Query         psy11695
Match_columns 190
No_of_seqs    128 out of 1059
Neff          9.1 
Searched_HMMs 46136
Date          Fri Aug 16 16:31:28 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy11695.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/11695hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3646|consensus              100.0 5.5E-34 1.2E-38  231.8  10.6  180    1-189   306-486 (486)
  2 PF02932 Neur_chan_memb:  Neuro  99.9 6.3E-26 1.4E-30  172.4   0.8  172    1-181    66-237 (237)
  3 TIGR00860 LIC Cation transport  99.9   5E-23 1.1E-27  174.5   6.8  147    1-182   311-457 (459)
  4 KOG3645|consensus               99.7 7.7E-18 1.7E-22  142.5   7.0  137    1-170   311-448 (449)
  5 PRK13743 conjugal transfer pro  76.0     9.9 0.00021   26.7   5.2   37  144-181    20-56  (141)
  6 KOG2678|consensus               74.7      14 0.00031   28.5   6.2   43  131-182   196-238 (244)
  7 PRK14762 membrane protein; Pro  72.5     5.1 0.00011   19.6   2.2   19  163-181     2-20  (27)
  8 PF14202 TnpW:  Transposon-enco  57.8      14  0.0003   20.0   2.4   28    9-36      8-35  (37)
  9 PF11616 EZH2_WD-Binding:  WD r  54.8      16 0.00035   18.7   2.2   21  136-156     4-24  (30)
 10 PF15586 Imm47:  Immunity prote  51.3      17 0.00036   25.2   2.6   35  127-169    78-112 (116)
 11 PF06939 DUF1286:  Protein of u  48.3      16 0.00034   25.1   2.0   25   18-42     59-83  (114)
 12 PF11395 DUF2873:  Protein of u  43.1      45 0.00098   18.0   2.9   19  164-182    11-29  (43)
 13 cd00928 Cyt_c_Oxidase_VIIa Cyt  43.1      40 0.00086   20.1   3.0   23  160-182    26-48  (55)
 14 PF03904 DUF334:  Domain of unk  42.2      72  0.0016   24.8   5.0   14  166-179   158-171 (230)
 15 PF11628 TCR_zetazeta:  T-cell   40.3      58  0.0013   17.1   3.0   16  157-173     4-19  (33)
 16 PF06992 Phage_lambda_P:  Repli  38.6      32  0.0007   26.9   2.7   38  132-172    14-51  (233)
 17 KOG0002|consensus               38.5      19 0.00042   20.5   1.1    9   25-33     18-26  (48)
 18 PF05624 LSR:  Lipolysis stimul  37.8     8.7 0.00019   21.8  -0.4   10  153-162     1-10  (49)
 19 PRK03692 putative UDP-N-acetyl  37.7      20 0.00044   28.2   1.5   28   17-44    193-220 (243)
 20 PF11057 Cortexin:  Cortexin of  35.9      53  0.0011   20.8   2.8   20  164-183    35-54  (81)
 21 KOG4647|consensus               33.1      81  0.0018   24.6   4.0   27  155-181    97-123 (263)
 22 PF08253 Leader_Erm:  Erm Leade  31.0      54  0.0012   14.8   1.7   14    9-22      3-16  (19)
 23 PRK13682 hypothetical protein;  30.3 1.2E+02  0.0026   17.7   3.7   21  158-178    27-47  (51)
 24 PF08372 PRT_C:  Plant phosphor  29.9 1.8E+02  0.0039   21.3   5.3   49  127-181    64-112 (156)
 25 PF14372 DUF4413:  Domain of un  28.7      93   0.002   20.7   3.4   19  145-163    45-63  (101)
 26 PF10290 DUF2403:  Glycine-rich  28.4      29 0.00063   21.4   0.8   10   15-24     46-55  (65)
 27 PF03993 DUF349:  Domain of Unk  28.3      27 0.00058   21.6   0.7   32  129-160    38-72  (77)
 28 PF11815 DUF3336:  Domain of un  28.3      92   0.002   22.3   3.5   27  139-165    14-40  (145)
 29 KOG2082|consensus               27.8      95  0.0021   29.0   4.1   33  154-186   566-598 (1075)
 30 COG4858 Uncharacterized membra  26.3 1.6E+02  0.0035   22.4   4.5   27  146-172   154-180 (226)
 31 PF14829 GPAT_N:  Glycerol-3-ph  26.2      58  0.0013   20.7   1.8   12  156-167    61-72  (77)
 32 PF03908 Sec20:  Sec20;  InterP  26.1 1.3E+02  0.0028   19.5   3.7   21  160-180    67-87  (92)
 33 PF08414 NADPH_Ox:  Respiratory  24.4 1.9E+02  0.0041   19.5   4.2   31  127-164     9-39  (100)
 34 PF06796 NapE:  Periplasmic nit  23.4 1.8E+02  0.0038   17.4   4.0   11  146-156    10-20  (56)
 35 PF00832 Ribosomal_L39:  Riboso  22.8      36 0.00079   19.1   0.4    9   24-32     12-20  (43)
 36 PF12732 YtxH:  YtxH-like prote  22.4      90   0.002   19.4   2.3   21  165-185     1-21  (74)
 37 PF08788 NHR2:  NHR2 domain lik  22.2 1.1E+02  0.0024   18.7   2.5   19  146-164    10-28  (67)
 38 TIGR02972 TMAO_torE trimethyla  21.5 1.8E+02  0.0038   16.7   4.0   29  147-177     3-31  (47)
 39 PF05484 LRV_FeS:  LRV protein   21.5      77  0.0017   19.0   1.7    9  158-166    40-48  (57)
 40 PRK13677 hypothetical protein;  21.4 2.3E+02  0.0049   19.8   4.1   40  123-162    72-112 (125)
 41 PF03530 SK_channel:  Calcium-a  21.3 1.3E+02  0.0029   20.9   3.1   22  146-168    78-99  (119)
 42 KOG3670|consensus               20.7      32 0.00068   29.1  -0.1   29  128-157   160-188 (397)
 43 COG4537 ComGC Competence prote  20.4 1.2E+02  0.0026   20.5   2.5   24  166-189    16-39  (107)
 44 PF07043 DUF1328:  Protein of u  20.3 1.6E+02  0.0036   16.1   2.7   17  158-174    22-38  (39)

No 1  
>KOG3646|consensus
Probab=100.00  E-value=5.5e-34  Score=231.84  Aligned_cols=180  Identities=44%  Similarity=0.688  Sum_probs=113.7

Q ss_pred             CeEeeehhheeeeEEeeecCCCCCCCCCHHHHHHHhhhcccccccCCCCCCCccchhHHhhhhhhhhhhhhhhccchhhh
Q psy11695          1 MFMVASSVVSTILILNYHHRNADTHEMSPWIRLVFLQWMPCILRMSRPSEEDKTSLTEATRKALKLKELELKERSSKSLL   80 (190)
Q Consensus         1 MvlVtlSiv~TV~VlN~hhr~p~~~~mp~WvR~l~L~~lp~lL~m~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (190)
                      |++|++|+++||+|||+|||+|.+|.|++|+|++||+|+|++|+|+||......... ..++...  ... .....+...
T Consensus       306 m~iv~~SvvfTv~vLn~h~R~p~~h~m~p~~r~vfL~wlpwll~M~rP~~~~~~~~~-~~~~~~~--~~~-~~~~~~~~~  381 (486)
T KOG3646|consen  306 MFIVAASVVFTVIVLNLHHRTPETHEMSPWTRSVFLEWLPWLLRMKRPFILRRTHPS-LRMKELD--RKL-KRGEHKSAE  381 (486)
T ss_pred             HHHHHhhheeEEEEEeeeccCccccccCHHHHHHHHHHHHHHHHhcCCCccccCCch-hhhhhhh--hhc-ccccccchh
Confidence            688999999999999999999999999999999999999999999999332221110 0111110  000 000000001


Q ss_pred             cccCCCCCcccCCCCCCCCCcccccCCCCCCccccC-ccCCCCCcHHHHHHHHHHHHHHHHhhhhhHHhhchhhHHHHHH
Q psy11695         81 ANVLDIDDDFRHNTLQSSSHTFLRHDDSGGGTILHA-TTSCIGPHRELTLILKELRVITDKIQKEDEAAEITNDWKFAAM  159 (190)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~l~~i~~~l~~I~~~~~~~~~~~~~~~eWk~vA~  159 (190)
                      .++.+..+.........  . ..+..........+. .........++..+.+.++.+.++++++++++++++||||+||
T Consensus       382 ~~~~~~~~~~~~~~~~~--~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~r~~~~~~~~~~~~dWkFAAm  458 (486)
T KOG3646|consen  382 ANGLDGFDLFNQRVSQS--L-TPRGRTASLPVISEHVSTATQFILKELHLILKELRAILDRMEEDDKEEALQSDWKFAAM  458 (486)
T ss_pred             hhccccccCCCccccCC--C-CCcccccCCcccchhhhhHHHHHHHHHHHHHHHHHHHHHHhhhhhHHHHHHhhhhHHHH
Confidence            11111111111000000  0 000000000000000 0000112346788999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhcCCcccc
Q psy11695        160 VVDRMCLIIFTLFTILATVAVLCSAPHIIV  189 (190)
Q Consensus       160 VlDRl~l~if~l~~~~~t~~i~~~~p~~~~  189 (190)
                      |+||+||++|+++++++  +|++.+|++++
T Consensus       459 vVDRlCL~~Fs~fiii~--~i~~~~p~l~~  486 (486)
T KOG3646|consen  459 VVDRLCLLAFSVFIVMC--GILLSAPHLVA  486 (486)
T ss_pred             HHHHHHHHHHHHHHHHH--HHhhcCCccCC
Confidence            99999999999999998  88999999874


No 2  
>PF02932 Neur_chan_memb:  Neurotransmitter-gated ion-channel transmembrane region ion channel family signature gamma-aminobutyric acid (GABA) receptor signature nicotinic acetylcholine receptor signature;  InterPro: IPR006029 Neurotransmitter ligand-gated ion channels are transmembrane receptor-ion channel complexes that open transiently upon binding of specific ligands, allowing rapid transmission of signals at chemical synapses [, ]. Five of these ion channel receptor families have been shown to form a sequence-related superfamily:   Nicotinic acetylcholine receptor (AchR), an excitatory cation channel in vertebrates and invertebrates; in vertebrate motor endplates it is composed of alpha, beta, gamma and delta/epsilon subunits; in neurons it is composed of alpha and non-alpha (or beta) subunits []. Glycine receptor, an inhibitory chloride ion channel composed of alpha and beta subunits []. Gamma-aminobutyric acid (GABA) receptor, an inhibitory chloride ion channel; at least four types of subunits (alpha, beta, gamma and delta) are known []. Serotonin 5HT3 receptor, of which there are seven major types (5HT3-5HT7) []. Glutamate receptor, an excitatory cation channel of which at least three types have been described (kainate, N-methyl-D-aspartate (NMDA) and quisqualate) [].   These receptors possess a pentameric structure (made up of varying subunits), surrounding a central pore. All known sequences of subunits from neurotransmitter-gated ion-channels are structurally related. They are composed of a large extracellular glycosylated N-terminal ligand-binding domain, followed by three hydrophobic transmembrane regions which form the ionic channel, followed by an intracellular region of variable length. A fourth hydrophobic region is found at the C-terminal of the sequence [, ]. This domain represents four transmembrane helices of a variety of neurotransmitter-gated ion-channels.; GO: 0006811 ion transport, 0016020 membrane; PDB: 1DXZ_A 3MRA_A 1EQ8_C 1OED_C 2PR9_P 1A11_A 1CEK_A 2BG9_E 2KSR_A 2K59_B ....
Probab=99.91  E-value=6.3e-26  Score=172.44  Aligned_cols=172  Identities=28%  Similarity=0.470  Sum_probs=75.0

Q ss_pred             CeEeeehhheeeeEEeeecCCCCCCCCCHHHHHHHhhhcccccccCCCCCCCccchhHHhhhhhhhhhhhhhhccchhhh
Q psy11695          1 MFMVASSVVSTILILNYHHRNADTHEMSPWIRLVFLQWMPCILRMSRPSEEDKTSLTEATRKALKLKELELKERSSKSLL   80 (190)
Q Consensus         1 MvlVtlSiv~TV~VlN~hhr~p~~~~mp~WvR~l~L~~lp~lL~m~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (190)
                      |+++++++..||+++|+|||++.+++||+|+|+++++++|+++||++|....................   . ... ...
T Consensus        66 ~~v~~~~~~~avv~~~~~~~~~~~~~~~~~~r~~~l~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~---~-~~~-~~~  140 (237)
T PF02932_consen   66 MFVFSASLEFAVVVYNIHHRGPRTRPMPPWVRRLFLEKLARLLCMKRPSEKERKPASSQESRSRSSSS---S-RKE-SET  140 (237)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHSTTT-S------------------------------------------------------
T ss_pred             chhhhHHHHhhhhhhhhcccccccccccchhHHHHhhhhhhhhhhccccccccccccccccccccccc---c-ccc-ccc
Confidence            45678899999999999999999999999999999999999999998865432211100000000000   0 000 000


Q ss_pred             cccCCCCCcccCCCCCCCCCcccccCCCCCCccccCccCCCCCcHHHHHHHHHHHHHHHHhhhhhHHhhchhhHHHHHHH
Q psy11695         81 ANVLDIDDDFRHNTLQSSSHTFLRHDDSGGGTILHATTSCIGPHRELTLILKELRVITDKIQKEDEAAEITNDWKFAAMV  160 (190)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~~l~~I~~~~~~~~~~~~~~~eWk~vA~V  160 (190)
                      .+..  .....+................. .. ...........+.++++.+++++|++|+++++++++.++||+++|+|
T Consensus       141 ~~~~--~~~~~~~~~~~~~~~~~~~~~~~-~~-~~~~~~~~~~~~~l~~~~~~~~~i~~~~~~~~~~~~~~~ew~~~A~v  216 (237)
T PF02932_consen  141 DKDP--SQSQSSSNSSSSSQNSPNSRSSS-SS-SSNSSSEQSLSPSLRRILEGVRFIAEHLREQDEEEEIKEEWKFVAMV  216 (237)
T ss_dssp             -----------------------------------SS---TTGGG----HHHHHHHHHHHHHHHHHHHHHHHHHHSTSHH
T ss_pred             cccc--ccccccccccccccccccccccc-cc-cccccccccccHHHhhhhcccceeecccccccccccccccccccHHH
Confidence            0000  00000000000000000000000 00 00000112234578899999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHh
Q psy11695        161 VDRMCLIIFTLFTILATVAVL  181 (190)
Q Consensus       161 lDRl~l~if~l~~~~~t~~i~  181 (190)
                      +||+|+|+|.+++++++++++
T Consensus       217 iDR~~~~~F~i~f~~~~i~yw  237 (237)
T PF02932_consen  217 IDRLFRILFPIAFILFNIVYW  237 (237)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHhhhC
Confidence            999999999999999999874


No 3  
>TIGR00860 LIC Cation transporter family protein. selective while glycine receptors are anion selective).
Probab=99.88  E-value=5e-23  Score=174.53  Aligned_cols=147  Identities=22%  Similarity=0.310  Sum_probs=101.1

Q ss_pred             CeEeeehhheeeeEEeeecCCCCCCCCCHHHHHHHhhhcccccccCCCCCCCccchhHHhhhhhhhhhhhhhhccchhhh
Q psy11695          1 MFMVASSVVSTILILNYHHRNADTHEMSPWIRLVFLQWMPCILRMSRPSEEDKTSLTEATRKALKLKELELKERSSKSLL   80 (190)
Q Consensus         1 MvlVtlSiv~TV~VlN~hhr~p~~~~mp~WvR~l~L~~lp~lL~m~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (190)
                      |++|++|++.|++|+|+|||+|.+|+     |++||+++|+++||++|..+.....   ..... ....+.   .     
T Consensus       311 ~~~v~~sli~tv~V~~~~~~~~~~~~-----r~~~l~~l~~~l~~~~~~~~~~~~~---~~~~~-~~~~~~---~-----  373 (459)
T TIGR00860       311 MAFVFLALLETAFVNYVHHKDPAQGK-----RHLLLERCAWRLCKQEPGEDYRRPA---LDHAS-LSSVEM---R-----  373 (459)
T ss_pred             HHHHHHHHHHHHhheeEEccCCCCCc-----eehHHhhchHHhcccCccccccccc---ccccc-cchhcc---c-----
Confidence            57899999999999999999999987     9999999999999999875322100   00000 000000   0     


Q ss_pred             cccCCCCCcccCCCCCCCCCcccccCCCCCCccccCccCCCCCcHHHHHHHHHHHHHHHHhhhhhHHhhchhhHHHHHHH
Q psy11695         81 ANVLDIDDDFRHNTLQSSSHTFLRHDDSGGGTILHATTSCIGPHRELTLILKELRVITDKIQKEDEAAEITNDWKFAAMV  160 (190)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~~l~~I~~~~~~~~~~~~~~~eWk~vA~V  160 (190)
                       .      ..+..  ...   ...........     .......++++++.+++++| +|+++++++++.++|||++|+|
T Consensus       374 -~------~~~~~--~~~---~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~i-~~~~~~~~~~~~~~~W~~~a~v  435 (459)
T TIGR00860       374 -A------KDGGR--GLE---SPTERQRLLHS-----PPPAEGDLDLAGILEEVRIA-HRFRKRDESEEVVRDWKFRAKV  435 (459)
T ss_pred             -c------ccccc--ccC---CcccccccCCC-----CCccccCHHHHHHHhhhhHH-HHHHhhhhhhcccchhhhccch
Confidence             0      00000  000   00000000000     00011346899999999999 9999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHhh
Q psy11695        161 VDRMCLIIFTLFTILATVAVLC  182 (190)
Q Consensus       161 lDRl~l~if~l~~~~~t~~i~~  182 (190)
                      +||+|||+|.++++++|+++++
T Consensus       436 iDr~~~~~f~~~~~~~~~~~~~  457 (459)
T TIGR00860       436 IDKLSRMAFPLAFLLFNIGYWM  457 (459)
T ss_pred             hhHHHHHHHHHHHHHhhhhheE
Confidence            9999999999999999999885


No 4  
>KOG3645|consensus
Probab=99.72  E-value=7.7e-18  Score=142.54  Aligned_cols=137  Identities=36%  Similarity=0.623  Sum_probs=94.9

Q ss_pred             CeEeeehhheeeeEEeeecCCCCCC-CCCHHHHHHHhhhcccccccCCCCCCCccchhHHhhhhhhhhhhhhhhccchhh
Q psy11695          1 MFMVASSVVSTILILNYHHRNADTH-EMSPWIRLVFLQWMPCILRMSRPSEEDKTSLTEATRKALKLKELELKERSSKSL   79 (190)
Q Consensus         1 MvlVtlSiv~TV~VlN~hhr~p~~~-~mp~WvR~l~L~~lp~lL~m~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   79 (190)
                      |+++++|+++||+++|+|||++.+| +||+|++++|++++|++++|++|+......     +....  ....        
T Consensus       311 m~~~~~sv~~tv~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~--~~~~--------  375 (449)
T KOG3645|consen  311 MVLVTISVVVTVVILNLHHRSPTTHPPMPPWVRRVFLEKLPRLLLMSRPEDELQVS-----RLIVL--GISV--------  375 (449)
T ss_pred             HHHHHHHHHHheeEEeeecccCCCCCCCchHHHHHHHHHHHHHHhcCCcccccccc-----ccccc--cccc--------
Confidence            6789999999999999999999999 899999999999999999999886511100     00000  0000        


Q ss_pred             hcccCCCCCcccCCCCCCCCCcccccCCCCCCccccCccCCCCCcHHHHHHHHHHHHHHHHhhhhhHHhhchhhHHHHHH
Q psy11695         80 LANVLDIDDDFRHNTLQSSSHTFLRHDDSGGGTILHATTSCIGPHRELTLILKELRVITDKIQKEDEAAEITNDWKFAAM  159 (190)
Q Consensus        80 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~~l~~I~~~~~~~~~~~~~~~eWk~vA~  159 (190)
                        ....    ....  ....... ..    ....     ......++++++.+.+++|+++++.++..++..+||+++|+
T Consensus       376 --~~~~----~~~~--~~~~~~~-~~----~~~~-----~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~w~~va~  437 (449)
T KOG3645|consen  376 --KLFK----ITKS--LGSIPVF-SS----ADPL-----LSPELSPELRKAIEGVDFIAEHLKSEDNFQEIREDWKYVAM  437 (449)
T ss_pred             --cccc----cccc--ccccccc-cc----cccc-----ccccccHHHHHHHHHHHHHHHHHHhHHHHhhhhHHHHHHHH
Confidence              0000    0000  0000000 00    0000     00114578889999999999999999999999999999999


Q ss_pred             HHHHHHHHHHH
Q psy11695        160 VVDRMCLIIFT  170 (190)
Q Consensus       160 VlDRl~l~if~  170 (190)
                      |+||+|||+|+
T Consensus       438 v~dr~~l~~f~  448 (449)
T KOG3645|consen  438 VLDRLLLWIFL  448 (449)
T ss_pred             HHHHHhhheEe
Confidence            99999999986


No 5  
>PRK13743 conjugal transfer protein TrbF; Provisional
Probab=76.04  E-value=9.9  Score=26.73  Aligned_cols=37  Identities=19%  Similarity=0.289  Sum_probs=28.7

Q ss_pred             hhHHhhchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Q psy11695        144 EDEAAEITNDWKFAAMVVDRMCLIIFTLFTILATVAVL  181 (190)
Q Consensus       144 ~~~~~~~~~eWk~vA~VlDRl~l~if~l~~~~~t~~i~  181 (190)
                      +.+-++.+.|.++...+.||- |++|+.+...|+++.-
T Consensus        20 e~KIrq~~rd~~y~~R~~~~Y-~~LfiVFl~AG~vLw~   56 (141)
T PRK13743         20 ELKIRQTKRDYDYERRVSDIY-FDLFIVFLTAGIVLWV   56 (141)
T ss_pred             hHHHHhhhhhHHHHHHHHHHH-HHHHHHHHHhhHHHHH
Confidence            345667888999999999985 5788888888877643


No 6  
>KOG2678|consensus
Probab=74.72  E-value=14  Score=28.55  Aligned_cols=43  Identities=16%  Similarity=0.500  Sum_probs=26.2

Q ss_pred             HHHHHHHHHHhhhhhHHhhchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Q psy11695        131 LKELRVITDKIQKEDEAAEITNDWKFAAMVVDRMCLIIFTLFTILATVAVLC  182 (190)
Q Consensus       131 ~~~l~~I~~~~~~~~~~~~~~~eWk~vA~VlDRl~l~if~l~~~~~t~~i~~  182 (190)
                      ...+....++++..++...  .+|-+++|+       ||.++.++.++.|+-
T Consensus       196 ~~~L~~~Serve~y~ksk~--s~wf~~~mi-------I~v~~sFVsMiliiq  238 (244)
T KOG2678|consen  196 SQGLMDVSERVEKYDKSKL--SYWFYITMI-------IFVILSFVSMILIIQ  238 (244)
T ss_pred             HHHHHhhhHHHHHHHHhhh--hHHHHHHHH-------HHHHHHHHHHHHHHH
Confidence            3455555566655444443  899999987       555555666655543


No 7  
>PRK14762 membrane protein; Provisional
Probab=72.52  E-value=5.1  Score=19.61  Aligned_cols=19  Identities=11%  Similarity=0.259  Sum_probs=14.0

Q ss_pred             HHHHHHHHHHHHHHHHHHh
Q psy11695        163 RMCLIIFTLFTILATVAVL  181 (190)
Q Consensus       163 Rl~l~if~l~~~~~t~~i~  181 (190)
                      |+.+|+-.+++++|.++++
T Consensus         2 ki~lw~i~iifligllvvt   20 (27)
T PRK14762          2 KIILWAVLIIFLIGLLVVT   20 (27)
T ss_pred             eeHHHHHHHHHHHHHHHHH
Confidence            4678888888888877654


No 8  
>PF14202 TnpW:  Transposon-encoded protein TnpW
Probab=57.81  E-value=14  Score=20.05  Aligned_cols=28  Identities=14%  Similarity=0.203  Sum_probs=22.0

Q ss_pred             heeeeEEeeecCCCCCCCCCHHHHHHHh
Q psy11695          9 VSTILILNYHHRNADTHEMSPWIRLVFL   36 (190)
Q Consensus         9 v~TV~VlN~hhr~p~~~~mp~WvR~l~L   36 (190)
                      --|++++++||....+-.|..=+.+++.
T Consensus         8 G~Tty~V~~~F~~~s~et~~DKi~rli~   35 (37)
T PF14202_consen    8 GKTTYVVEVHFSETSKETMQDKIKRLIR   35 (37)
T ss_pred             CCEEEEEEEEECCCccccHHHHHHHHHh
Confidence            4589999999988877778777776653


No 9  
>PF11616 EZH2_WD-Binding:  WD repeat binding protein EZH2;  InterPro: IPR021654  This family of proteins represents Enhancer of zest homologue 2, (EZH2) a 30 residue peptide which binds to a WD-repeat domain of EED by residues 39-68. EED is a component of PRC2 complex which is involved in gene expression []. This interaction is required for the HMTase activity of PCR2 []. ; GO: 0018024 histone-lysine N-methyltransferase activity; PDB: 2QXV_B.
Probab=54.76  E-value=16  Score=18.72  Aligned_cols=21  Identities=10%  Similarity=0.408  Sum_probs=16.1

Q ss_pred             HHHHHhhhhhHHhhchhhHHH
Q psy11695        136 VITDKIQKEDEAAEITNDWKF  156 (190)
Q Consensus       136 ~I~~~~~~~~~~~~~~~eWk~  156 (190)
                      |.+++.+-++..+-..+||+.
T Consensus         4 f~sNr~Ki~e~t~iLN~eWk~   24 (30)
T PF11616_consen    4 FSSNRQKIQERTDILNEEWKK   24 (30)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHH
T ss_pred             hHhhHHHHHHHHHHHHHHHHH
Confidence            455666777788888999995


No 10 
>PF15586 Imm47:  Immunity protein 47
Probab=51.26  E-value=17  Score=25.22  Aligned_cols=35  Identities=23%  Similarity=0.306  Sum_probs=25.7

Q ss_pred             HHHHHHHHHHHHHHhhhhhHHhhchhhHHHHHHHHHHHHHHHH
Q psy11695        127 LTLILKELRVITDKIQKEDEAAEITNDWKFAAMVVDRMCLIIF  169 (190)
Q Consensus       127 l~~i~~~l~~I~~~~~~~~~~~~~~~eWk~vA~VlDRl~l~if  169 (190)
                      ..+|.+.++.|.++...        ++|..+|..|-|+|.|=|
T Consensus        78 ~~~I~~~i~~~i~~c~~--------~~W~~~~~kLsr~f~WEf  112 (116)
T PF15586_consen   78 YDEIKKTIERIIESCEG--------DDWDEIAEKLSRYFAWEF  112 (116)
T ss_pred             HHHHHHHHHHHHHHccC--------CCHHHHHHHHHHheeeec
Confidence            45666666666555532        789999999999998855


No 11 
>PF06939 DUF1286:  Protein of unknown function (DUF1286);  InterPro: IPR009705 This entry is represented by Sulfolobus virus STSV1, Orf8. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This family consists of several hypothetical archaeal proteins of around 120 residues in length. All members of this family seem to be Sulfolobus species specific. The function of this family is unknown.
Probab=48.29  E-value=16  Score=25.09  Aligned_cols=25  Identities=20%  Similarity=0.227  Sum_probs=20.5

Q ss_pred             ecCCCCCCCCCHHHHHHHhhhcccc
Q psy11695         18 HHRNADTHEMSPWIRLVFLQWMPCI   42 (190)
Q Consensus        18 hhr~p~~~~mp~WvR~l~L~~lp~l   42 (190)
                      -+|+|.||.+|+-+-+=++.-+|-+
T Consensus        59 ~~RTPlTHT~pRSv~WGli~slp~i   83 (114)
T PF06939_consen   59 PVRTPLTHTLPRSVLWGLIPSLPLI   83 (114)
T ss_pred             eecCCCccCcchhhHHHHHHHHHHH
Confidence            4699999999998888887777743


No 12 
>PF11395 DUF2873:  Protein of unknown function (DUF2873);  InterPro: IPR021532 This entry is represented by the human SARS coronavirus, Orf7b; it is a family of uncharacterised viral proteins.
Probab=43.13  E-value=45  Score=18.02  Aligned_cols=19  Identities=21%  Similarity=0.742  Sum_probs=10.4

Q ss_pred             HHHHHHHHHHHHHHHHHhh
Q psy11695        164 MCLIIFTLFTILATVAVLC  182 (190)
Q Consensus       164 l~l~if~l~~~~~t~~i~~  182 (190)
                      +|+..|+++.++.-+.||+
T Consensus        11 lc~l~~llflv~imliif~   29 (43)
T PF11395_consen   11 LCFLSFLLFLVIIMLIIFW   29 (43)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            4455555555555555554


No 13 
>cd00928 Cyt_c_Oxidase_VIIa Cytochrome c oxidase subunit VIIa. Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes. It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane. The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome. Found only in eukaryotes, subunit VIIa has two tissue-specific isoforms that are expressed in a developmental manner. VIIa-H is expressed in heart and skeletal muscle but not smooth muscle. VIIa-L is expressed in liver and non-muscle tissues.
Probab=43.07  E-value=40  Score=20.06  Aligned_cols=23  Identities=30%  Similarity=0.335  Sum_probs=18.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhh
Q psy11695        160 VVDRMCLIIFTLFTILATVAVLC  182 (190)
Q Consensus       160 VlDRl~l~if~l~~~~~t~~i~~  182 (190)
                      +.|++++.+=..++++|+...+.
T Consensus        26 ~~D~~LYr~Tm~L~~vG~~~~~~   48 (55)
T cd00928          26 VVDRILYRLTMALTVVGTGYSLY   48 (55)
T ss_pred             chhHHHHHHHHHHHHHhHHHHHH
Confidence            67999999888888888877653


No 14 
>PF03904 DUF334:  Domain of unknown function (DUF334);  InterPro: IPR005602 This is a family of proteins found in Staphylococcus aureus plasmid with no characterised function.
Probab=42.23  E-value=72  Score=24.84  Aligned_cols=14  Identities=36%  Similarity=0.859  Sum_probs=7.3

Q ss_pred             HHHHHHHHHHHHHH
Q psy11695        166 LIIFTLFTILATVA  179 (190)
Q Consensus       166 l~if~l~~~~~t~~  179 (190)
                      |.+|.+|.++.|++
T Consensus       158 l~Vf~LF~lvmt~g  171 (230)
T PF03904_consen  158 LFVFMLFALVMTIG  171 (230)
T ss_pred             HHHHHHHHHHHHhc
Confidence            33555555555543


No 15 
>PF11628 TCR_zetazeta:  T-cell surface glycoprotein CD3 zeta chain;  InterPro: IPR021663 The TCR complex of T-lymphocytes consists of either a TCR alpha/beta or TCR gamma/delta heterodimer co-expressed at the cell surface with the invariant subunits of CD3 labelled gamma, delta, epsilon, zeta, and eta []. The zeta subunit forms either homodimers or heterodimers with eta [], but eta homodimers have not been observed. The structure of the zetazeta transmembrane dimer consists of a left-handed coiled coil with polar contacts. Two aspartic acids are critical for zetazeta dimerisation and assembly with TCR [].  The high affinity immunoglobulin epsilon receptor (IgE Fc receptor) subunit gamma associates with a variety of FcR alpha chains to form a functional signaling complex. The gamma subunit has a critical role in allowing the IgE Fc receptor to reach the cell surface and regulates several aspects of the immune response []. This family includes both CD3 zeta subunits and IgE Fc receptor gamma subunits. The gamma chain of the high affinity Fc receptor for IgE has significant structural homology to CD3 zeta and the related CD3 eta subunit and can facilitate T cell receptor expression and signaling in the absence of CD3 zeta and CD3 eta [].; PDB: 2HAC_B.
Probab=40.33  E-value=58  Score=17.13  Aligned_cols=16  Identities=13%  Similarity=0.457  Sum_probs=11.0

Q ss_pred             HHHHHHHHHHHHHHHHH
Q psy11695        157 AAMVVDRMCLIIFTLFT  173 (190)
Q Consensus       157 vA~VlDRl~l~if~l~~  173 (190)
                      ++.++|-++| +|-++.
T Consensus         4 lCYiLDgiL~-iYgiii   19 (33)
T PF11628_consen    4 LCYILDGILF-IYGIII   19 (33)
T ss_dssp             HHHHHHHHHH-HHHHHH
T ss_pred             eeeeHHHHHH-HHHHHH
Confidence            6789998876 555543


No 16 
>PF06992 Phage_lambda_P:  Replication protein P;  InterPro: IPR009731 This family consists of several Bacteriophage lambda replication protein P like proteins. The bacteriophage lambda P protein promoters replication of the phage chromosome by recruiting a key component of the cellular replication machinery to the viral origin. Specifically, P protein delivers one or more molecules of Escherichia coli DnaB helicase to a nucleoprotein structure formed by the lambda O initiator at the lambda replication origin [].; GO: 0006270 DNA-dependent DNA replication initiation
Probab=38.58  E-value=32  Score=26.90  Aligned_cols=38  Identities=21%  Similarity=0.375  Sum_probs=23.8

Q ss_pred             HHHHHHHHHhhhhhHHhhchhhHHHHHHHHHHHHHHHHHHH
Q psy11695        132 KELRVITDKIQKEDEAAEITNDWKFAAMVVDRMCLIIFTLF  172 (190)
Q Consensus       132 ~~l~~I~~~~~~~~~~~~~~~eWk~vA~VlDRl~l~if~l~  172 (190)
                      +.++.|+.++-++..++...+   .++.++|+||--+-.++
T Consensus        14 ~~~~r~a~~~p~q~~~~~~~~---~~~~~vd~lF~~L~aif   51 (233)
T PF06992_consen   14 EQLRRMANNMPEQYDEKAQVE---QAAKLVDRLFRQLKAIF   51 (233)
T ss_pred             HHHHHHHccCCccccccchHH---HHHHHHHHHHHHHHHhC
Confidence            356677777776665544332   57888888886554443


No 17 
>KOG0002|consensus
Probab=38.55  E-value=19  Score=20.45  Aligned_cols=9  Identities=33%  Similarity=1.055  Sum_probs=6.9

Q ss_pred             CCCCHHHHH
Q psy11695         25 HEMSPWIRL   33 (190)
Q Consensus        25 ~~mp~WvR~   33 (190)
                      .++|.|+|-
T Consensus        18 r~iP~WiRm   26 (48)
T KOG0002|consen   18 RPIPQWIRM   26 (48)
T ss_pred             CCccHHHhh
Confidence            578999873


No 18 
>PF05624 LSR:  Lipolysis stimulated receptor (LSR);  InterPro: IPR008664 This domain consists of mammalian LISCH7 protein homologues. LISCH7 is a liver-specific BHLH-ZIP transcription factor.
Probab=37.77  E-value=8.7  Score=21.84  Aligned_cols=10  Identities=20%  Similarity=0.823  Sum_probs=5.7

Q ss_pred             hHHHHHHHHH
Q psy11695        153 DWKFAAMVVD  162 (190)
Q Consensus       153 eWk~vA~VlD  162 (190)
                      ||-+|..|+=
T Consensus         1 ~Wl~V~~iil   10 (49)
T PF05624_consen    1 HWLFVVLIIL   10 (49)
T ss_pred             CeEEEeHHHH
Confidence            4666666543


No 19 
>PRK03692 putative UDP-N-acetyl-D-mannosaminuronic acid transferase; Provisional
Probab=37.67  E-value=20  Score=28.16  Aligned_cols=28  Identities=14%  Similarity=0.240  Sum_probs=23.0

Q ss_pred             eecCCCCCCCCCHHHHHHHhhhcccccc
Q psy11695         17 YHHRNADTHEMSPWIRLVFLQWMPCILR   44 (190)
Q Consensus        17 ~hhr~p~~~~mp~WvR~l~L~~lp~lL~   44 (190)
                      +.+-+....+-|+|+|++=|+||=|++.
T Consensus       193 fD~~aG~~~RAP~w~~~~gLEWlyRl~~  220 (243)
T PRK03692        193 YDVFTGHVKRAPKIWQNLGLEWLYRLLS  220 (243)
T ss_pred             EEEecCCcCcCcHHHHHhChHHHHHhHh
Confidence            4455666788999999999999999773


No 20 
>PF11057 Cortexin:  Cortexin of kidney;  InterPro: IPR020066 Cortexin is a neuron-specific, 82-residue membrane protein which is found especially in vertebrate brain cortex tissue. It may mediate extracellular or intracellular signalling of cortical neurons during forebrain development. Cortexin is present at significant levels in the foetal brain, suggesting that it may be important to neurons of both the developing and adult cerebral cortex. Cortexin has a conserved single membrane-spanning region in the middle of each sequence []. In humans, there is selective expression of Cortexin 3 (CTXN3) in the kidney as well as the brain []. This entry contains Cortexins 1, 2 and 3.; GO: 0031224 intrinsic to membrane
Probab=35.91  E-value=53  Score=20.84  Aligned_cols=20  Identities=20%  Similarity=0.218  Sum_probs=15.8

Q ss_pred             HHHHHHHHHHHHHHHHHhhc
Q psy11695        164 MCLIIFTLFTILATVAVLCS  183 (190)
Q Consensus       164 l~l~if~l~~~~~t~~i~~~  183 (190)
                      .+|++|+.+.++-.+-|++.
T Consensus        35 ~~L~~fL~~liVRCfrIllD   54 (81)
T PF11057_consen   35 GLLCLFLGLLIVRCFRILLD   54 (81)
T ss_pred             HHHHHHHHHHHHHHHHHHcC
Confidence            46778888888888888876


No 21 
>KOG4647|consensus
Probab=33.08  E-value=81  Score=24.55  Aligned_cols=27  Identities=26%  Similarity=0.404  Sum_probs=22.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHh
Q psy11695        155 KFAAMVVDRMCLIIFTLFTILATVAVL  181 (190)
Q Consensus       155 k~vA~VlDRl~l~if~l~~~~~t~~i~  181 (190)
                      +++|-.+|-+++++|=+.++.|++-++
T Consensus        97 R~~AE~IDffilf~~K~~Iv~g~~~l~  123 (263)
T KOG4647|consen   97 RLLAELIDFFILFSFKLAIVGGTLSLL  123 (263)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhHHHhh
Confidence            468999999999988888888887665


No 22 
>PF08253 Leader_Erm:  Erm Leader peptide ;  InterPro: IPR013204 These short proteins are leader peptides (15-19 amino acids) of erm genes that code for resistance determinants in Staphylococcus aureus [].
Probab=30.98  E-value=54  Score=14.77  Aligned_cols=14  Identities=21%  Similarity=0.413  Sum_probs=9.7

Q ss_pred             heeeeEEeeecCCC
Q psy11695          9 VSTILILNYHHRNA   22 (190)
Q Consensus         9 v~TV~VlN~hhr~p   22 (190)
                      .+++||+|-.|-.|
T Consensus         3 ~fSiFVI~~vhYqp   16 (19)
T PF08253_consen    3 MFSIFVINTVHYQP   16 (19)
T ss_pred             eEEEEEEEeeccCC
Confidence            46789998665444


No 23 
>PRK13682 hypothetical protein; Provisional
Probab=30.26  E-value=1.2e+02  Score=17.74  Aligned_cols=21  Identities=14%  Similarity=0.409  Sum_probs=14.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHH
Q psy11695        158 AMVVDRMCLIIFTLFTILATV  178 (190)
Q Consensus       158 A~VlDRl~l~if~l~~~~~t~  178 (190)
                      |.-+-+++|++|+.+.+++-+
T Consensus        27 aa~iAkiLF~iflvl~vvslv   47 (51)
T PRK13682         27 AAGIAKILFFIFLVLFVVSLL   47 (51)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            445677888888887766544


No 24 
>PF08372 PRT_C:  Plant phosphoribosyltransferase C-terminal;  InterPro: IPR013583 This domain is found at the C terminus of phosphoribosyltransferases and phosphoribosyltransferase-like proteins. It contains putative transmembrane regions. It often appears together with calcium-ion dependent C2 domains (IPR000008 from INTERPRO). 
Probab=29.92  E-value=1.8e+02  Score=21.27  Aligned_cols=49  Identities=16%  Similarity=0.399  Sum_probs=26.6

Q ss_pred             HHHHHHHHHHHHHHhhhhhHHhhchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Q psy11695        127 LTLILKELRVITDKIQKEDEAAEITNDWKFAAMVVDRMCLIIFTLFTILATVAVL  181 (190)
Q Consensus       127 l~~i~~~l~~I~~~~~~~~~~~~~~~eWk~vA~VlDRl~l~if~l~~~~~t~~i~  181 (190)
                      ++.+...++.+-+.+..+-|.=+.--.|+      |...=++|.+++++.+++++
T Consensus        64 lr~va~rvQ~vlgd~At~gERl~allsWr------dP~aT~lf~~~clv~avvly  112 (156)
T PF08372_consen   64 LRSVAGRVQNVLGDVATQGERLQALLSWR------DPRATALFVVFCLVAAVVLY  112 (156)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhhccC------CccHHHHHHHHHHHHHHHHH
Confidence            44555555555555555555555555675      55555556666665555544


No 25 
>PF14372 DUF4413:  Domain of unknown function (DUF4413)
Probab=28.66  E-value=93  Score=20.67  Aligned_cols=19  Identities=21%  Similarity=0.027  Sum_probs=13.6

Q ss_pred             hHHhhchhhHHHHHHHHHH
Q psy11695        145 DEAAEITNDWKFAAMVVDR  163 (190)
Q Consensus       145 ~~~~~~~~eWk~vA~VlDR  163 (190)
                      ++.-+....|-.+|.|||=
T Consensus        45 dKYw~~~~~~l~ia~ILDP   63 (101)
T PF14372_consen   45 DKYWKDCNLLLAIATILDP   63 (101)
T ss_pred             HHHHHHhHHHHHHHHHhch
Confidence            4555566777888888883


No 26 
>PF10290 DUF2403:  Glycine-rich protein domain (DUF2403);  InterPro: IPR018807  This domain is found N-terminal to IPR018805 from INTERPRO. The function of this glycine-rich domain is unknown. 
Probab=28.43  E-value=29  Score=21.40  Aligned_cols=10  Identities=30%  Similarity=0.388  Sum_probs=7.7

Q ss_pred             EeeecCCCCC
Q psy11695         15 LNYHHRNADT   24 (190)
Q Consensus        15 lN~hhr~p~~   24 (190)
                      |.+|||+|-.
T Consensus        46 lSvhFRGPl~   55 (65)
T PF10290_consen   46 LSVHFRGPLN   55 (65)
T ss_pred             EEEEEeCCcE
Confidence            5689999853


No 27 
>PF03993 DUF349:  Domain of Unknown Function (DUF349);  InterPro: IPR007139 This motif is found singly or as up to five tandem repeats in a small set of bacterial proteins. There are two or three alpha-helices, and possibly a beta-strand.
Probab=28.33  E-value=27  Score=21.63  Aligned_cols=32  Identities=19%  Similarity=0.443  Sum_probs=20.1

Q ss_pred             HHHHHHHHHHHHh---hhhhHHhhchhhHHHHHHH
Q psy11695        129 LILKELRVITDKI---QKEDEAAEITNDWKFAAMV  160 (190)
Q Consensus       129 ~i~~~l~~I~~~~---~~~~~~~~~~~eWk~vA~V  160 (190)
                      .+++.++.+.+..   ...+...++.++|+-++.|
T Consensus        38 ~Li~~~~~l~~~~d~~~~~~~~k~l~~~Wk~iG~v   72 (77)
T PF03993_consen   38 ALIEEAEALAESEDWKEAAEEIKELQQEWKEIGPV   72 (77)
T ss_pred             HHHHHHHHhcccccHHHHHHHHHHHHHHHHHcCCC
Confidence            5555555555544   3445667788889887654


No 28 
>PF11815 DUF3336:  Domain of unknown function (DUF3336);  InterPro: IPR021771 This family of proteins is characterised by an N-terminal domain that is found adjacent to the patatin/phospholipase A2-related domain (see PF01734 from PFAM). The family of proteins, which contain these two domains, have been characterised in Saccharomyces cerevisiae (Baker's yeast) as a bifunctional enzyme with triacylglycerol lipase and lysophosphatidic acid acyltransferase or lysophosphatidylethanolamine acyltransferase activity. They are generally involved in triacylglycerol mobilisation and localized to lipid particles [, ].
Probab=28.27  E-value=92  Score=22.34  Aligned_cols=27  Identities=26%  Similarity=0.436  Sum_probs=19.8

Q ss_pred             HHhhhhhHHhhchhhHHHHHHHHHHHH
Q psy11695        139 DKIQKEDEAAEITNDWKFAAMVVDRMC  165 (190)
Q Consensus       139 ~~~~~~~~~~~~~~eWk~vA~VlDRl~  165 (190)
                      +.++.+-+..+.=+||+.+|.-+|.+.
T Consensus        14 ~~l~~~l~~A~sYeEW~~~A~~LD~l~   40 (145)
T PF11815_consen   14 RRLRRQLRNAESYEEWKEAAQELDELE   40 (145)
T ss_pred             HHHHHHHHcCCCHHHHHHHHHHHHHHc
Confidence            344555556666788999999999884


No 29 
>KOG2082|consensus
Probab=27.80  E-value=95  Score=28.98  Aligned_cols=33  Identities=15%  Similarity=0.354  Sum_probs=29.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCc
Q psy11695        154 WKFAAMVVDRMCLIIFTLFTILATVAVLCSAPH  186 (190)
Q Consensus       154 Wk~vA~VlDRl~l~if~l~~~~~t~~i~~~~p~  186 (190)
                      =-.+|-++|-|||--|..+++.+++--++.+|+
T Consensus       566 lD~iApilsmFFLMCY~fVNLaCavqtLLrtPn  598 (1075)
T KOG2082|consen  566 LDLIAPILSMFFLMCYLFVNLACAVQTLLRTPN  598 (1075)
T ss_pred             hhHHHHHHHHHHHHHHHHHhHHHHHHHHhcCCC
Confidence            345789999999999999999999999999996


No 30 
>COG4858 Uncharacterized membrane-bound protein conserved in bacteria [Function unknown]
Probab=26.29  E-value=1.6e+02  Score=22.36  Aligned_cols=27  Identities=22%  Similarity=0.431  Sum_probs=22.7

Q ss_pred             HHhhchhhHHHHHHHHHHHHHHHHHHH
Q psy11695        146 EAAEITNDWKFAAMVVDRMCLIIFTLF  172 (190)
Q Consensus       146 ~~~~~~~eWk~vA~VlDRl~l~if~l~  172 (190)
                      +..+.-.-||+++-.+--+++|++..+
T Consensus       154 d~sqr~~~~K~~lv~~~sm~lWi~v~i  180 (226)
T COG4858         154 DNSQRPGTWKYLLVAVLSMLLWIAVMI  180 (226)
T ss_pred             ccccCCchHHHHHHHHHHHHHHHHHHH
Confidence            556677889999999999999998763


No 31 
>PF14829 GPAT_N:  Glycerol-3-phosphate acyltransferase N-terminal; PDB: 1IUQ_A 1K30_A.
Probab=26.17  E-value=58  Score=20.75  Aligned_cols=12  Identities=33%  Similarity=0.329  Sum_probs=9.5

Q ss_pred             HHHHHHHHHHHH
Q psy11695        156 FAAMVVDRMCLI  167 (190)
Q Consensus       156 ~vA~VlDRl~l~  167 (190)
                      .+|-++||+|+=
T Consensus        61 nm~~~~Drvlld   72 (77)
T PF14829_consen   61 NMAVALDRVLLD   72 (77)
T ss_dssp             HHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHc
Confidence            468899999873


No 32 
>PF03908 Sec20:  Sec20;  InterPro: IPR005606 Sec20 is a membrane glycoprotein associated with secretory pathway.
Probab=26.07  E-value=1.3e+02  Score=19.52  Aligned_cols=21  Identities=24%  Similarity=0.436  Sum_probs=11.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHH
Q psy11695        160 VVDRMCLIIFTLFTILATVAV  180 (190)
Q Consensus       160 VlDRl~l~if~l~~~~~t~~i  180 (190)
                      ..||+++|.-++++++..+.|
T Consensus        67 ~~D~~li~~~~~~f~~~v~yI   87 (92)
T PF03908_consen   67 KTDRILIFFAFLFFLLVVLYI   87 (92)
T ss_pred             HHhHHHHHHHHHHHHHHHHHH
Confidence            468887775444443333333


No 33 
>PF08414 NADPH_Ox:  Respiratory burst NADPH oxidase;  InterPro: IPR013623 This domain is found in plant proteins such as respiratory burst NADPH oxidase proteins which produce reactive oxygen species as a defence mechanism. It tends to occur to the N terminus of an EF-hand (IPR002048 from INTERPRO), which suggests a direct regulatory effect of Ca2+ on the activity of the NADPH oxidase in plants []. ; GO: 0004601 peroxidase activity, 0050664 oxidoreductase activity, acting on NADH or NADPH, oxygen as acceptor, 0055114 oxidation-reduction process; PDB: 3A8R_A.
Probab=24.41  E-value=1.9e+02  Score=19.46  Aligned_cols=31  Identities=26%  Similarity=0.408  Sum_probs=21.6

Q ss_pred             HHHHHHHHHHHHHHhhhhhHHhhchhhHHHHHHHHHHH
Q psy11695        127 LTLILKELRVITDKIQKEDEAAEITNDWKFAAMVVDRM  164 (190)
Q Consensus       127 l~~i~~~l~~I~~~~~~~~~~~~~~~eWk~vA~VlDRl  164 (190)
                      .+.++++|+||......       .+.|+.|-.-.|.+
T Consensus         9 A~~ALkGLrFIskt~~~-------~~~W~~VE~RFd~L   39 (100)
T PF08414_consen    9 AQRALKGLRFISKTTGG-------ADGWKEVEKRFDKL   39 (100)
T ss_dssp             HHHHHHHHHHHHHHH------------HHHHHHHHHHH
T ss_pred             HHHHHhcccceecCCCC-------ccCHHHHHHHHHHh
Confidence            46788999999976554       33499998888876


No 34 
>PF06796 NapE:  Periplasmic nitrate reductase protein NapE;  InterPro: IPR010649 This family consists of several bacterial periplasmic nitrate reductase NapE proteins. Seven genes, napKEFDABC, encoding the periplasmic nitrate reductase system were cloned from the denitrifying phototrophic bacterium Rhodobacter sphaeroides. NapE is thought to be a transmembrane protein [].
Probab=23.44  E-value=1.8e+02  Score=17.40  Aligned_cols=11  Identities=9%  Similarity=0.148  Sum_probs=7.9

Q ss_pred             HHhhchhhHHH
Q psy11695        146 EAAEITNDWKF  156 (190)
Q Consensus       146 ~~~~~~~eWk~  156 (190)
                      ..++.++||+-
T Consensus        10 ~~~~k~~E~~~   20 (56)
T PF06796_consen   10 DKSTKRSELKA   20 (56)
T ss_pred             ccchhHHHHHH
Confidence            46667888983


No 35 
>PF00832 Ribosomal_L39:  Ribosomal L39 protein;  InterPro: IPR000077 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic and archaebacterial large subunit ribosomal proteins can be grouped on the basis of sequence similarities. These proteins are very basic. About 50 residues long, they are the smallest proteins of eukaryotic-type ribosomes.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 3CCJ_2 3CME_2 3OW2_1 1YI2_2 1KD1_3 3CXC_1 3G6E_2 1VQ4_2 3CCU_2 3CC7_2 ....
Probab=22.79  E-value=36  Score=19.11  Aligned_cols=9  Identities=22%  Similarity=0.903  Sum_probs=3.9

Q ss_pred             CCCCCHHHH
Q psy11695         24 THEMSPWIR   32 (190)
Q Consensus        24 ~~~mp~WvR   32 (190)
                      .+|+|.|++
T Consensus        12 NrpvP~Wv~   20 (43)
T PF00832_consen   12 NRPVPQWVR   20 (43)
T ss_dssp             TS---HHGH
T ss_pred             cCCCCcEEE
Confidence            367888865


No 36 
>PF12732 YtxH:  YtxH-like protein;  InterPro: IPR024623 This family of uncharacterised proteins is found in bacteria. Proteins in this family are typically between 100 and 143 amino acids in length. The N-terminal region is the most conserved.
Probab=22.40  E-value=90  Score=19.35  Aligned_cols=21  Identities=29%  Similarity=0.151  Sum_probs=14.9

Q ss_pred             HHHHHHHHHHHHHHHHhhcCC
Q psy11695        165 CLIIFTLFTILATVAVLCSAP  185 (190)
Q Consensus       165 ~l~if~l~~~~~t~~i~~~~p  185 (190)
                      |++-|++-.++|+++-++.+|
T Consensus         1 F~~g~l~Ga~~Ga~~glL~aP   21 (74)
T PF12732_consen    1 FLLGFLAGAAAGAAAGLLFAP   21 (74)
T ss_pred             CHHHHHHHHHHHHHHHHHhCC
Confidence            456677777778777666667


No 37 
>PF08788 NHR2:  NHR2 domain like;  InterPro: IPR014896  Transcriptional activation and repression are required for control of cell proliferation and differentiation during embryonic development and homeostasis in the adult organism. Perturbations of these processes can lead to the development of cancer []. The Eight-Twenty-One (ETO) gene product is able to form complexes with corepressors and deacetylases, such as nuclear receptor corepressor (N-CoR), which repress transcription when recruited by transcription factors []. The ETO gene derives its name from its association with many cases of acute myelogenous leukaemia (AML), in which a reciprocal translocation, t(8;21), brings together a large portion of the ETO gene from chromosome eight and part of the AML1 gene from chromosome 21. The human ETO gene family currently comprises three major subfamilies: ETO/myeloid transforming gene on chromosome 8 (MTG8); myeloid transforming gene related protein-1 (MTGR1) and myeloid transforming gene on chromosome 16 (MTG16). ETO proteins are composed of four evolutionarily conserved domains termed nervy homology regions (NHR) 1-4. NHR1 is thought to stabilise the formation of high molecular weight complexes, but is not directly responsible for repressor activity. NHR2 and its flanking sequence comprise the core repressor domain, which mediates 50% of the wild type repressor activity. Furthermore, there is evidence that the amphipathic helical structure of NHR2 promotes the formation of ETO/AML1 homodimers []. NHR3 and NHR4 have been shown to act in concert to bind N-CoR. NHR4 contains two zinc finger motifs, which are thought to play a role in protein interactions rather than DNA binding [].  This entry represents the NHR2 (Nervy homology 2) domain found in ETO proteins. It mediates oligomerisation and protein-protein interactions, forming an alpha-helical tetramer []. ; PDB: 1WQ6_A.
Probab=22.21  E-value=1.1e+02  Score=18.70  Aligned_cols=19  Identities=16%  Similarity=0.475  Sum_probs=13.4

Q ss_pred             HHhhchhhHHHHHHHHHHH
Q psy11695        146 EAAEITNDWKFAAMVVDRM  164 (190)
Q Consensus       146 ~~~~~~~eWk~vA~VlDRl  164 (190)
                      .+.+..+|||.+-.+|..+
T Consensus        10 t~~~~~deWkh~~~mLnCI   28 (67)
T PF08788_consen   10 TEREWADEWKHLDHMLNCI   28 (67)
T ss_dssp             -HHHHHHHHHHHHHHHHHH
T ss_pred             ccccHHHHhcCHHHHHHHH
Confidence            4567789999977766554


No 38 
>TIGR02972 TMAO_torE trimethylamine N-oxide reductase system, TorE protein. Members of this small, apparent transmembrane protein are designated TorE and occur in operons for the trimethylamine N-oxide (TMAO) reductase system. Members are closely related to the NapE protein of the related periplasmic nitrate reductase system. It may be that TorE is an integral membrane subunit of a complex with the reductase TorA.
Probab=21.51  E-value=1.8e+02  Score=16.71  Aligned_cols=29  Identities=10%  Similarity=0.020  Sum_probs=13.9

Q ss_pred             HhhchhhHHHHHHHHHHHHHHHHHHHHHHHH
Q psy11695        147 AAEITNDWKFAAMVVDRMCLIIFTLFTILAT  177 (190)
Q Consensus       147 ~~~~~~eWk~vA~VlDRl~l~if~l~~~~~t  177 (190)
                      +++.++||+-  ..+=-++++-.+.+.+++.
T Consensus         3 ~~~k~~El~~--flfl~v~l~PiLsV~~Vg~   31 (47)
T TIGR02972         3 ESKRSNELKA--LGFIIVVLFPILSVAGIGG   31 (47)
T ss_pred             cchhHHHHHH--HHHHHHHHHHHHHHHHHHH
Confidence            4556678883  3222333334444444444


No 39 
>PF05484 LRV_FeS:  LRV protein FeS4 cluster;  InterPro: IPR008665 This iron sulphur cluster is found at the N terminus of some proteins containing leucine-repeat variant (LRV) repeats (IPR004830 from INTERPRO). These proteins have a two-domain structure, composed of a small N-terminal domain containing a cluster of four Cys residues that houses the 4Fe:4S cluster, and a larger C-terminal domain containing the LRV repeats []. Biochemical studies revealed that the 4Fe:4S cluster is sensitive to oxygen, but does not appear to have reversible redox activity.; PDB: 1LRV_A.
Probab=21.48  E-value=77  Score=18.99  Aligned_cols=9  Identities=33%  Similarity=0.364  Sum_probs=4.2

Q ss_pred             HHHHHHHHH
Q psy11695        158 AMVVDRMCL  166 (190)
Q Consensus       158 A~VlDRl~l  166 (190)
                      |.-|||||-
T Consensus        40 aRrIdRFF~   48 (57)
T PF05484_consen   40 ARRIDRFFR   48 (57)
T ss_dssp             HHHHHHHHH
T ss_pred             HHHHHHHHH
Confidence            344555543


No 40 
>PRK13677 hypothetical protein; Provisional
Probab=21.41  E-value=2.3e+02  Score=19.77  Aligned_cols=40  Identities=23%  Similarity=0.292  Sum_probs=31.4

Q ss_pred             CcHHHHHHHHHHHHHHHHhh-hhhHHhhchhhHHHHHHHHH
Q psy11695        123 PHRELTLILKELRVITDKIQ-KEDEAAEITNDWKFAAMVVD  162 (190)
Q Consensus       123 ~~~~l~~i~~~l~~I~~~~~-~~~~~~~~~~eWk~vA~VlD  162 (190)
                      .++.+..+++++..|+.+.+ +.|-.+++-+|-+..-.|+-
T Consensus        72 i~~~l~~vidELd~i~~~~~~e~d~K~kiL~dLrHLE~Vv~  112 (125)
T PRK13677         72 ISPNLRYVIDELDQICQRDREEVDLKRKILDDLRHLESVVA  112 (125)
T ss_pred             ccHHHHHHHHHHHHHhcchhhhHHHHHHHHHHHHHHHHHHH
Confidence            45678899999999999876 45667778888888777764


No 41 
>PF03530 SK_channel:  Calcium-activated SK potassium channel;  InterPro: IPR011996 Potassium channels are the most diverse group of the ion channel family [, ]. They are important in shaping the action potential, and in neuronal excitability and plasticity []. The potassium channel family is composed of several functionally distinct isoforms, which can be broadly separated into 2 groups []: the practically non-inactivating 'delayed' group and the rapidly inactivating 'transient' group. These are all highly similar proteins, with only small amino acid changes causing the diversity of the voltage-dependent gating mechanism, channel conductance and toxin binding properties. Each type of K+ channel is activated by different signals and conditions depending on their type of regulation: some open in response to depolarisation of the plasma membrane; others in response to hyperpolarisation or an increase in intracellular calcium concentration; some can be regulated by binding of a transmitter, together with intracellular kinases; while others are regulated by GTP-binding proteins or other second messengers []. In eukaryotic cells, K+ channels are involved in neural signalling and generation of the cardiac rhythm, act as effectors in signal transduction pathways involving G protein-coupled receptors (GPCRs) and may have a role in target cell lysis by cytotoxic T-lymphocytes []. In prokaryotic cells, they play a role in the maintenance of ionic homeostasis [].  All K+ channels discovered so far possess a core of alpha subunits, each comprising either one or two copies of a highly conserved pore loop domain (P-domain). The P-domain contains the sequence (T/SxxTxGxG), which has been termed the K+ selectivity sequence. In families that contain one P-domain, four subunits assemble to form a selective pathway for K+ across the membrane. However, it remains unclear how the 2 P-domain subunits assemble to form a selective pore. The functional diversity of these families can arise through homo- or hetero-associations of alpha subunits or association with auxiliary cytoplasmic beta subunits. K+ channel subunits containing one pore domain can be assigned into one of two superfamilies: those that possess six transmembrane (TM) domains and those that possess only two TM domains. The six TM domain superfamily can be further subdivided into conserved gene families: the voltage-gated (Kv) channels; the KCNQ channels (originally known as KvLQT channels); the EAG-like K+ channels; and three types of calcium (Ca)-activated K+ channels (BK, IK and SK) []. The 2TM domain family comprises inward-rectifying K+ channels. In addition, there are K+ channel alpha-subunits that possess two P-domains. These are usually highly regulated K+ selective leak channels. Ca2+-activated K+ channels are a diverse group of channels that are activated by an increase in intracellular Ca2+ concentration. They are found in the majority of nerve cells, where they modulate cell excitability and action potential. Three types of Ca2+-activated K+ channel have been characterised, termed small-conductance (SK), intermediate conductance (IK) and large conductance (BK) respectively []. SK channels are thought to play an important role in the functioning of all excitable tissues. To date, 3 subtypes (designated SK1-SK3) have been cloned, each of which possesses a different tissue expression profile: SK1 channels are expressed in the heart; SK2 channels are found in the adrenal gland; and SK3 channels are known to be present in skeletal muscle []. SK channels have a single-channel conductance of 2-20 pS and are activated by rises in cytosolic calcium with half maximal activation in the 400-800 nM range [, ]. Unlike BK channels, they are voltage insensitive and unaffected by low concentrations of TEA, charybdotoxin, or iberiotoxin. However, they are potently blocked by the bee venom apamin [, ], tubocurarine, and quaternary salts of bicuculline [, ]. A new series of compounds that block SK channels include dequalinium Synonym(s): SK Channel This entry represents a conserved region, found in proteins of SK channels family.
Probab=21.32  E-value=1.3e+02  Score=20.88  Aligned_cols=22  Identities=27%  Similarity=0.484  Sum_probs=17.7

Q ss_pred             HHhhchhhHHHHHHHHHHHHHHH
Q psy11695        146 EAAEITNDWKFAAMVVDRMCLII  168 (190)
Q Consensus       146 ~~~~~~~eWk~vA~VlDRl~l~i  168 (190)
                      .-+...+||+ +|+..+|++...
T Consensus        78 ~~dn~~~dWr-ia~t~~r~~~i~   99 (119)
T PF03530_consen   78 MVDNGADDWR-IAMTWERILQIA   99 (119)
T ss_pred             HHHcCCchHH-HHHHHHHHHHHH
Confidence            4556678999 999999998764


No 42 
>KOG3670|consensus
Probab=20.74  E-value=32  Score=29.08  Aligned_cols=29  Identities=28%  Similarity=0.567  Sum_probs=20.3

Q ss_pred             HHHHHHHHHHHHHhhhhhHHhhchhhHHHH
Q psy11695        128 TLILKELRVITDKIQKEDEAAEITNDWKFA  157 (190)
Q Consensus       128 ~~i~~~l~~I~~~~~~~~~~~~~~~eWk~v  157 (190)
                      +.+.+.-+.+.+++++..+-+ .++|||.|
T Consensus       160 ~Dlp~QAr~Lv~rik~~~~i~-~~~dWKLi  188 (397)
T KOG3670|consen  160 EDLPDQARDLVSRIKKDKEIN-MKNDWKLI  188 (397)
T ss_pred             hhhHHHHHHHHHHHHhccCcc-cccceEEE
Confidence            455666667777777665555 89999965


No 43 
>COG4537 ComGC Competence protein ComGC [Intracellular trafficking and secretion]
Probab=20.39  E-value=1.2e+02  Score=20.52  Aligned_cols=24  Identities=13%  Similarity=0.342  Sum_probs=17.6

Q ss_pred             HHHHHHHHHHHHHHHhhcCCcccc
Q psy11695        166 LIIFTLFTILATVAVLCSAPHIIV  189 (190)
Q Consensus       166 l~if~l~~~~~t~~i~~~~p~~~~  189 (190)
                      |.=.+++.++.++++++-+|++.+
T Consensus        16 LvEMLiVLlIISiLlLl~iPNltK   39 (107)
T COG4537          16 LVEMLIVLLIISILLLLFIPNLTK   39 (107)
T ss_pred             HHHHHHHHHHHHHHHHHHccchhh
Confidence            334667777788888888898753


No 44 
>PF07043 DUF1328:  Protein of unknown function (DUF1328);  InterPro: IPR009760 This entry represents several hypothetical bacterial proteins of around 50 residues in length. The function of this family is unknown but is thought to be a membrane protein.; GO: 0005886 plasma membrane
Probab=20.28  E-value=1.6e+02  Score=16.12  Aligned_cols=17  Identities=18%  Similarity=0.438  Sum_probs=12.0

Q ss_pred             HHHHHHHHHHHHHHHHH
Q psy11695        158 AMVVDRMCLIIFTLFTI  174 (190)
Q Consensus       158 A~VlDRl~l~if~l~~~  174 (190)
                      |.-+-|++|++|+.+.+
T Consensus        22 a~~iAkiLf~iflvl~v   38 (39)
T PF07043_consen   22 AAGIAKILFFIFLVLFV   38 (39)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            45567788888877654


Done!