Query         psy11705
Match_columns 81
No_of_seqs    36 out of 38
Neff          2.7 
Searched_HMMs 46136
Date          Fri Aug 16 16:48:50 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy11705.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/11705hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF15114 UPF0640:  Uncharacteri 100.0 1.4E-46   3E-51  244.0   6.0   68    4-73      2-69  (69)
  2 PF06305 DUF1049:  Protein of u  59.4      15 0.00033   21.5   3.0   50   17-76     12-61  (68)
  3 PRK10628 LigB family dioxygena  51.9     6.7 0.00015   30.0   0.8   13   26-38    208-220 (246)
  4 PF14142 YrzO:  YrzO-like prote  51.6      16 0.00035   22.4   2.3   17   29-45      5-21  (46)
  5 TIGR00852 pts-Glc PTS system,   50.9      10 0.00022   28.5   1.6   18   24-41      3-20  (289)
  6 PF06522 B12D:  NADH-ubiquinone  50.5     7.8 0.00017   24.4   0.8   13   28-40      6-18  (73)
  7 TIGR02002 PTS-II-BC-glcB PTS s  37.9      19 0.00042   29.8   1.4   29   11-43     56-84  (502)
  8 PF08365 IGF2_C:  Insulin-like   37.6      23  0.0005   22.5   1.5   12   56-67      5-16  (56)
  9 PF05965 FYRC:  F/Y rich C-term  37.6      25 0.00053   21.9   1.6   24    5-28     59-82  (86)
 10 PF00876 Innexin:  Innexin;  In  35.7      22 0.00048   27.5   1.4   23   19-41     79-101 (348)
 11 PF04741 InvH:  InvH outer memb  33.8      21 0.00046   26.4   1.0   15   25-39      4-18  (147)
 12 TIGR02986 restrict_Alw26I type  29.1      45 0.00097   28.3   2.2   21   44-64     30-51  (424)
 13 PF01757 Acyl_transf_3:  Acyltr  24.4      73  0.0016   21.1   2.2   15   27-41     47-61  (340)
 14 PF13150 DUF3989:  Protein of u  23.6      57  0.0012   21.5   1.6   45    7-61     12-56  (85)
 15 PRK00888 ftsB cell division pr  22.9 2.4E+02  0.0052   18.7   4.5   41   31-76      7-47  (105)
 16 TIGR01996 PTS-II-BC-sucr PTS s  22.3      49  0.0011   26.9   1.3   26   11-40    153-178 (461)
 17 TIGR00727 ISP4_OPT small oligo  21.5      53  0.0011   28.7   1.4   17   24-40    572-588 (681)
 18 PF02411 MerT:  MerT mercuric t  21.1      44 0.00096   23.0   0.7   29   23-64     47-75  (116)
 19 PF12052 VGCC_beta4Aa_N:  Volta  20.8 1.1E+02  0.0023   18.6   2.2   17   60-76     24-40  (42)
 20 PF10777 YlaC:  Inner membrane   20.5      22 0.00047   26.5  -1.0    9   51-59    140-148 (155)
 21 PF09665 RE_Alw26IDE:  Type II   20.3      81  0.0018   27.4   2.2   21   44-64     30-51  (511)

No 1  
>PF15114 UPF0640:  Uncharacterised protein family UPF0640
Probab=100.00  E-value=1.4e-46  Score=244.00  Aligned_cols=68  Identities=62%  Similarity=1.137  Sum_probs=65.7

Q ss_pred             hhhhHHHHHHHHhcCCCcccchhhhhHHHHhhhhhhhhhheeeeeecCcchhhhHHhhHHHHHHHHHHhh
Q psy11705          4 FFYSLRLKRLLKAWPGQKYFGIYRFLPLFFGVGAALEFAMIKWEVNNGEINFYKTYKRNQAVILAEERLS   73 (81)
Q Consensus         4 ~~~s~~ikrll~~~PGK~rfG~YRflP~FF~lGaamE~~MIn~~v~~G~~nFYdvyrRkqae~~~e~rl~   73 (81)
                      ..+|++|++||++||||++||+|||||+||||||||||+||||+|  |+|||||||||||||++||+|++
T Consensus         2 ~~~s~~i~~ll~~~PGK~~fG~YRFLP~FF~lGaalE~~MIn~~v--G~~~FY~tykrrqae~~~e~rl~   69 (69)
T PF15114_consen    2 FLRSRRIRRLLDLWPGKRRFGIYRFLPLFFVLGAALEWSMINWRV--GKENFYDTYKRRQAERQVEQRLK   69 (69)
T ss_pred             chhHHHHHHHHHHCCCccccchhhhhHHHHHhhhhheEEEEEEee--CceeHHHHHHHHHHHHHHHHhcC
Confidence            458999999999999999999999999999999999999999999  99999999999999999999974


No 2  
>PF06305 DUF1049:  Protein of unknown function (DUF1049);  InterPro: IPR010445 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=59.42  E-value=15  Score=21.49  Aligned_cols=50  Identities=20%  Similarity=0.214  Sum_probs=27.4

Q ss_pred             cCCCcccchhhhhHHHHhhhhhhhhhheeeeeecCcchhhhHHhhHHHHHHHHHHhhhhh
Q psy11705         17 WPGQKYFGIYRFLPLFFGVGAALEFAMIKWEVNNGEINFYKTYKRNQAVILAEERLSKLE   76 (81)
Q Consensus        17 ~PGK~rfG~YRflP~FF~lGaamE~~MIn~~v~~G~~nFYdvyrRkqae~~~e~rl~~~~   76 (81)
                      +|+.-....+=++=++|++|+.+=|++-          .....+.|..-+..++++++.+
T Consensus        12 ~~~~~~~pl~l~il~~f~~G~llg~l~~----------~~~~~~~r~~~~~~~k~l~~le   61 (68)
T PF06305_consen   12 LFGQFPLPLGLLILIAFLLGALLGWLLS----------LPSRLRLRRRIRRLRKELKKLE   61 (68)
T ss_pred             EeeeccchHHHHHHHHHHHHHHHHHHHH----------HHHHHHHHHHHHHHHHHHHHHH
Confidence            3343333444456678888888777653          2233455555555555555543


No 3  
>PRK10628 LigB family dioxygenase; Provisional
Probab=51.92  E-value=6.7  Score=30.04  Aligned_cols=13  Identities=38%  Similarity=0.759  Sum_probs=11.3

Q ss_pred             hhhhHHHHhhhhh
Q psy11705         26 YRFLPLFFGVGAA   38 (81)
Q Consensus        26 YRflP~FF~lGaa   38 (81)
                      =-|+|+|+++||+
T Consensus       208 EH~lPL~~alGAa  220 (246)
T PRK10628        208 EHYLPLLYVLGAW  220 (246)
T ss_pred             HHHHHHHHHhcCC
Confidence            3589999999996


No 4  
>PF14142 YrzO:  YrzO-like protein
Probab=51.63  E-value=16  Score=22.39  Aligned_cols=17  Identities=47%  Similarity=0.745  Sum_probs=15.6

Q ss_pred             hHHHHhhhhhhhhhhee
Q psy11705         29 LPLFFGVGAALEFAMIK   45 (81)
Q Consensus        29 lP~FF~lGaamE~~MIn   45 (81)
                      |-+||..|-|-|..-||
T Consensus         5 llff~a~gvacelaain   21 (46)
T PF14142_consen    5 LLFFFAAGVACELAAIN   21 (46)
T ss_pred             HHHHHHHHHHHHHHHHh
Confidence            56899999999999998


No 5  
>TIGR00852 pts-Glc PTS system, maltose and glucose-specific subfamily, IIC component. permeases are in this class, as the cellobiose (Cel) b-glucoside PTS permease is in the Lac family (TC #4.A.3). These permeases show limited sequence similarity with members of the Fru family (TC #4.A.2). Several of the E. coli PTS permeases in the Glc family lack their own IIA domains and instead use the glucose IIA protein (IIAglc or Crr). Most of these permeases have the B and C domains linked together in a single polypeptide chain, and a cysteyl residue in the IIB domain is phosphorylated by direct phosphoryl transfer from IIAglc(his~P). Those permeases which lack a IIA domain include the maltose (Mal), arbutin-salicin-cellobiose (ASC), trehalose (Tre), putative glucoside (Glv) and sucrose (Scr) permeases of E. coli. Most, but not all Scr permeases of other bacteria also lack a IIA domain. This model is specific for the IIC domain of the Glc family PTS transporters.
Probab=50.94  E-value=10  Score=28.54  Aligned_cols=18  Identities=50%  Similarity=0.968  Sum_probs=15.6

Q ss_pred             chhhhhHHHHhhhhhhhh
Q psy11705         24 GIYRFLPLFFGVGAALEF   41 (81)
Q Consensus        24 G~YRflP~FF~lGaamE~   41 (81)
                      .++.|||++|+.++|-.+
T Consensus         3 ~~F~fLPil~a~saak~f   20 (289)
T TIGR00852         3 AAFFFLPLLFAIGAAKGF   20 (289)
T ss_pred             hHHHHHHHHHHHHHHHHh
Confidence            679999999999888765


No 6  
>PF06522 B12D:  NADH-ubiquinone reductase complex 1 MLRQ subunit;  InterPro: IPR010530 The MLRQ subunit of mitochondrial NADH-ubiquinone reductase complex I is nuclear [] and is found in plants [], insects, fungi and higher metazoans []. It appears to act within the membrane and, in mammals, is highly expressed in muscle and neural tissue, indicative of a role in ATP generation [].
Probab=50.51  E-value=7.8  Score=24.39  Aligned_cols=13  Identities=46%  Similarity=0.761  Sum_probs=10.7

Q ss_pred             hhHHHHhhhhhhh
Q psy11705         28 FLPLFFGVGAALE   40 (81)
Q Consensus        28 flP~FF~lGaamE   40 (81)
                      .+|||+++|+|+=
T Consensus         6 l~PL~~~vg~a~~   18 (73)
T PF06522_consen    6 LYPLFVIVGVAVG   18 (73)
T ss_pred             ccchHHHHHHHHH
Confidence            4799999998864


No 7  
>TIGR02002 PTS-II-BC-glcB PTS system, glucose-specific IIBC component. This model represents the combined B and C domains of the PTS transport system enzyme II specific for glucose transport. Many of the genes in this family also include an A domain as part of the same polypeptide and thus should be given the name "PTS system, glucose-specific IIABC component" while the B. subtilus enzyme also contains an enzyme III domain which appears to act independently of the enzyme II domains. This family is most closely related to the N-acetylglucosamine-specific PTS enzymes (TIGR01998).
Probab=37.87  E-value=19  Score=29.83  Aligned_cols=29  Identities=38%  Similarity=0.624  Sum_probs=22.7

Q ss_pred             HHHHHhcCCCcccchhhhhHHHHhhhhhhhhhh
Q psy11705         11 KRLLKAWPGQKYFGIYRFLPLFFGVGAALEFAM   43 (81)
Q Consensus        11 krll~~~PGK~rfG~YRflP~FF~lGaamE~~M   43 (81)
                      -.+++.. |.   .++.|||++|++|+|..+..
T Consensus        56 ~~~l~~~-g~---avF~~LPilfai~~A~~f~~   84 (502)
T TIGR02002        56 SKVMEAA-GG---IIFANLPLIFAIGVALGLAG   84 (502)
T ss_pred             HHHHHHH-HH---HHHHHhHHHHHHHHHHHhcC
Confidence            3445544 44   89999999999999988876


No 8  
>PF08365 IGF2_C:  Insulin-like growth factor II E-peptide;  InterPro: IPR013576  The insulin family of proteins groups together several evolutionarily related active peptides []: these include insulin [, ], relaxin [, ], insect prothoracicotropic hormone (bombyxin) [], insulin-like growth factors (IGF1 and IGF2) [, ], mammalian Leydig cell-specific insulin-like peptide (gene INSL3), early placenta insulin-like peptide (ELIP) (gene INSL4), locust insulin-related peptide (LIRP), molluscan insulin-related peptides (MIP), and Caenorhabditis elegans insulin-like peptides. The 3D structures of a number of family members have been determined [, , ]. The fold comprises two polypeptide chains (A and B) linked by two disulphide bonds: all share a conserved arrangement of 4 cysteines in their A chain, the first of which is linked by a disulphide bond to the third, while the second and fourth are linked by interchain disulphide bonds to cysteines in the B chain.   Insulin is found in many animals, and is involved in the regulation of normal glucose homeostasis. It also has other specific physiological effects, such as increasing the permeability of cells to monosaccharides, amino acids and fatty acids, and accelerating glycolysis and glycogen synthesis in the liver []. Insulin exerts its effects by interaction with a cell-surface receptor, which may also result in the promotion of cell growth [].   Insulin is synthesised as a prepropeptide from which an endoplasmic reticulum-targeting sequence is cleaved to yield proinsulin. The sequence of prosinsulin contains 2 well-conserved regions (designated A and B), separated by an intervening connecting region (C), which is variable between species []. The connecting region is cleaved, liberating the active protein, which contains the A and B chains, held together by 2 disulphide bonds [].  Insulin-like Growth Factor Binding Proteins (IGFBP) are a group of vertebrate secreted proteins, which bind to IGF-I and IGF-II with high affinity and modulate the biological actions of IGFs. The IGFBP family has six distinct subgroups, IGFBP-1 through 6, based on conservation of gene (intron-exon) organisation, structural similarity, and binding affinity for IGFs. Across species, IGFBP-5 exhibits the most sequence conservation, while IGFBP-6 exhibits the least sequence conservation. The IGFBPs contain inhibitor domain homologues, which are related to MEROPS protease inhibitor family I31 (equistatin, clan IX).  All IGFBPs share a common domain architecture (IPR000867 from INTERPRO:IPR000716 from INTERPRO). While the N-terminal (IPR000867 from INTERPRO, IGF binding protein domain), and the C-terminal (IPR000716 from INTERPRO, thyroglobulin type-1 repeat) domains are conserved across vertebrate species, the mid-region is highly variable with respect to protease cleavage sites and phosphorylation and glycosylation sites. IGFBPs contain 16-18 conserved cysteines located in the N-terminal and the C-terminal regions, which form 8-9 disulphide bonds [].   As demonstrated for human IGFBP-5, the N terminus is the primary binding site for IGF. This region, comprised of Val49, Tyr50, Pro62 and Lys68-Leu75, forms a hydrophobic patch on the surface of the protein []. The C terminus is also required for high affinity IGF binding, as well as for binding to the extracellular matrix [] and for nuclear translocation [, ] of IGFBP-3 and -5.   IGFBPs are unusually pleiotropic molecules. Like other binding proteins, IGFBP can prolong the half-life of IGFs via high affinity binding of the ligands. In addition to functioning as simple carrier proteins, serum IGFBPs also serve to regulate the endocrine and paracrine/autocrine actions of IGF by modulating the IGF available to bind to signalling IGF-I receptors [, ]. Furthermore, IGFBPs can function as growth modulators independent of IGFs. For example, IGFBP-5 stimulates markers of bone formation in osteoblasts lacking functional IGFs []. The binding of IGFBP to its putative receptor on the cell membrane may stimulate the signalling pathway independent of an IGF receptor, to mediate the effects of IGFBPs in certain target cell types. IGFBP-1 and -2, but not other IGFBPs, contain a C-terminal Arg-Gly-Asp integrin-binding motif. Thus, IGFBP-1 can also stimulate cell migration of CHO and human trophoblast cells through an action mediated by alpha 5 beta 1 integrin []. Finally, IGFBPs transported into the nucleus (via the nuclear localisation signal) may also exert IGF-independent effects by transcriptional activation of genes. This domain is the C-terminal domain of insulin-like growth factor II proteins (IGF-2, also see IPR004825 from INTERPRO) in vertebrates and seems to represent the E-peptide [, ]. 
Probab=37.61  E-value=23  Score=22.49  Aligned_cols=12  Identities=33%  Similarity=0.614  Sum_probs=10.2

Q ss_pred             hhHHhhHHHHHH
Q psy11705         56 YKTYKRNQAVIL   67 (81)
Q Consensus        56 YdvyrRkqae~~   67 (81)
                      ||||+||.|++.
T Consensus         5 yd~WqrksaqRL   16 (56)
T PF08365_consen    5 YDVWQRKSAQRL   16 (56)
T ss_pred             hhHHHHHHHHHH
Confidence            899999888873


No 9  
>PF05965 FYRC:  F/Y rich C-terminus;  InterPro: IPR003889 The "FY-rich" domain C-terminal region is sometimes closely juxtaposed with the N-terminal region (IPR003888 from INTERPRO), but sometimes is far distant. It is of unknown function, but occurs frequently in chromatin-associated proteins like trithorax and its homologues.; GO: 0005634 nucleus; PDB: 2WZO_A.
Probab=37.56  E-value=25  Score=21.91  Aligned_cols=24  Identities=25%  Similarity=0.573  Sum_probs=17.5

Q ss_pred             hhhHHHHHHHHhcCCCcccchhhh
Q psy11705          5 FYSLRLKRLLKAWPGQKYFGIYRF   28 (81)
Q Consensus         5 ~~s~~ikrll~~~PGK~rfG~YRf   28 (81)
                      +.+..|.++|+.+||-...--|+|
T Consensus        59 ls~p~V~~lie~Lp~a~~c~~Y~f   82 (86)
T PF05965_consen   59 LSNPAVQRLIESLPGADKCSNYKF   82 (86)
T ss_dssp             TTSHHHHHHHTTSTTGGG-TT---
T ss_pred             CCCHHHHHHHHhCCCcchhhcCCc
Confidence            467889999999999988777765


No 10 
>PF00876 Innexin:  Innexin;  InterPro: IPR000990 The pannexin family combines invertebrate gap junction proteins and their vertebrate homologs. These proteins have been named innexins []. Gap junctions are composed of membrane proteins, which form a channel permeable for ions and small molecules connecting cytoplasm of adjacent cells. Although gap junctions provide similar functions in all multicellular organisms, until recently it was believed that vertebrates and invertebrates use unrelated proteins for this purpose. While the connexins family of gap junction proteins is well- characterised in vertebrates, no homologs have been found in invertebrates. In turn, gap junction molecules with no sequence homology to connexins have been identified in insects and nematodes. It has been suggested that these proteins are specific invertebrate gap junctions, and they were thus named innexins (invertebrate analog of connexins) []. As innexin homologs were recently identified in other taxonomic groups including vertebrates, indicating their ubiquitous distribution in the animal kingdom, they were called pannexins (from the Latin pan-all, throughout, and nexus-connection, bond) [, , ]. Genomes of vertebrates carry probably a conserved set of 3 pannexin paralogs (PANX1, PANX2 and PANX3). Invertebrate genomes may contain more than a dozen pannexin (innexin) genes. Vinnexins, viral homologs of pannexins/innexins, were identified in Polydnaviruses that occur in obligate symbiotic associations with parasitoid wasps. It was suggested that virally encoded vinnexin proteins may function to alter gap junction proteins in infected host cells, possibly modifying cell-cell communication during encapsulation responses in parasitized insects [, ]. Structurally pannexins are simillar to connexins. Both types of protein consist of a cytoplasmic N-terminal domain, followed by four transmembrane segments that delimit two extracellular and one cytoplasmic loops; the C- terminal domain is cytoplasmic.; GO: 0005921 gap junction
Probab=35.73  E-value=22  Score=27.46  Aligned_cols=23  Identities=17%  Similarity=0.463  Sum_probs=19.1

Q ss_pred             CCcccchhhhhHHHHhhhhhhhh
Q psy11705         19 GQKYFGIYRFLPLFFGVGAALEF   41 (81)
Q Consensus        19 GK~rfG~YRflP~FF~lGaamE~   41 (81)
                      .++..+.|.|+|++.++-|+|=+
T Consensus        79 ~~~~i~YYQWVPfiL~lQA~lfy  101 (348)
T PF00876_consen   79 EKREISYYQWVPFILLLQAILFY  101 (348)
T ss_pred             ccceEeeehhhHHHHHHHHHHHH
Confidence            45678999999999999998743


No 11 
>PF04741 InvH:  InvH outer membrane lipoprotein;  InterPro: IPR006830 This family represents the Salmonella outer membrane lipoprotein InvH. The molecular function of this protein is unknown, but it is required for the localisation to outer membrane of InvG, which is involved in a type III secretion apparatus mediating host cell invasion [, ].; GO: 0009405 pathogenesis
Probab=33.80  E-value=21  Score=26.36  Aligned_cols=15  Identities=40%  Similarity=0.817  Sum_probs=13.0

Q ss_pred             hhhhhHHHHhhhhhh
Q psy11705         25 IYRFLPLFFGVGAAL   39 (81)
Q Consensus        25 ~YRflP~FF~lGaam   39 (81)
                      .|.-||+|+++|.|-
T Consensus         4 fysclpvf~ligcaq   18 (147)
T PF04741_consen    4 FYSCLPVFLLIGCAQ   18 (147)
T ss_pred             hhhhhhHHHHhhhcc
Confidence            588899999999873


No 12 
>TIGR02986 restrict_Alw26I type II restriction endonuclease, Alw26I/Eco31I/Esp3I family. Members of this family are type II restriction endonucleases of the Alw26I/Eco31I/Esp3I family. Characterized specificities of three members are GGTCTC, CGTCTC, and the shared subsequence GTCTC.
Probab=29.10  E-value=45  Score=28.33  Aligned_cols=21  Identities=33%  Similarity=0.809  Sum_probs=16.5

Q ss_pred             eeeeeecCc-chhhhHHhhHHH
Q psy11705         44 IKWEVNNGE-INFYKTYKRNQA   64 (81)
Q Consensus        44 In~~v~~G~-~nFYdvyrRkqa   64 (81)
                      |+|.+..+. +.||++|.+|.+
T Consensus        30 I~W~~~s~~~~gF~~~~q~R~a   51 (424)
T TIGR02986        30 ISWQVSSKKTTGFYTYYQARRA   51 (424)
T ss_pred             eEEEecCCCCccchHHHHHHHH
Confidence            889886554 569999998865


No 13 
>PF01757 Acyl_transf_3:  Acyltransferase family;  InterPro: IPR002656 This entry contains a range of acyltransferase enzymes as well as yet uncharacterised proteins from Caenorhabditis elegans. It also includes the protein OatA. The pathogenic bacteria, Staphylococcus aureus, is able to cause persistent infections due to its ability to resist the immune defence system. Lysozyme, a cell wall-lytic enzyme, is one of the first defence compounds induced in serum and tissues after the onset of infection.  S. aureus has complete resistance to lysozyme action by O-acetylating its peptidoglycan (PG) by O-acetyltransferase (OatA) [, ]. Staphylococcus bacteria are one of the only bacterial genera that are resistant to lysozyme and tend to colonise the skin and mucosa of humans and animals []. OatA is an integral membrane protein. This entry also includes NolL proteins. NolL-dependent acetylation is specific for the fucosyl penta-N-acetylglucosamine species. In addition, the NolL protein caused elevated production of lipo-chitin oligosaccharides (LCOs). The NolL protein obtained from Rhizobium loti (Mesorhizobium loti) functions as an acetyl transferase [].; GO: 0016747 transferase activity, transferring acyl groups other than amino-acyl groups
Probab=24.36  E-value=73  Score=21.08  Aligned_cols=15  Identities=33%  Similarity=0.388  Sum_probs=11.9

Q ss_pred             hhhHHHHhhhhhhhh
Q psy11705         27 RFLPLFFGVGAALEF   41 (81)
Q Consensus        27 RflP~FF~lGaamE~   41 (81)
                      --+|+||++.|-+=.
T Consensus        47 ~~v~~Ff~iSG~~~~   61 (340)
T PF01757_consen   47 FAVPLFFFISGYLLA   61 (340)
T ss_pred             hHHHHHHHHHHHHHH
Confidence            358999999887655


No 14 
>PF13150 DUF3989:  Protein of unknown function (DUF3989)
Probab=23.58  E-value=57  Score=21.47  Aligned_cols=45  Identities=20%  Similarity=0.184  Sum_probs=31.8

Q ss_pred             hHHHHHHHHhcCCCcccchhhhhHHHHhhhhhhhhhheeeeeecCcchhhhHHhh
Q psy11705          7 SLRLKRLLKAWPGQKYFGIYRFLPLFFGVGAALEFAMIKWEVNNGEINFYKTYKR   61 (81)
Q Consensus         7 s~~ikrll~~~PGK~rfG~YRflP~FF~lGaamE~~MIn~~v~~G~~nFYdvyrR   61 (81)
                      ..++|++++.+|.++|..+   +=..|++-|++=..|+       -..+|+.=|.
T Consensus        12 ~~~Lr~~c~~Lsp~~R~~v---vl~ml~~fa~l~ly~~-------~~ai~~~Gk~   56 (85)
T PF13150_consen   12 DDRLRRYCGRLSPKQRLRV---VLVMLVLFAALCLYMT-------VSAIYDIGKE   56 (85)
T ss_pred             HHHHHHHHhcCCHHHHHHH---HHHHHHHHHHHHHHHH-------HHHHHHhccC
Confidence            3679999999999988765   4455566666666676       2567777543


No 15 
>PRK00888 ftsB cell division protein FtsB; Reviewed
Probab=22.91  E-value=2.4e+02  Score=18.75  Aligned_cols=41  Identities=17%  Similarity=0.304  Sum_probs=25.4

Q ss_pred             HHHhhhhhhhhhheeeeeecCcchhhhHHhhHHHHHHHHHHhhhhh
Q psy11705         31 LFFGVGAALEFAMIKWEVNNGEINFYKTYKRNQAVILAEERLSKLE   76 (81)
Q Consensus        31 ~FF~lGaamE~~MIn~~v~~G~~nFYdvyrRkqae~~~e~rl~~~~   76 (81)
                      +++++-+.+.+.++.     |.-++-+..+-++-..+.++++++.+
T Consensus         7 vll~ll~~l~y~l~~-----g~~G~~~~~~l~~q~~~~~~e~~~l~   47 (105)
T PRK00888          7 LLLALLVWLQYSLWF-----GKNGILDYWRVNDQVAAQQQTNAKLK   47 (105)
T ss_pred             HHHHHHHHHHHHHhc-----cCCcHHHHHHHHHHHHHHHHHHHHHH
Confidence            455666777777774     77777666555555555555555443


No 16 
>TIGR01996 PTS-II-BC-sucr PTS system, sucrose-specific IIBC component. This family is closely related to the trehalose transporting PTS IIBC enzymes and the B and C domains of each are described by subfamily-domain level TIGRFAMs models (TIGR00826 and TIGR00852, respectively).
Probab=22.28  E-value=49  Score=26.87  Aligned_cols=26  Identities=23%  Similarity=0.595  Sum_probs=17.8

Q ss_pred             HHHHHhcCCCcccchhhhhHHHHhhhhhhh
Q psy11705         11 KRLLKAWPGQKYFGIYRFLPLFFGVGAALE   40 (81)
Q Consensus        11 krll~~~PGK~rfG~YRflP~FF~lGaamE   40 (81)
                      -.+++.. |+   .++.|||++|+.++|=+
T Consensus       153 ~~il~~i-~~---a~f~fLPil~a~s~AKk  178 (461)
T TIGR01996       153 AEMINVF-TS---TAFAFLPILIGFSAAKR  178 (461)
T ss_pred             HHHHHHH-HH---HHHHHHHHHHHHHHHHH
Confidence            3445444 44   78999999999776543


No 17 
>TIGR00727 ISP4_OPT small oligopeptide transporter, OPT family. This model represents a family of transporters of small oligopeptides, demonstrated experimentally in three different species of yeast. A set of related proteins from the plant Arabidopsis thaliana forms an outgroup to the yeast set by neighbor joining analysis but is remarkably well conserved and is predicted here to have equivalent function.
Probab=21.53  E-value=53  Score=28.70  Aligned_cols=17  Identities=35%  Similarity=0.495  Sum_probs=15.2

Q ss_pred             chhhhhHHHHhhhhhhh
Q psy11705         24 GIYRFLPLFFGVGAALE   40 (81)
Q Consensus        24 G~YRflP~FF~lGaamE   40 (81)
                      |.|..||.||++||++=
T Consensus       572 ~~Y~~l~~~fliGa~~p  588 (681)
T TIGR00727       572 YIYPGLKWFWLIGACIG  588 (681)
T ss_pred             CcchHHHHHHHHHHHHH
Confidence            37999999999999983


No 18 
>PF02411 MerT:  MerT mercuric transport protein;  InterPro: IPR003457 MerT is an mercuric transport integral membrane protein and is responsible for transport of the Hg2+ iron from periplasmic MerP (also part of the transport system) to mercuric reductase (MerA).; GO: 0015097 mercury ion transmembrane transporter activity, 0015694 mercury ion transport, 0016020 membrane
Probab=21.14  E-value=44  Score=23.02  Aligned_cols=29  Identities=24%  Similarity=0.548  Sum_probs=18.1

Q ss_pred             cchhhhhHHHHhhhhhhhhhheeeeeecCcchhhhHHhhHHH
Q psy11705         23 FGIYRFLPLFFGVGAALEFAMIKWEVNNGEINFYKTYKRNQA   64 (81)
Q Consensus        23 fG~YRflP~FF~lGaamE~~MIn~~v~~G~~nFYdvyrRkqa   64 (81)
                      +.+||  |+|.++-.+.           -.-.||+.||++++
T Consensus        47 lepyR--p~fi~~tl~~-----------lg~a~~~~yr~~~~   75 (116)
T PF02411_consen   47 LEPYR--PYFIALTLLF-----------LGYAFWRLYRPRKA   75 (116)
T ss_pred             HHhHH--HHHHHHHHHH-----------HHHHHHHHHccccc
Confidence            46777  7776554332           23678999987653


No 19 
>PF12052 VGCC_beta4Aa_N:  Voltage gated calcium channel subunit beta domain 4Aa N terminal;  InterPro: IPR000584 Ca2+ ions are unique in that they not only carry charge but they are also the most widely used of diffusible second messengers. Voltage-dependent Ca2+ channels (VDCC) are a family of molecules that allow cells to couple electrical activity to intracellular Ca2+ signalling. The opening and closing of these channels by depolarizing stimuli, such as action potentials, allows Ca2+ ions to enter neurons down a steep electrochemical gradient, producing transient intracellular Ca2+ signals. Many of the processes that occur in neurons, including transmitter release, gene transcription and metabolism are controlled by Ca2+ influx occurring simultaneously at different cellular locales. The pore is formed by the alpha-1 subunit which incorporates the conduction pore, the voltage sensor and gating apparatus, and the known sites of channel regulation by second messengers, drugs, and toxins []. The activity of this pore is modulated by 4 tightly-coupled subunits: an intracellular beta subunit; a transmembrane gamma subunit; and a disulphide-linked complex of alpha-2 and delta subunits, which are proteolytically cleaved from the same gene product. Properties of the protein including gating voltage-dependence, G protein modulation and kinase susceptibility can be influenced by these subunits. Voltage-gated calcium channels are classified as T, L, N, P, Q and R, and are distinguished by their sensitivity to pharmacological blocks, single-channel conductance kinetics, and voltage-dependence. On the basis of their voltage activation properties, the voltage-gated calcium classes can be further divided into two broad groups: the low (T-type) and high (L, N, P, Q and R-type) threshold-activated channels. Co-expression of beta subunit mRNA with alpha-1 subunit mRNA in xenopus oocytes produces increased calcium currents, which are accompanied by a shift in the voltage-dependence of activation to more negative membrane potentials. Conversely, microinjection of antisense oligonucleotides to beta subunit mRNA produces decreased calcium currents and shifts voltage-dependent activation to more positive membrane potentials. There are four distinct beta subunits: beta-1, beta-2, beta-3 and beta-4; and the magnitude of the shift in the voltage-dependence of activation of change to membrane potentials varies with the particular subtype []. This entry represents the beta subunits found in L-type voltage-gated calcium channels.; GO: 0005245 voltage-gated calcium channel activity, 0006816 calcium ion transport, 0051925 regulation of calcium ion transport via voltage-gated calcium channel activity; PDB: 1T0J_A 1T0H_A 2D46_A 1T3S_A 1T3L_A 4DEY_A 4DEX_A 1VYT_B 1VYU_A.
Probab=20.85  E-value=1.1e+02  Score=18.55  Aligned_cols=17  Identities=29%  Similarity=0.190  Sum_probs=13.5

Q ss_pred             hhHHHHHHHHHHhhhhh
Q psy11705         60 KRNQAVILAEERLSKLE   76 (81)
Q Consensus        60 rRkqae~~~e~rl~~~~   76 (81)
                      -|+.+|+++..+|+.+.
T Consensus        24 lRre~erqA~~QLekAk   40 (42)
T PF12052_consen   24 LRREAERQALAQLEKAK   40 (42)
T ss_dssp             HHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHHhh
Confidence            57888999888887764


No 20 
>PF10777 YlaC:  Inner membrane protein YlaC;  InterPro: IPR019713  The extracytoplasmic function (ECF) sigma factors are small regulatory proteins that are quite divergent in sequence relative to most other sigma factors. YlaC, regulated by YlaA, is important in oxidative stress resistance. It contributes to hydrogen peroxide resistance in Bacillus subtilis []. 
Probab=20.47  E-value=22  Score=26.49  Aligned_cols=9  Identities=67%  Similarity=1.412  Sum_probs=4.8

Q ss_pred             CcchhhhHH
Q psy11705         51 GEINFYKTY   59 (81)
Q Consensus        51 G~~nFYdvy   59 (81)
                      |+..|||||
T Consensus       140 gei~FYDVy  148 (155)
T PF10777_consen  140 GEISFYDVY  148 (155)
T ss_pred             CceeEEEeE
Confidence            455555554


No 21 
>PF09665 RE_Alw26IDE:  Type II restriction endonuclease (RE_Alw26IDE);  InterPro: IPR014328 There are four classes of restriction endonucleases: types I, II,III and IV. All types of enzymes recognise specific short DNA sequences and carry out the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates. They differ in their recognition sequence, subunit composition, cleavage position, and cofactor requirements [, ], as summarised below:   Type I enzymes (3.1.21.3 from EC) cleave at sites remote from recognition site; require both ATP and S-adenosyl-L-methionine to function; multifunctional protein with both restriction and methylase (2.1.1.72 from EC) activities. Type II enzymes (3.1.21.4 from EC) cleave within or at short specific distances from recognition site; most require magnesium; single function (restriction) enzymes independent of methylase. Type III enzymes (3.1.21.5 from EC) cleave at sites a short distance from recognition site; require ATP (but doesn't hydrolyse it); S-adenosyl-L-methionine stimulates reaction but is not required; exists as part of a complex with a modification methylase methylase (2.1.1.72 from EC). Type IV enzymes target methylated DNA.   Type II restriction endonucleases (3.1.21.4 from EC) are components of prokaryotic DNA restriction-modification mechanisms that protect the organism against invading foreign DNA. These site-specific deoxyribonucleases catalyse the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates. Of the 3000 restriction endonucleases that have been characterised, most are homodimeric or tetrameric enzymes that cleave target DNA at sequence-specific sites close to the recognition site. For homodimeric enzymes, the recognition site is usually a palindromic sequence 4-8 bp in length. Most enzymes require magnesium ions as a cofactor for catalysis. Although they can vary in their mode of recognition, many restriction endonucleases share a similar structural core comprising four beta-strands and one alpha-helix, as well as a similar mechanism of cleavage, suggesting a common ancestral origin []. However, there is still considerable diversity amongst restriction endonucleases [, ]. The target site recognition process triggers large conformational changes of the enzyme and the target DNA, leading to the activation of the catalytic centres. Like other DNA binding proteins, restriction enzymes are capable of non-specific DNA binding as well, which is the prerequisite for efficient target site location by facilitated diffusion. Non-specific binding usually does not involve interactions with the bases but only with the DNA backbone [].  This entry represents type II restriction endonucleases of the Alw26I/Eco31I/Esp3I family [], whose recognition sequences are 5'-GTCTC-3' (Alw26I), 5'-GGTCTC-3' (Eco31I) and 5'-CGTCTC-3' (Esp3I).
Probab=20.31  E-value=81  Score=27.42  Aligned_cols=21  Identities=38%  Similarity=0.893  Sum_probs=15.5

Q ss_pred             eeeeeecC-cchhhhHHhhHHH
Q psy11705         44 IKWEVNNG-EINFYKTYKRNQA   64 (81)
Q Consensus        44 In~~v~~G-~~nFYdvyrRkqa   64 (81)
                      |+|.+..+ .+.||++|.+|-+
T Consensus        30 I~W~a~s~~~~gF~~t~q~R~~   51 (511)
T PF09665_consen   30 IQWEAPSNRTSGFYDTYQKRRA   51 (511)
T ss_pred             eEEEecCCCCCcchHHHHHHHH
Confidence            67777544 3569999998865


Done!