Diaphorina citri psyllid: psy11707

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------
MSSSSGSMKKIVEINDYLLGTLAGGAADCVYWDRVLAKQCRLYELRNGERISVAAASKLMCNMAYNYKGTGLSMGMMIAGWDKRGPQLYYVDSDGQRIKGNVFSVGSGSVFAFGVLDTGYHWNLTDEEAHQLARKSIYHATYRDFASGGLIRGNASGQQWNQGRFLGHQKGPNSGRS
cEEEccccccEEEEcccEEEEccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccEEEEEEEEEcccccEEEEEcccccEEEEcEEEccccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccccEEEEEEcccccEEEEEccccccccccc
MSSSSGSMKKIVEINDYLLGTLAGGAADCVYWDRVLAKQCRLYELRNGERISVAAASKLMCNMAYNYKGTGLSMGMMIAGWDKRGPQLYYVDSDGQRIKGNVFSVGSGSVFAFGVLDTGYHWNLTDEEAHQLARKSIYHATYRDFASGGLIRGNASGQQWNQGRFLG**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSSSGSMKKIVEINDYLLGTLAGGAADCVYWDRVLAKQCRLYELRNGERISVAAASKLMCNMAYNYKGTGLSMGMMIAGWDKRGPQLYYVDSDGQRIKGNVFSVGSGSVFAFGVLDTGYHWNLTDEEAHQLARKSIYHATYRDFASGGLIRGNASGQQWNQGRFLGHQKGPNSGRS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Proteasome subunit beta 2 Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.confidentC3MZI0
Proteasome subunit beta type-5 The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.confidentQ54BC8
Proteasome subunit beta Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.confidentD2RGT4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0019774 [CC]proteasome core complex, beta-subunit complexprobableGO:0043234, GO:0032991, GO:0005839, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0000502
GO:0044281 [BP]small molecule metabolic processprobableGO:0044710, GO:0008150, GO:0008152
GO:0051297 [BP]centrosome organizationprobableGO:0006996, GO:0031023, GO:0007010, GO:0009987, GO:0016043, GO:0008150, GO:0007017, GO:0044763, GO:0071840, GO:0000226, GO:0044699
GO:0005654 [CC]nucleoplasmprobableGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0016071 [BP]mRNA metabolic processprobableGO:0016070, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:1901360, GO:0046483
GO:0008283 [BP]cell proliferationprobableGO:0008150, GO:0044699
GO:0006977 [BP]DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrestprobableGO:0051726, GO:0044699, GO:0010948, GO:0044773, GO:0044774, GO:0007165, GO:0035556, GO:0072331, GO:0050789, GO:0072401, GO:0090068, GO:0051716, GO:2000134, GO:0031570, GO:0031571, GO:0072395, GO:0010564, GO:0071158, GO:0065007, GO:1901988, GO:0048518, GO:0048519, GO:0071156, GO:1901990, GO:0030330, GO:0008150, GO:0009987, GO:0007346, GO:0050794, GO:0006974, GO:1901987, GO:0006950, GO:0044763, GO:0023052, GO:0007154, GO:0072413, GO:0042770, GO:0044700, GO:0007049, GO:0000077, GO:2000045, GO:0000075, GO:0072431, GO:0022402, GO:0072422, GO:0033554, GO:1901991, GO:0044783, GO:0007093, GO:0050896, GO:0048523, GO:0048522
GO:0006979 [BP]response to oxidative stressprobableGO:0006950, GO:0008150, GO:0050896
GO:0006521 [BP]regulation of cellular amino acid metabolic processprobableGO:0080090, GO:0019222, GO:0031323, GO:0010565, GO:0050794, GO:0033238, GO:0065007, GO:0051171, GO:0008150, GO:0050789
GO:0000084 [BP]S phase of mitotic cell cycleprobableGO:0051325, GO:0044699, GO:0000278, GO:0009987, GO:0051329, GO:0008150, GO:0022402, GO:0022403, GO:0044763, GO:0007049, GO:0051320
GO:0000082 [BP]G1/S transition of mitotic cell cycleprobableGO:0051325, GO:0044699, GO:0000278, GO:0008150, GO:0009987, GO:0051329, GO:0044770, GO:0044772, GO:0022402, GO:0022403, GO:0044763, GO:0007049
GO:0043232 [CC]intracellular non-membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0010499 [BP]proteasomal ubiquitin-independent protein catabolic processprobableGO:0051603, GO:1901575, GO:0044265, GO:0044260, GO:0044267, GO:0019538, GO:0009056, GO:0009987, GO:0010498, GO:0044237, GO:0043170, GO:0044248, GO:0071704, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0006508, GO:0044238, GO:0009057
GO:0000209 [BP]protein polyubiquitinationprobableGO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0004298 [MF]threonine-type endopeptidase activityprobableGO:0016787, GO:0004175, GO:0003824, GO:0070003, GO:0070011, GO:0003674, GO:0008233
GO:0042981 [BP]regulation of apoptotic processprobableGO:0050794, GO:0043067, GO:0008150, GO:0065007, GO:0010941, GO:0050789
GO:0022008 [BP]neurogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699
GO:0005774 [CC]vacuolar membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044437, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0000022 [BP]mitotic spindle elongationprobableGO:0006996, GO:0044699, GO:0007017, GO:0007010, GO:0000278, GO:0071822, GO:0043933, GO:0071840, GO:0009987, GO:0000226, GO:0008150, GO:0007051, GO:0007052, GO:0022402, GO:0007049, GO:0044763, GO:0051231, GO:0016043
GO:0044445 [CC]cytosolic partprobableGO:0005737, GO:0005829, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005635 [CC]nuclear envelopeprobableGO:0005575, GO:0005623, GO:0005634, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0000216 [BP]M/G1 transition of mitotic cell cycleprobable
GO:0051437 [BP]positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycleprobableGO:0009893, GO:0019222, GO:0031325, GO:0031323, GO:0051439, GO:0051438, GO:0050789, GO:0007049, GO:0080090, GO:0051340, GO:0010604, GO:0051246, GO:0051247, GO:0032270, GO:0044699, GO:0031398, GO:0031399, GO:0031396, GO:0065007, GO:0065009, GO:0043085, GO:0009987, GO:0000278, GO:0060255, GO:0050790, GO:0050794, GO:0048518, GO:0044763, GO:0032268, GO:0051443, GO:0022402, GO:0031401, GO:0051351, GO:0008150, GO:0044093, GO:0048522
GO:0051436 [BP]negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycleprobableGO:0009892, GO:0080090, GO:0019222, GO:0031324, GO:0031323, GO:0031399, GO:0022402, GO:0051438, GO:0043086, GO:0044699, GO:0051248, GO:0051340, GO:0010605, GO:0051246, GO:0050789, GO:0065007, GO:0007049, GO:0044092, GO:0031396, GO:0031397, GO:0065009, GO:0009987, GO:0000278, GO:0060255, GO:0051439, GO:0050790, GO:0050794, GO:0044763, GO:0048519, GO:0051444, GO:0032269, GO:0032268, GO:0031400, GO:0051352, GO:0008150, GO:0048523
GO:0002479 [BP]antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependentprobableGO:0002474, GO:0019882, GO:0019884, GO:0002478, GO:0002376, GO:0042590, GO:0008150, GO:0048002
GO:0006915 [BP]apoptotic processprobableGO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0031145 [BP]anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic processprobableGO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0043161, GO:0071704, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0010498, GO:0044237, GO:0043170, GO:0006511
GO:0010467 [BP]gene expressionprobableGO:0071704, GO:0008150, GO:0008152, GO:0043170
GO:0016032 [BP]viral reproductionprobableGO:0009987, GO:0044764, GO:0008150, GO:0051704

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.25.-Threonine endopeptidases.probable
3.4.25.1Transferred entry: 3.4.25.1.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1IRU, chain L
Confidence level:very confident
Coverage over the Query: 3-172
View the alignment between query and template
View the model in PyMOL