP6 is a member of the zyxin LIM protein
           family and contains three LIM zinc-binding domains at
           the C-terminal. TRIP6 protein localizes to focal
           adhesion sites and along actin stress fibers.
           Recruitment of this protein to the plasma membrane
           occurs in a lysophosphatidic acid (LPA)-dependent
           manner. TRIP6 recruits a number of molecules involved in
           actin assembly, cell motility, survival and
           transcriptional control. The function of TRIP6 in cell
           motility is regulated by Src-dependent phosphorylation
           at a Tyr residue. The phosphorylation activates the
           coupling to the Crk SH2 domain, which is required for
           the function of TRIP6 in promoting lysophosphatidic acid
           (LPA)-induced cell migration. TRIP6 can shuttle to the
           nucleus to serve as a coactivator of AP-1 and NF-kappaB
           transcriptional factors. Moreover, TRIP6 can form a
           ternary complex with the NHERF2 PDZ protein and LPA2
           receptor to regulate LPA-induced activation of ERK and
           AKT, rendering cells resistant to chemotherapy. Recent
           evidence shows that TRIP6 antagonizes Fas-Induced
           apoptosis by enhancing the antiapoptotic effect of LPA
           in cells. As in other LIM domains, this domain family is
           50-60 amino acids in size and shares two characteristic
           zinc finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein.
          Length = 54

 Score = 27.8 bits (62), Expect = 0.91
 Identities = 13/37 (35%), Positives = 18/37 (48%), Gaps = 3/37 (8%)

Query: 98  CSLCGEKVYLAQRFAFNA--RLFHRTCFKCARCQSQL 132
           C  CGE V + +     A  ++FH  CF C  C  +L
Sbjct: 1   CGRCGENV-VGEGTGCTAMDQVFHVDCFTCMTCNGKL 36


>gnl|CDD|188726 cd09340, LIM1_Testin_like, The first LIM domain of Testin-like
           family.  The first LIM domain of Testin_like family:
           This family includes testin, prickle, dyxin and
           LIMPETin. Structurally, testin and prickle proteins
           contain three LIM domains at C-terminal; LIMPETin has
           six LIM domains; and dyxin presents only two LIM
           domains. However, all members of the family contain a
           PET protein-protein interaction domain.  Testin is a
           cytoskeleton associated focal adhesion protein that
           localizes along actin stress fibers, at
           cell-cell-contact areas, and at focal adhesion plaques.
           Testin interacts with a variety of cytoskeletal
           proteins, including zyxin, mena, VASP, talin, and actin
           and it is involved in cell motility and adhesion events.
           Prickles have been implicated in roles of regulating
           tissue polarity or planar cell polarity (PCP).  Dyxin
           involves in lung and heart development by interaction
           with GATA6 and blocking GATA6 activated target genes.
           LIMPETin might be the recombinant product of genes
           coding testin and four and half LIM proteins and its
           function is not well understood. As in other LIM
           domains, this domain family is 50-60 amino acids in size
           and shares two characteristic zinc finger motifs. The
           two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 58

 Score = 28.0 bits (63), Expect = 0.97
 Identities = 11/37 (29%), Positives = 13/37 (35%), Gaps = 7/37 (18%)

Query: 98  CSLC------GEKVYLAQRFAFNARLFHRTCFKCARC 128
           C  C      GE    A+R       +H  CF C  C
Sbjct: 1   CEKCKEPINPGEVAVFAERAG-EDACWHPGCFVCETC 36


>gnl|CDD|188730 cd09344, LIM1_FHL1, The first LIM domain of Four and a half LIM
           domains protein 1.  The first LIM domain of Four and a
           half LIM domains protein 1 (FHL1):  FHL1 is heavily
           expressed in skeletal and cardiac muscles. It plays
           important roles in muscle growth, differentiation, and
           sarcomere assembly by acting as a modulator of
           transcription factors. Defects in FHL1 gene are
           responsible for a number of Muscular dystrophy-like
           muscle disorders. It has been detected that FHL1 binds
           to Myosin-binding protein C, regulating myosin filament
           formation and sarcomere assembly. LIM domains are 50-60
           amino acids in size and share two characteristic zinc
           finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes. .
          Length = 54

 Score = 27.4 bits (61), Expect = 1.1
 Identities = 9/20 (45%), Positives = 12/20 (60%)

Query: 113 FNARLFHRTCFKCARCQSQL 132
              R +H TCF+CA+C   L
Sbjct: 17  HKNRYWHETCFRCAKCYKPL 36


>gnl|CDD|188845 cd09461, LIM3_Enigma_like_1, The third LIM domain of an Enigma
           subfamily with unknown function.  The third LIM domain
           of an Enigma subfamily with unknown function: The Enigma
           LIM domain family is comprised of three characterized
           members: Enigma, ENH, and Cypher (mouse)/ZASP (human).
           These subfamily members contain a single PDZ domain at
           the N-terminus and three LIM domains at the C-terminus.
           They serve as adaptor proteins, where the PDZ domain
           tethers the protein to the cytoskeleton and the LIM
           domains, recruit signaling proteins to implement
           corresponding functions. The members of the enigma
           family have been implicated in regulating or organizing
           cytoskeletal structure, as well as involving multiple
           signaling pathways. LIM domains are 50-60 amino acids in
           size and share two characteristic zinc finger motifs.
           The two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 54

 Score = 27.5 bits (61), Expect = 1.4
 Identities = 16/51 (31%), Positives = 20/51 (39%), Gaps = 3/51 (5%)

Query: 98  CSLCGEKVYLAQRF--AFNARLFHRTCFKCARCQSQLTCINAYETHTGQFC 146
           C  CG  +    R+  A N   +H  CF C RC   L   + Y      FC
Sbjct: 1   CVSCGFPIEAGDRWVEALNNN-YHSQCFNCTRCNVNLEGQSFYAKGGRPFC 50


>gnl|CDD|188851 cd09467, LIM1_Lhx3b, The first LIM domain of Lhx3b.  The first LIM
           domain of Lhx3b. Lhx3b is a member of LHX protein
           family, which features two tandem N-terminal LIM domains
           and a C-terminal DNA binding homeodomain. Members of LHX
           family are found in the nucleus and act as transcription
           factors or cofactors. LHX proteins are critical for the
           development of specialized cells in multiple tissue
           types, including the nervous system, skeletal muscle,
           the heart, the kidneys, and endocrine organs, such as
           the pituitary gland and the pancreas. Lhx3b is one of
           the two isoforms of Lhx3. The Lhx3 gene is expressed in
           the ventral spinal cord, the pons, the medulla
           oblongata, and the pineal gland of the developing
           nervous system during mouse embryogenesis, and
           transcripts are found in the emergent pituitary gland.
           Lhx3 functions in concert with other transcription
           factors to specify interneuron and motor neuron fates
           during development. Lhx3 proteins have been demonstrated
           to directly bind to the promoters of several pituitary
           hormone gene promoters. The Lhx3 gene encodes two
           isoforms, LHX3a and LHX3b that differ in their
           amino-terminal sequences, where Lhx3a has longer
           N-terminal.  They show differential activation of
           pituitary hormone genes and distinct DNA binding
           properties. In human, Lhx3a trans-activated the
           alpha-glycoprotein subunit promoter and genes containing
           a high-affinity Lhx3 binding site more effectively than
           the hLhx3b isoform. In addition, hLhx3a induce
           transcription of the TSHbeta-subunit gene by acting on
           pituitary POU domain factor, Pit-1, while hLhx3b does
           not. As in other LIM domains, this domain family is
           50-60 amino acids in size and shares two characteristic
           zinc finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein.
          Length = 55

 Score = 27.2 bits (60), Expect = 1.5
 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 4/37 (10%)

Query: 98  CSLCGEKVYLAQRFAFNA--RLFHRTCFKCARCQSQL 132
           C+ C +  ++  RF      R +H  C KC+ CQ+QL
Sbjct: 4   CAGCNQ--HIVDRFILKVLDRHWHSKCLKCSDCQTQL 38


>gnl|CDD|188810 cd09426, LIM2_FHL2, The second LIM domain of Four and a half LIM
           domains protein 2 (FHL2).  The second LIM domain of Four
           and a half LIM domains protein 2 (FHL2):  FHL2 is one of
           the best studied FHL proteins. FHL2 expression is most
           abundant in the heart, and in brain, liver and lung to a
           lesser extent. FHL2 participates in a wide range of
           cellular processes, such as transcriptional regulation,
           signal transduction, and cell survival by binding to
           various protein partners. FHL2 has shown to interact
           with more than 50 different proteins, including
           receptors, structural proteins, transcription factors
           and cofactors, signal transducers, splicing factors, DNA
           replication and repair enzymes, and metabolic enzymes.
           Although FHL2 is abundantly expressed in heart, the fhl2
           null mice are viable and had no detectable abnormal
           cardiac phenotype. LIM domains are 50-60 amino acids in
           size and share two characteristic zinc finger motifs.
           The two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to s upport the assembly of multimeric protein
           complexes.
          Length = 57

 Score = 26.9 bits (59), Expect = 1.9
 Identities = 12/33 (36%), Positives = 16/33 (48%), Gaps = 1/33 (3%)

Query: 98  CSLCGEKVYLAQR-FAFNARLFHRTCFKCARCQ 129
           CS C + +    R   +    +H TCF C RCQ
Sbjct: 1   CSECKKTIMPGTRKMEYKGNSWHETCFICQRCQ 33


>gnl|CDD|188783 cd09397, LIM1_UF1, LIM domain in proteins of unknown function.  The
           first Lim domain of a LIM domain containing protein: The
           functions of the proteins are unknown. The members of
           this family contain two copies of LIM domain. The LIM
           domain is 50-60 amino acids in size and shares two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein.
          Length = 58

 Score = 26.8 bits (60), Expect = 2.0
 Identities = 10/39 (25%), Positives = 15/39 (38%), Gaps = 3/39 (7%)

Query: 98  CSLCGEKVYLAQRFAFNARL---FHRTCFKCARCQSQLT 133
           C  CG ++      + +  L   +HR CF C  C     
Sbjct: 1   CRKCGLEIEGKSISSKDGELSGQWHRECFVCTTCGCPFQ 39


>gnl|CDD|188761 cd09375, LIM2_Lhx1_Lhx5, The second LIM domain of Lhx1 (also known
           as Lim1) and Lhx5.  The second LIM domain of Lhx1 (also
           known as Lim1) and Lhx5. Lhx1 and Lhx5 are closely
           related members of LHX protein family, which features
           two tandem N-terminal LIM domains and a C-terminal DNA
           binding homeodomain. Members of LHX family are found in
           the nucleus and act as transcription factors or
           cofactors. LHX proteins are critical for the development
           of specialized cells in multiple tissue types, including
           the nervous system, skeletal muscle, the heart, the
           kidneys, and endocrine organs, such as the pituitary
           gland and the pancreas. Lhx1 is required for regulating
           the vertebrate head organizer, the nervous system, and
           female reproductive tract development. During
           embryogenesis in the mouse, Lhx1 is expressed early in
           mesodermal tissue, then later during urogenital, kidney,
           liver, and nervous system development. In the adult,
           expression is restricted to the kidney and brain. A
           mouse embryos with Lhx1 gene knockout cannot grow normal
           anterior head structures, kidneys, and gonads, but with
           normally developed trunk and tail morphology. In the
           developing nervous system, Lhx1 is required to direct
           the trajectories of motor axons in the limb. Lhx1 null
           female mice lack the oviducts and uterus.  Lhx5 protein
           may play complementary or overlapping roles with Lhx1.
           The expression of Lhx5 in the anterior portion of the
           mouse neural tube suggests a role in patterning of the
           forebrain. All LIM domains are 50-60 amino acids in size
           and share two characteristic zinc finger motifs. The two
           zinc fingers contain eight conserved residues, mostly
           cysteines and histidines, which coordinately bond to two
           zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 56

 Score = 26.9 bits (60), Expect = 2.0
 Identities = 12/32 (37%), Positives = 15/32 (46%), Gaps = 1/32 (3%)

Query: 118 FHRTCFKCARCQSQL-TCINAYETHTGQFCCE 148
           FH  CF C  C+ QL T    Y     +F C+
Sbjct: 22  FHLNCFTCMVCRKQLSTGEELYILDENKFICK 53


>gnl|CDD|188714 cd09328, LIM2_abLIM, The second LIM domain on actin binding LIM
           (abLIM) proteins.  The second LIM domain of actin
           binding LIM (abLIM) proteins:  Three homologous members
           of the abLIM protein family have been identified;
           abLIM-1, abLIM-2 and abLIM-3. The N-terminal of abLIM
           consists of four tandem repeats of LIM domains and the
           C-terminal of acting binding LIM protein is a villin
           headpiece domain, which has strong actin binding
           activity. The abLIM-1, which is expressed in retina,
           brain, and muscle tissue, has been indicated to function
           as a tumor suppressor. AbLIM-2 and -3, mainly expressed
           in muscle and neuronal tissue, bind to F-actin strongly.
            They may serve as a scaffold for signaling modules of
           the actin cytoskeleton and thereby modulate
           transcription. It has shown that LIM domains of abLIMs
           interact with STARS (striated muscle activator of Rho
           signaling), which directly binds actin and stimulates
           serum-response factor (SRF)-dependent transcription. All
           LIM domains are 50-60 amino acids in size and share two
           characteristic highly conserved zinc finger motifs. The
           two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 56

 Score = 26.5 bits (59), Expect = 2.5
 Identities = 11/36 (30%), Positives = 17/36 (47%), Gaps = 2/36 (5%)

Query: 116 RLFHRTCFKCARCQSQLTCINAYETHTGQFC-CEVC 150
           + +H  CF C+ C+ Q        T  G+ C C+ C
Sbjct: 21  KTYHPKCFVCSVCR-QPFPPGDRVTFNGKECLCQKC 55


>gnl|CDD|188774 cd09388, LIM1_LMO1_LMO3, The first LIM domain of LMO1 and LMO3 (LIM
           domain only protein 1 and 3).  The first LIM domain of
           LMO1 and LMO3 (LIM domain only protein 1 and 3): LMO1
           and LMO3 are highly homologous and belong to the LMO
           protein family. LMO1 and LMO3 are nuclear protein that
           plays important roles in transcriptional regulation and
           development. As LIM domains lack intrinsic DNA-binding
           activity, nuclear LMOs are involved in transcriptional
           regulation by forming complexes with other transcription
           factors or cofactors. For example, LMO1 interacts with
           the the bHLH domain of  bHLH transcription factor, TAL1
           (T-cell acute leukemia1)/SCL (stem cell leukemia) . LMO1
           inhibits the expression of TAL1/SCL target genes.  LMO3
           facilitates p53 binding to its response elements, which
           suggests that LMO3 acts as a co-repressor of p53,
           suppressing p53-dependent transcriptional regulation. In
           addition, LMO3 interacts with neuronal transcription
           factor, HEN2, and acts as an oncogene in neuroblastoma.
           Another binding partner of LMO3 is calcium- and
           integrin-binding protein CIB, which binds via the second
           LIM domain (LIM2) of LMO3. One role of the CIB/LMO3
           complex is to inhibit cell proliferation. Although LMO1
           and LMO3 are highly homologous proteins, they play
           different roles in the regulation of the pituitary
           glycoprotein hormone alpha-subunit (alpha GSU) gene.
           Alpha GSU promoter activity was markedly repressed by
           LMO1 but activated by LMO3. All LIM domains are 50-60
           amino acids in size and share two characteristic zinc
           finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 55

 Score = 26.7 bits (59), Expect = 2.5
 Identities = 12/37 (32%), Positives = 18/37 (48%), Gaps = 4/37 (10%)

Query: 98  CSLCGEKVYLAQRFAFNA--RLFHRTCFKCARCQSQL 132
           C+ C  K+    R+   A  + +H  C KCA C  +L
Sbjct: 1   CAGCNRKI--KDRYLLKALDQYWHEDCLKCACCDCRL 35


>gnl|CDD|188852 cd09468, LIM1_Lhx4, The first LIM domain of Lhx4.  The first LIM
           domain of Lhx4. Lhx4 belongs to the LHX protein family,
           which features two tandem N-terminal LIM domains and a
           C-terminal DNA binding homeodomain. Members of LHX
           family are found in the nucleus and act as transcription
           factors or cofactors. LHX proteins are critical for the
           development of specialized cells in multiple tissue
           types, including the nervous system, skeletal muscle,
           the heart, the kidneys, and endocrine organs, such as
           the pituitary gland and the pancreas. LHX4 plays
           essential roles in pituitary gland and nervous system
           development. In mice, the lhx4 gene is expressed in the
           developing hindbrain, cerebral cortex, pituitary gland,
           and spinal cord. LHX4 shows significant sequence
           similarity to LHX3, particularly to isoforms Lhx3a. In
           gene regulation experiments, the LHX4 protein exhibits
           regulation roles towards pituitary genes, acting on
           their promoters/enhancers. As in other LIM domains, this
           domain family is 50-60 amino acids in size and shares
           two characteristic zinc finger motifs. The two zinc
           fingers contain eight conserved residues, mostly
           cysteines and histidines, which coordinately bond to two
           zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein.
          Length = 52

 Score = 26.5 bits (58), Expect = 2.5
 Identities = 12/35 (34%), Positives = 17/35 (48%)

Query: 98  CSLCGEKVYLAQRFAFNARLFHRTCFKCARCQSQL 132
           C+ C + +          R +H +C KCA CQ QL
Sbjct: 1   CAGCNQHILDKFILKVLDRHWHSSCLKCADCQMQL 35


>gnl|CDD|188765 cd09379, LIM2_AWH, The second LIM domain of Arrowhead (AWH).  The
           second LIM domain of Arrowhead (AWH): Arrowhead belongs
           to the LHX protein family, which features two tandem
           N-terminal LIM domains and a C-terminal DNA binding
           homeodomain. Members of LHX family are found in the
           nucleus and act as transcription factors or cofactors.
           LHX proteins are critical for the development of
           specialized cells in multiple tissue types, including
           the nervous system, skeletal muscle, the heart, the
           kidneys, and endocrine organs such as the pituitary
           gland and the pancreas. During embryogenesis of
           Drosophila, Arrowhead is expressed in each abdominal
           segment and in the labial segment. Late in embryonic
           development, expression of arrowhead is refined to the
           abdominal histoblasts and salivary gland imaginal ring
           cells themselves. The Arrowhead gene required for
           establishment of a subset of imaginal tissues: the
           abdominal histoblasts and the salivary gland imaginal
           rings. As in other LIM domains, this domain family is
           50-60 amino acids in size and shares two characteristic
           zinc finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein.
          Length = 55

 Score = 26.6 bits (59), Expect = 2.6
 Identities = 12/52 (23%), Positives = 22/52 (42%), Gaps = 3/52 (5%)

Query: 98  CSLCGEKVYLAQ--RFAFNARLFHRTCFKCARCQSQLTCINAYETHTGQFCC 147
           C+ C   +  +   R A +  ++H  CF C  C+ QL+    +     +  C
Sbjct: 1   CAKCSRNISASDWVRRARD-HVYHLACFACDACKRQLSTGEEFALIEDRVLC 51


>gnl|CDD|188854 cd09470, LIM1_Lhx9, The first LIM domain of Lhx9.  The first LIM
           domain of Lhx9: Lhx9 belongs to the LHX protein family,
           which features two tandem N-terminal LIM domains and a
           C-terminal DNA binding homeodomain. Members of LHX
           family are found in the nucleus and act as transcription
           factors or cofactors. LHX proteins are critical for the
           development of specialized cells in multiple tissue
           types, including the nervous system, skeletal muscle,
           the heart, the kidneys, and endocrine organs, such as
           the pituitary gland and the pancreas.  Lhx9 is highly
           homologous to Lhx2. It is expressed in several regions
           of the developing mouse brain, the spinal cord, the
           pancreas, in limb mesenchyme, and in the urogenital
           region. Lhx9 plays critical roles in gonad development. 
           Homozygous mice lacking functional Lhx9 alleles exhibit
           numerous urogenital defects, such as gonadal agenesis,
           infertility, and undetectable levels of testosterone and
           estradiol coupled with high FSH levels. Lhx9 null mice
           have reduced levels of the Sf1 nuclear receptor that is
           required for gonadogenesis, and recent studies have
           shown that Lhx9 is able to activate the Sf1/FtzF1 gene.
           Lhx9 null mice are phenotypically female, even those
           that are genotypically male.  As in other LIM domains,
           this domain family is 50-60 amino acids in size and
           shares two characteristic zinc finger motifs. The two
           zinc fingers contain eight conserved residues, mostly
           cysteines and histidines, which coordinately bond to two
           zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein.
          Length = 54

 Score = 26.6 bits (58), Expect = 3.2
 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 8/43 (18%)

Query: 98  CSLCGEKVYLAQRFAFNA--RLFHRTCFKCARC----QSQLTC 134
           C+ CG K+  + R+   A  + +H  C KC  C    +S+LTC
Sbjct: 1   CAGCGGKI--SDRYYLLAVDKQWHLRCLKCCECKLALESELTC 41


>gnl|CDD|130919 TIGR01860, VNFD, nitrogenase vanadium-iron protein, alpha chain.
           This model represents the alpha chain of the
           vanadium-containing component of the vanadium-iron
           nitrogenase compound I. The complex also includes a
           second alpha chain, two beta chains and two delta
           chains. Compount I interacts with compound II also known
           as the iron-protein which transfers electrons to
           compound I where the catalysis occurs [Central
           intermediary metabolism, Nitrogen fixation].
          Length = 461

 Score = 28.8 bits (64), Expect = 3.4
 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 3/46 (6%)

Query: 63  DVPQKTTSPAHREPGAPRAPSQPPS---TLPGSLKLNSCSLCGEKV 105
           D+P++      +EPG       P S   T+PGSL    CS CG K+
Sbjct: 10  DIPERQKHVYIKEPGEDTTEFLPLSNIATIPGSLSERGCSYCGAKL 55


>gnl|CDD|165563 PHA03308, PHA03308, transcriptional regulator ICP4; Provisional.
          Length = 1463

 Score = 29.0 bits (64), Expect = 3.5
 Identities = 13/37 (35%), Positives = 18/37 (48%)

Query: 51  SNTDNPLSLPGVDVPQKTTSPAHREPGAPRAPSQPPS 87
           ++ DNPL  P    P+    P   EP  P+ P +P S
Sbjct: 835 TDRDNPLLPPCPITPEGPPCPPREEPQQPQEPQEPQS 871


>gnl|CDD|188732 cd09346, LIM3_FHL, The third LIM domain of Four and a half LIM
           domains protein (FHL).  The third LIM domain of Four and
           a half LIM domains protein (FHL): LIM-only protein
           family consists of five members, designated FHL1, FHL2,
           FHL3, FHL5 and LIMPETin. The first four members are
           composed of four complete LIM domains arranged in tandem
           and an N-terminal single zinc finger domain with a
           consensus sequence equivalent to the C-terminal half of
           a LIM domain. LIMPETin is an exception, containing six
           LIM domains. FHL1, 2 and 3 are predominantly expressed
           in muscle tissues, and FHL5 is highly expressed in male
           germ cells.  FHL proteins exert their roles as
           transcription co-activators or co-repressors through a
           wide array of interaction partners. For example, FHL1
           binds to Myosin-binding protein C, regulating myosin
           filament formation and sarcomere assembly. FHL2 has
           shown to interact with more than 50 different proteins,
           including receptors, structural proteins, transcription
           factors and cofactors, signal transducers, splicing
           factors, DNA replication and repair enzymes, and
           metabolic enzymes. FHL3 int eracts with many
           transcription factors, such as CREB, BKLF/KLF3, CtBP2,
           MyoD, and MZF_1. FHL5 is a tissue-specific coactivator
           of CREB/CREM family transcription factors. LIM domains
           are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 52

 Score = 26.1 bits (58), Expect = 3.9
 Identities = 10/35 (28%), Positives = 17/35 (48%), Gaps = 1/35 (2%)

Query: 98  CSLCGEKVYLAQRFAFNARLFHRTCFKCARCQSQL 132
           C+ C  K   +    +  + +H+ CF C  C+ QL
Sbjct: 1   CAKCK-KAITSGGVTYRDQPWHKECFVCTGCKKQL 34


>gnl|CDD|188814 cd09430, LIM5_LIMPETin, The fifth LIM domain of protein LIMPETin.
           The fifth LIM domain of protein LIMPETin: LIMPETin
           contains 6 LIM domains at the C-terminal and an
           N-terminal PET domain. Four of the six LIM domains are
           highly homologous to the four and half LIM domain
           protein family and two of them show sequence similarity
           to the LIM domains of the testin family. Thus, LIMPETin
           may be the recombinant product of genes coding testin
           and FHL proteins.  In Schistosoma mansoni, where
           LIMPETin was first identified, LIMPETin is down
           regulated in sexually mature adult Schistosoma females
           compared to sexually immature adult females and adult
           male. Its differential expression indicates that it is a
           transcription regulator. LIM domains are 50-60 amino
           acids in size and share two characteristic zinc finger
           motifs. The two zinc fingers contain eight conserved
           residues, mostly cysteines and histidines, which
           coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 52

 Score = 25.9 bits (57), Expect = 4.2
 Identities = 7/15 (46%), Positives = 8/15 (53%)

Query: 118 FHRTCFKCARCQSQL 132
           +HR CF C  C   L
Sbjct: 20  WHRECFTCTNCSKSL 34


>gnl|CDD|188804 cd09420, LIM3_Prickle, The third LIM domain of Prickle.  The third
           LIM domain of Prickle: Prickle contains three C-terminal
           LIM domains and a N-terminal PET domain.  Prickles have
           been implicated in roles of regulating tissue polarity
           or planar cell polarity (PCP).  PCP establishment
           requires the conserved Frizzled/Dishevelled PCP pathway.
           Prickle interacts with Dishevelled, thereby modulating
           Frizzled/Dishevelled activity and PCP signaling. Two
           forms of prickles have been identified; namely prickle 1
           and prickle 2. Prickle 1 and prickle 2 are
           differentially expressed. While prickle 1 is expressed
           in fetal heart and hematological malignancies, prickle 2
           is found in fetal brain, adult cartilage, pancreatic
           islet, and some types of timorous cells. LIM domains are
           50-60 amino acids in size and share two characteristic
           zinc finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 59

 Score = 26.2 bits (58), Expect = 4.3
 Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 3/38 (7%)

Query: 98  CSLCGEKVYLAQ-RFAFNARLFHRT--CFKCARCQSQL 132
           C  CGE + + Q +  ++ + +H T  CF CA+C+  L
Sbjct: 3   CDTCGEHIGVDQGQMTYDGQHWHATEKCFCCAQCKKSL 40


>gnl|CDD|188853 cd09469, LIM1_Lhx2, The first LIM domain of Lhx2.  The first LIM
           domain of Lhx2: Lhx2 belongs to the LHX protein family,
           which features two tandem N-terminal LIM domains and a
           C-terminal DNA binding homeodomain. Members of LHX
           family are found in the nucleus and act as transcription
           factors or cofactors. LHX proteins are critical for the
           development of specialized cells in multiple tissue
           types, including the nervous system, skeletal muscle,
           the heart, the kidneys, and endocrine organs, such as
           the pituitary gland and the pancreas.  In animals, Lhx2
           plays important roles in eye, cerebral cortex, limb, the
           olfactory organs, and erythrocyte development. Lhx2 gene
           knockout mice exhibit impaired patterning of the
           cortical hem and the telencephalon of the developing
           brain, and a lack of development in olfactory
           structures. The Lhx2 protein has been shown to bind to
           the mouse M71 olfactory receptor promoter. Similar to
           other LIM domains, this domain family is 50-60 amino
           acids in size and share two characteristic zinc finger
           motifs. The two zinc fingers contain eight conserved
           residues, mostly cysteines and histidines, which
           coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein.
          Length = 64

 Score = 26.1 bits (57), Expect = 4.5
 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 8/45 (17%)

Query: 98  CSLCGEKVYLAQRFAFNA--RLFHRTCFKCARC----QSQLTCIN 136
           C+ CG K+  + R+   A  + +H  C KC  C    +S+LTC +
Sbjct: 11  CAGCGGKI--SDRYYLLAVDKQWHMRCLKCCECKLNLESELTCFS 53


>gnl|CDD|173789 cd04059, Peptidases_S8_Protein_convertases_Kexins_Furin-like,
           Peptidase S8 family domain in Protein convertases.
           Protein convertases, whose members include furins and
           kexins, are members of the peptidase S8 or Subtilase
           clan of proteases. They have an Asp/His/Ser catalytic
           triad that is not homologous to trypsin. Kexins are
           involved in the activation of peptide hormones, growth
           factors, and viral proteins.  Furin cleaves cell surface
           vasoactive peptides and proteins involved in
           cardiovascular tissue remodeling in the TGN, at cell
           surface, or in endosomes but rarely in the ER.  Furin
           also plays a key role in blood pressure regulation
           though the activation of transforming growth factor
           (TGF)-beta. High specificity is seen for cleavage after
           dibasic (Lys-Arg or Arg-Arg) or multiple basic residues
           in protein convertases.  There is also strong sequence
           conservation.
          Length = 297

 Score = 28.3 bits (64), Expect = 4.6
 Identities = 12/36 (33%), Positives = 16/36 (44%), Gaps = 1/36 (2%)

Query: 198 STHCDSNLVTA-SVESTNMERNMDNDDLNILNKCTT 232
           S    S L +A S  S N E ++   DL     CT+
Sbjct: 222 SEVGSSVLASAPSGGSGNPEASIVTTDLGGNCNCTS 257


>gnl|CDD|188749 cd09363, LIM3_Enigma_like, The third LIM domain of Enigma-like
           family.  The third LIM domain of Enigma-like family: The
           Enigma LIM domain family is comprised of three members:
           Enigma, ENH, and Cypher (mouse)/ZASP (human). These
           subfamily members contain a single PDZ domain at the
           N-terminus and three LIM domains at the C-terminus.
           Enigma was initially characterized in humans and is
           expressed in multiple tissues, such as skeletal muscle,
           heart, bone, and brain. The third LIM domain
           specifically interacts with the insulin receptor and the
           second LIM domain interacts with the receptor tyrosine
           kinase Ret and the adaptor protein APS.  Thus Enigma is
           implicated in signal transduction processes, such as
           mitogenic activity, insulin related actin organization,
           and glucose metabolism. The second member, ENH protein,
           was first identified in rat brain.  It has been shown
           that ENH interacts with protein kinase D1 (PKD1) via its
           LIM domains and forms a complex with PKD1 and the
           alpha1C subunit of cardiac L-type voltage-gated calcium
           channel in rat neonatal cardiomyocytes. The N-terminal
           PDZ domain interacts with alpha-actinin at the Z-line.
           ZASP/Cypher is required for maintenance of Z-line
           structure during muscle contraction, but not required
           for Z-line assembly. In heart, Cypher/ZASP plays a
           structural role through its interaction with
           cytoskeletal Z-line proteins. In addition, there is
           increasing evidence that Cypher/ZASP also performs
           signaling functions. Studies reveal that Cypher/ZASP
           interacts with and directs PKC to the Z-line, where PKC
           phosphorylates downstream signaling targets. LIM domains
           are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 54

 Score = 25.9 bits (57), Expect = 4.9
 Identities = 13/37 (35%), Positives = 15/37 (40%), Gaps = 3/37 (8%)

Query: 98  CSLCGEKVYLAQRF--AFNARLFHRTCFKCARCQSQL 132
           C  C   +    RF  A     +H TCF CA C   L
Sbjct: 1   CHGCDFPIEAGDRFLEALGHT-WHDTCFVCAVCHVNL 36


>gnl|CDD|188716 cd09330, LIM4_abLIM, The fourth LIM domain of actin binding LIM
           (abLIM) proteins.  The fourth LIM domain of actin
           binding LIM (abLIM) proteins: Three homologous members
           of the abLIM protein family have been identified;
           abLIM-1, abLIM-2 and abLIM-3. The N-terminal of abLIM
           consists of four tandem repeats of LIM domains and the
           C-terminal of acting binding LIM protein is a villin
           headpiece domain, which has strong actin binding
           activity. The abLIM-1, which is expressed in retina,
           brain, and muscle tissue, has been indicated to function
           as a tumor suppressor. AbLIM-2 and -3, mainly expressed
           in muscle and neuronal tissue, bind to F-actin strongly.
            They may serve as a scaffold for signaling modules of
           the actin cytoskeleton and thereby modulate
           transcription. It has shown that LIM domains of abLIMs
           interact with STARS (striated muscle activator of Rho
           signaling), which directly binds actin and stimulates
           serum-response factor (SRF)-dependent transcription. All
           LIM domains are 50-60 amino acids in size and share two
           characteristic highly conserved zinc finger motifs. The
           two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 56

 Score = 25.8 bits (57), Expect = 5.3
 Identities = 6/16 (37%), Positives = 9/16 (56%)

Query: 118 FHRTCFKCARCQSQLT 133
           +H TC +C+RC     
Sbjct: 20  YHPTCARCSRCGQMFG 35


>gnl|CDD|188754 cd09368, LIM1_Lhx3_Lhx4, The first LIM domain of Lhx3 and Lhx4
           family.  The first LIM domain of Lhx3-Lhx4 family: Lhx3
           and Lhx4 belong to the LHX protein family, which
           features two tandem N-terminal LIM domains and a
           C-terminal DNA binding homeodomain. Members of LHX
           family are found in the nucleus and act as transcription
           factors or cofactors. LHX proteins are critical for the
           development of specialized cells in multiple tissue
           types, including the nervous system, skeletal muscle,
           the heart, the kidneys, and endocrine organs, such as
           the pituitary gland and the pancreas. The LHX3 and LHX4
           LIM-homeodomain transcription factors play essential
           roles in pituitary gland and nervous system development.
           Although LHX3 and LHX4 share marked sequence homology,
           the genes have different expression patterns. They play
           overlapping, but distinct functions during the
           establishment of the specialized cells of the mammalian
           pituitary gland and the nervous system. Lhx3 proteins
           have been demonstrated the ability to directly bind to
           the promoters/enhancers of several pituitary hormone
           gene promoters to cause increased transcription. Lhx3a
           and Lhx3b, whose mRNAs have distinct temporal expression
           profiles during development, are two isoforms of Lhx3.
           LHX4 plays essential roles in pituitary gland and
           nervous system development. In mice, the lhx4 gene is
           expressed in the developing hindbrain, cerebral cortex,
           pituitary gland, and spinal cord. LHX4 shows significant
           sequence similarity to LHX3, particularly to isoforms
           Lhx3a. In gene regulation experiments, the LHX4 protein
           exhibits regulation roles towards pituitary genes,
           acting on their promoters/enhancers. As in other LIM
           domains, this domain family is 50-60 amino acids in size
           and shares two characteristic zinc finger motifs. The
           two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein.
          Length = 52

 Score = 25.5 bits (56), Expect = 5.5
 Identities = 14/38 (36%), Positives = 17/38 (44%), Gaps = 4/38 (10%)

Query: 98  CSLCGEKVYLAQRFAFNA--RLFHRTCFKCARCQSQLT 133
           C  C E +    RF      R +H  C KC  C +QLT
Sbjct: 1   CGGCQEHIL--DRFILKVLDRTWHAKCLKCNDCGAQLT 36


>gnl|CDD|223410 COG0333, RpmF, Ribosomal protein L32 [Translation, ribosomal
           structure and biogenesis].
          Length = 57

 Score = 25.7 bits (57), Expect = 5.6
 Identities = 19/62 (30%), Positives = 24/62 (38%), Gaps = 18/62 (29%)

Query: 64  VPQKTTSPAHREPGAPRAPSQPPSTLPGSLKLNSCSLCGEKVYLAQRFAFNARLFHRTCF 123
           VP++ TS + R     R  S      P    L+ C  CGE            +L HR C 
Sbjct: 3   VPKRKTSKSRR--RMRR--SHDALKAPT---LSVCPNCGEY-----------KLPHRVCL 44

Query: 124 KC 125
           KC
Sbjct: 45  KC 46


>gnl|CDD|188777 cd09391, LIM1_Lrg1p_like, The first LIM domain of Lrg1p, a LIM and
           RhoGap domain containing protein.  The first LIM domain
           of Lrg1p, a LIM and RhoGap domain containing protein:
           The members of this family contain three tandem repeats
           of LIM domains and a Rho-type GTPase activating protein
           (RhoGap) domain. Lrg1p is a Rho1 GTPase-activating
           protein required for efficient cell fusion in yeast.
           Lrg1p-GAP domain strongly and specifically stimulates
           the GTPase activity of Rho1p, a regulator of beta
           (1-3)-glucan synthase in vitro. The LIM domain is 50-60
           amino acids in size and shares two characteristic zinc
           finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein.
          Length = 57

 Score = 25.7 bits (57), Expect = 6.4
 Identities = 10/37 (27%), Positives = 17/37 (45%), Gaps = 5/37 (13%)

Query: 98  CSLCGEKVYLAQRF--AFNARLFHRTCFKCARCQSQL 132
           C+ CG+ +    +F  A    ++H  CF C  C   +
Sbjct: 1   CAKCGKPI--TGQFVRALG-DVYHLDCFTCHDCGKPV 34


>gnl|CDD|188763 cd09377, LIM2_Lhx2_Lhx9, The second LIM domain of Lhx2 and Lhx9
           family.  The second LIM domain of Lhx2 and Lhx9 family:
           Lhx2 and Lhx9 are highly homologous LHX regulatory
           proteins. They belong to the LHX protein family, which
           features two tandem N-terminal LIM domains and a
           C-terminal DNA binding homeodomain. Members of LHX
           family are found in the nucleus and act as transcription
           factors or cofactors. LHX proteins are critical for the
           development of specialized cells in multiple tissue
           types, including the nervous system, skeletal muscle,
           the heart, the kidneys, and endocrine organs, such as
           the pituitary gland and the pancreas.  Although Lhx2 and
           Lhx9 are highly homologous, they seems to play
           regulatory roles in different organs.  In animals, Lhx2
           plays important roles in eye, cerebral cortex, limb, the
           olfactory organs, and erythrocyte development. Lhx2 gene
           knockout mice exhibit impaired patterning of the
           cortical hem and the telencephalon of the developing
           brain, and a lack of development in olfactory
           structures. Lhx9 is expressed in several regions of the
           developing mouse brain, the spinal cord, the pancreas,
           in limb mesenchyme, and in the urogenital region. Lhx9
           plays critical roles in gonad development.  Homozygous
           mice lacking functional Lhx9 alleles exhibit numerous
           urogenital defects, such as gonadal agenesis,
           infertility, and undetectable levels of testosterone and
           estradiol coupled with high FSH levels. Lhx9 null mice
           are phenotypically female, even those that are
           genotypically male. As in other LIM domains, this domain
           family is 50-60 amino acids in size and shares two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein.
          Length = 59

 Score = 25.7 bits (57), Expect = 6.7
 Identities = 9/16 (56%), Positives = 9/16 (56%)

Query: 118 FHRTCFKCARCQSQLT 133
           FH  CF CA C   LT
Sbjct: 26  FHLNCFTCATCNKPLT 41


>gnl|CDD|188794 cd09410, LIM3_Leupaxin, The third LIM domain of Leupaxin.  The
           third LIM domain of Leupaxin: Leupaxin is a cytoskeleton
           adaptor protein, which is preferentially expressed in
           hematopoietic cells. Leupaxin belongs to the paxillin
           focal adhesion protein family. Same as other members of
           the family, it has four leucine-rich LD-motifs in the
           N-terminus and four LIM domains in the C-terminus. It
           may function in cell type-specific signaling by
           associating with interaction partners PYK2, FAK, PEP and
           p95PKL.  When expressed in human leukocytic cells,
           leupaxin significantly suppressed integrin-mediated cell
           adhesion to fibronectin and the tyrosine phosphorylation
           of paxillin. These findings indicate that leupaxin may
           negatively regulate the functions of paxillin during
           integrin signaling. LIM domains are 50-60 amino acids in
           size and share two characteristic zinc finger motifs.
           The two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 53

 Score = 25.6 bits (56), Expect = 7.0
 Identities = 15/49 (30%), Positives = 20/49 (40%), Gaps = 1/49 (2%)

Query: 98  CSLCGEKVYLAQRFAFNARLFHRTCFKCARCQSQLTCINAYETHTGQFC 146
           CS CG  V      A N  ++H  CF C+ C    T  + +E      C
Sbjct: 1   CSGCGRPVKENYLSAANG-VWHPECFVCSDCLKPFTDGSFFELDGRPLC 48


>gnl|CDD|188782 cd09396, LIM_DA1, The Lim domain of DA1.  The Lim domain of DA1:
           DA1 contains one copy of LIM domain and a domain of
           unknown function. DA1 is predicted as an ubiquitin
           receptor, which sets final seed and organ size by
           restricting the period of cell proliferation. The LIM
           domain is 50-60 amino acids in size and shares two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein.
          Length = 53

 Score = 25.3 bits (56), Expect = 7.1
 Identities = 5/13 (38%), Positives = 8/13 (61%)

Query: 116 RLFHRTCFKCARC 128
            ++H  CF+C  C
Sbjct: 19  AVWHPECFRCHAC 31


>gnl|CDD|188769 cd09383, LIM2_Lhx7_Lhx8, The second LIM domain of Lhx7 and Lhx8.
           The second LIM domain of Lhx7 and Lhx8:  Lhx7 and Lhx8
           belong to the LHX protein family, which features two
           tandem N-terminal LIM domains and a C-terminal DNA
           binding homeodomain. Members of LHX family are found in
           the nucleus and act as transcription factors or
           cofactors. LHX proteins are critical for the development
           of specialized cells in multiple tissue types, including
           the nervous system, skeletal muscle, the heart, the
           kidneys, and endocrine organs such as the pituitary
           gland and the pancreas.  Studies using mutant mice have
           revealed roles for Lhx7 and Lhx8 in the development of
           cholinergic neurons in the telencephalon and in basal
           forebrain development. Mice lacking alleles of the
           LIM-homeobox gene Lhx7 or Lhx8 display dramatically
           reduced number of forebrain cholinergic neurons. In
           addition, Lhx7 mutation affects male and female mice
           differently, with females appearing more affected than
           males. As in other LIM domains, this domain family is
           50-60 amino acids in size and shares two characteristic
           zinc finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein.
          Length = 55

 Score = 25.4 bits (55), Expect = 7.3
 Identities = 13/38 (34%), Positives = 19/38 (50%), Gaps = 3/38 (7%)

Query: 98  CSLCGEKVYLAQ--RFAFNARLFHRTCFKCARCQSQLT 133
           CS CG  ++     R A    ++H  CF C  C+ QL+
Sbjct: 1   CSRCGRHIHSTDWVRRA-KGNVYHLACFACFSCKRQLS 37


>gnl|CDD|188811 cd09427, LIM2_FHL3, The second LIM domain of Four and a half LIM
           domains protein 3 (FHL3).  The second LIM domain of Four
           and a half LIM domains protein 3 (FHL3):  FHL3 is highly
           expressed in the skeleton and cardiac muscles and
           possesses the transactivation and repression activities.
           FHL3 interacts with many transcription factors, such as
           CREB, BKLF/KLF3, CtBP2, MyoD, and MZF_1. Moreover, FHL3
           interacts with alpha- and beta-subunits of the muscle
           alpha7beta1 integrin receptor. FHL3 was also proved to
           possess the auto-activation ability and was confirmed
           that the second zinc finger motif in fourth LIM domain
           was responsible for the auto-activation of FHL3. LIM
           domains are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 58

 Score = 25.2 bits (55), Expect = 7.7
 Identities = 10/33 (30%), Positives = 15/33 (45%), Gaps = 1/33 (3%)

Query: 98  CSLCGEKVYLAQR-FAFNARLFHRTCFKCARCQ 129
           C  CG+ V    R   +  + +H  CF C  C+
Sbjct: 4   CVACGKTVMPGSRKLEYEGQTWHEHCFICHGCE 36


>gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional.
          Length = 991

 Score = 27.7 bits (61), Expect = 7.9
 Identities = 14/40 (35%), Positives = 20/40 (50%), Gaps = 1/40 (2%)

Query: 65  PQKTTSPAHREPGAPRAPSQPPSTLPGSLKLNSCSLCGEK 104
           PQ   +P  R  GAP  P  PP   P S++L   +  G++
Sbjct: 780 PQAPPAPQQRPRGAP-TPQPPPQAGPTSMQLMPRAAPGQQ 818


>gnl|CDD|188762 cd09376, LIM2_Lhx3_Lhx4, The second LIM domain of Lhx3-Lhx4 family.
            The second LIM domain of Lhx3-Lhx4 family: Lhx3 and
           Lhx4 belong to the LHX protein family, which features
           two tandem N-terminal LIM domains and a C-terminal DNA
           binding homeodomain. Members of LHX family are found in
           the nucleus and act as transcription factors or
           cofactors. LHX proteins are critical for the development
           of specialized cells in multiple tissue types, including
           the nervous system, skeletal muscle, the heart, the
           kidneys, and endocrine organs, such as the pituitary
           gland and the pancreas. The LHX3 and LHX4
           LIM-homeodomain transcription factors play essential
           roles in pituitary gland and nervous system development.
           Although LHX3 and LHX4 share marked sequence homology,
           the genes have different expression patterns. They play
           overlapping, but distinct functions during the
           establishment of the specialized cells of the mammalian
           pituitary gland and the nervous system. Lhx3 proteins
           have been demonstrated the ability to directly bind to
           the promoters/enhancers of several pituitary hormone
           gene promoters to cause increased transcription.Lhx3a
           and Lhx3b, whose mRNAs have distinct temporal expression
           profiles during development, are two isoforms of Lhx3.
           LHX4 plays essential roles in pituitary gland and
           nervous system development. In mice, the lhx4 gene is
           expressed in the developing hindbrain, cerebral cortex,
           pituitary gland, and spinal cord. LHX4 shows significant
           sequence similarity to LHX3, particularly to isoforms
           Lhx3a. In gene regulation experiments, the LHX4 protein
           exhibits regulation roles towards pituitary genes,
           acting on their promoters/enhancers. As in other LIM
           domains, this domain family is 50-60 amino acids in size
           and shares two characteristic zinc finger motifs. The
           two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein.
          Length = 56

 Score = 25.4 bits (56), Expect = 8.0
 Identities = 13/37 (35%), Positives = 18/37 (48%), Gaps = 3/37 (8%)

Query: 98  CSLCGEKVYLAQ--RFAFNARLFHRTCFKCARCQSQL 132
           C+ C E +   Q  R A    ++H  CF C  C+ QL
Sbjct: 1   CAGCDEGIPPTQVVRRA-QDNVYHLECFACFMCKRQL 36


>gnl|CDD|188127 TIGR01284, alt_nitrog_alph, nitrogenase alpha chain.  This model
           represents the alpha chains of various forms of the
           nitrogen-fixing enzyme nitrogenase: vanadium-iron,
           iron-iron, and molybdenum-iron. Most examples of NifD,
           the molybdenum-iron type nitrogenase alpha chain, are
           excluded from this model and described instead by
           equivalog model TIGR01282. It appears by phylogenetic
           and UPGMA trees that this model represents a distinct
           clade of NifD homologs, in which arose several
           molybdenum-independent forms [Central intermediary
           metabolism, Nitrogen fixation].
          Length = 457

 Score = 27.5 bits (61), Expect = 9.1
 Identities = 11/45 (24%), Positives = 21/45 (46%), Gaps = 3/45 (6%)

Query: 63  DVPQKTTSPAHREPGAPRAPSQP---PSTLPGSLKLNSCSLCGEK 104
           ++P++      ++ G P     P    +T+PG +    C+ CG K
Sbjct: 8   EIPERKKHIYVKKQGEPEGDFLPACNTTTIPGCMSERGCAFCGAK 52


>gnl|CDD|223915 COG0846, SIR2, NAD-dependent protein deacetylases, SIR2 family
           [Transcription].
          Length = 250

 Score = 27.2 bits (61), Expect = 9.1
 Identities = 13/35 (37%), Positives = 14/35 (40%)

Query: 91  GSLKLNSCSLCGEKVYLAQRFAFNARLFHRTCFKC 125
           GSLK   CS CG + Y      F        C KC
Sbjct: 118 GSLKRVRCSKCGNQYYDEDVIKFIEDGLIPRCPKC 152


>gnl|CDD|117486 pfam08919, F_actin_bind, F-actin binding.  The F-actin binding
          domain forms a compact bundle of four antiparallel
          alpha-helices, which are arranged in a left-handed
          topology. Binding of F-actin to the F-actin binding
          domain may result in cytoplasmic retention and
          subcellular distribution of the protein, as well as
          possible inhibition of protein function.
          Length = 179

 Score = 27.0 bits (59), Expect = 9.2
 Identities = 14/37 (37%), Positives = 16/37 (43%), Gaps = 4/37 (10%)

Query: 59 LPGVDVPQKTTSPAHREPGAPRAPSQPPSTLPGSLKL 95
           P V  PQ T  P     G P +P   PST P   K+
Sbjct: 8  PPAVPKPQSTAKP----VGTPPSPVPLPSTSPSPSKM 40


>gnl|CDD|188779 cd09393, LIM3_Lrg1p_like, The third LIM domain of Lrg1p, a LIM and
           RhoGap domain containing protein.  The third LIM domain
           of Lrg1p, a LIM and RhoGap domain containing protein:
           The members of this family contain three tandem repeats
           of LIM domains and a Rho-type GTPase activating protein
           (RhoGap) domain. Lrg1p is a Rho1 GTPase-activating
           protein required for efficient cell fusion in yeast.
           Lrg1p-GAP domain strongly and specifically stimulates
           the GTPase activity of Rho1p, a regulator of beta
           (1-3)-glucan synthase in vitro. The LIM domain is 50-60
           amino acids in size and shares two characteristic zinc
           finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein.
          Length = 56

 Score = 25.0 bits (55), Expect = 9.2
 Identities = 7/17 (41%), Positives = 10/17 (58%)

Query: 113 FNARLFHRTCFKCARCQ 129
           F  + +H  CF C+RC 
Sbjct: 15  FEDKRWHLKCFTCSRCH 31


>gnl|CDD|188767 cd09381, LIM1_Lhx7_Lhx8, The first LIM domain of Lhx7 and Lhx8.
           The first LIM domain of Lhx7 and Lhx8:  Lhx7 and Lhx8
           belong to the LHX protein family, which features two
           tandem N-terminal LIM domains and a C-terminal DNA
           binding homeodomain. Members of LHX family are found in
           the nucleus and act as transcription factors or
           cofactors. LHX proteins are critical for the development
           of specialized cells in multiple tissue types, including
           the nervous system, skeletal muscle, the heart, the
           kidneys, and endocrine organs such as the pituitary
           gland and the pancreas.  Studies using mutant mice have
           revealed roles for Lhx7 and Lhx8 in the development of
           cholinergic neurons in the telencephalon and in basal
           forebrain development. Mice lacking alleles of the
           LIM-homeobox gene Lhx7 or Lhx8 display dramatically
           reduced number of forebrain cholinergic neurons. In
           addition, Lhx7 mutation affects male and female mice
           differently, with females appearing more affected than
           males. As in other LIM domains, this domain family is
           50-60 amino acids in size and shares two characteristic
           zinc finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein.
          Length = 56

 Score = 24.9 bits (54), Expect = 9.6
 Identities = 10/35 (28%), Positives = 16/35 (45%)

Query: 98  CSLCGEKVYLAQRFAFNARLFHRTCFKCARCQSQL 132
           CS CG ++        N   +H  C  C+ C++ L
Sbjct: 2   CSSCGLEIVDKYLLKVNDLCWHVRCLSCSVCRTSL 36


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.316    0.132    0.404 

Gapped
Lambda     K      H
   0.267   0.0698    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 13,154,709
Number of extensions: 1149158
Number of successful extensions: 1272
Number of sequences better than 10.0: 1
Number of HSP's gapped: 1269
Number of HSP's successfully gapped: 117
Length of query: 271
Length of database: 10,937,602
Length adjustment: 95
Effective length of query: 176
Effective length of database: 6,723,972
Effective search space: 1183419072
Effective search space used: 1183419072
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 58 (26.2 bits)