Query         psy11715
Match_columns 118
No_of_seqs    29 out of 31
Neff          2.2 
Searched_HMMs 46136
Date          Fri Aug 16 17:06:01 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy11715.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/11715hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3038|consensus               99.2   2E-11 4.4E-16  100.3   3.5   57   60-117    68-128 (264)
  2 KOG3362|consensus               33.0      19 0.00041   28.5   0.7   26   34-59    116-143 (156)
  3 PF05179 CDC73:  RNA pol II acc  27.0      24 0.00053   28.8   0.4   12   35-46    215-226 (273)
  4 COG0647 NagD Predicted sugar p  26.6      48   0.001   27.2   2.0   27   74-100   167-193 (269)
  5 PRK09993 C-lysozyme inhibitor;  26.4      36 0.00077   26.7   1.2   26   76-103    39-64  (153)
  6 PHA00687 hypothetical protein   25.6      37  0.0008   22.8   1.0   12   79-90     14-25  (56)
  7 cd08806 CARD_CARD14_CARMA2 Cas  20.0      54  0.0012   23.6   1.0   33   55-87     27-62  (86)
  8 PF08199 E2:  Bacteriophage E2-  19.5      35 0.00076   21.4  -0.1   13   36-48     21-33  (37)
  9 cd02929 TMADH_HD_FMN Trimethyl  18.0      40 0.00086   28.0  -0.1   14   45-58    338-351 (370)
 10 PF06217 GAGA_bind:  GAGA bindi  17.7      76  0.0016   27.2   1.5   29   60-90    247-275 (301)

No 1  
>KOG3038|consensus
Probab=99.16  E-value=2e-11  Score=100.28  Aligned_cols=57  Identities=42%  Similarity=0.730  Sum_probs=52.9

Q ss_pred             ccchhhhhhcc----ccchhhhhHHHHHHHhhccccceeccCCCCCCCCcccccCCCCCCcc
Q psy11715         60 NNLFTLARITG----CKEVMRKSAYMKMLKSSAHTLPLWVGKPGQKPAALVGAIPADPSHIA  117 (118)
Q Consensus        60 eErRiaAkiAG----prktMRRGVLMkmLQqsA~TLPLWIGKpgekPPpLCGAIPA~~~YvA  117 (118)
                      .|+.|.+.++|    +.++|||+++|.++++++.+||+|+|+++ .||++|||||++++|++
T Consensus        68 ~e~l~~~~~~~~~~~~~~~~~r~~~~el~k~~~~~lp~~~~~~~-~~p~~~gaip~~~~~~~  128 (264)
T KOG3038|consen   68 SEILITQLDLGRPEGPTGQMRRGVLMELLKQKAMTLPLWIGKPG-KPPPLCGAIPAQGDYVL  128 (264)
T ss_pred             HHHHHHHHHhcccCCccchhhhhhhhhHHhhhccccccccCCCC-CCCcccccccccCCccc
Confidence            56778888888    77899999999999999999999999999 99999999999999975


No 2  
>KOG3362|consensus
Probab=33.03  E-value=19  Score=28.53  Aligned_cols=26  Identities=31%  Similarity=0.717  Sum_probs=21.3

Q ss_pred             hhhhhhhccccchhhhhhhcC--CCccc
Q psy11715         34 KAELFHNFCGYHSITKCLLCN--QCPFF   59 (118)
Q Consensus        34 ~~~~~~~~~~~~~~~~~~~~~--~~sl~   59 (118)
                      -..-|-+.|||-|+.-|..|+  .||+.
T Consensus       116 P~r~fCaVCG~~S~ysC~~CG~kyCsv~  143 (156)
T KOG3362|consen  116 PLRKFCAVCGYDSKYSCVNCGTKYCSVR  143 (156)
T ss_pred             CcchhhhhcCCCchhHHHhcCCceeech
Confidence            345578899999999999997  58775


No 3  
>PF05179 CDC73:  RNA pol II accessory factor, Cdc73 family;  InterPro: IPR007852 Paf1 is an RNA polymerase II-associated protein in yeast, which defines a complex that is distinct from the Srb/Mediator holoenzyme. The Paf1 complex, which also contains Cdc73, Ctr9, Hpr1, Ccr4, Rtf1 and Leo1, is required for full expression of a subset of yeast genes, particularly those responsive to signals from the Pkc1/MAP kinase cascade. The complex appears to play an essential role in RNA elongation []. ; PDB: 3V46_A.
Probab=26.98  E-value=24  Score=28.80  Aligned_cols=12  Identities=33%  Similarity=0.625  Sum_probs=10.7

Q ss_pred             hhhhhhccccch
Q psy11715         35 AELFHNFCGYHS   46 (118)
Q Consensus        35 ~~~~~~~~~~~~   46 (118)
                      +|||++.||||-
T Consensus       215 ~~LF~~v~gf~~  226 (273)
T PF05179_consen  215 VELFQKVKGFYV  226 (273)
T ss_dssp             HHHHHHSEEEEE
T ss_pred             HHHhhcCcEEEE
Confidence            589999999985


No 4  
>COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism]
Probab=26.60  E-value=48  Score=27.16  Aligned_cols=27  Identities=22%  Similarity=0.311  Sum_probs=23.6

Q ss_pred             hhhhhHHHHHHHhhccccceeccCCCC
Q psy11715         74 VMRKSAYMKMLKSSAHTLPLWVGKPGQ  100 (118)
Q Consensus        74 tMRRGVLMkmLQqsA~TLPLWIGKpge  100 (118)
                      ..--|.++.++.+....-|.|+|||..
T Consensus       167 ~pgaGai~~~~~~~tg~~~~~~GKP~~  193 (269)
T COG0647         167 RPGAGAIAALLEQATGREPTVIGKPSP  193 (269)
T ss_pred             ccCcHHHHHHHHHhhCCcccccCCCCH
Confidence            355799999999999999999999964


No 5  
>PRK09993 C-lysozyme inhibitor; Provisional
Probab=26.38  E-value=36  Score=26.73  Aligned_cols=26  Identities=35%  Similarity=0.643  Sum_probs=21.4

Q ss_pred             hhhHHHHHHHhhccccceeccCCCCCCC
Q psy11715         76 RKSAYMKMLKSSAHTLPLWVGKPGQKPA  103 (118)
Q Consensus        76 RRGVLMkmLQqsA~TLPLWIGKpgekPP  103 (118)
                      =|-++.+|++.+  +||.||-+.|..+|
T Consensus        39 yk~aw~~mvkg~--~LP~WV~~gGtssP   64 (153)
T PRK09993         39 TKAAFNQMVQGH--KLPAWVMKGGTYSP   64 (153)
T ss_pred             HHHHHHHHHcCC--CCcHHHHcCCCCCc
Confidence            456788999888  69999998777776


No 6  
>PHA00687 hypothetical protein
Probab=25.62  E-value=37  Score=22.83  Aligned_cols=12  Identities=33%  Similarity=0.570  Sum_probs=9.9

Q ss_pred             HHHHHHHhhccc
Q psy11715         79 AYMKMLKSSAHT   90 (118)
Q Consensus        79 VLMkmLQqsA~T   90 (118)
                      ..|.+|||.|+|
T Consensus        14 eamrllqqaaqt   25 (56)
T PHA00687         14 EAMRLLQQAAQT   25 (56)
T ss_pred             HHHHHHHHHhcC
Confidence            457899999987


No 7  
>cd08806 CARD_CARD14_CARMA2 Caspase activation and recruitment domain of CARD14-like proteins. Caspase activation and recruitment domain (CARD) similar to that found in CARD14, also known as BIMP2 or CARMA2 (caspase recruitment domain-containing membrane-associated guanylate kinase protein 2). CARD14 has been identified as a novel member of the MAGUK (membrane-associated guanylate kinase) family that functions as upstream activators of BCL10 (B-cell lymphoma 10) and NF-kB signaling. In general, CARDs are death domains (DDs) found associated with caspases. They are known to be important in the signaling pathways for apoptosis, inflammation, and host-defense mechanisms. DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including PYRIN and DED (Death Effector Domain). They serve as adaptors in signaling pathways 
Probab=19.97  E-value=54  Score=23.64  Aligned_cols=33  Identities=18%  Similarity=0.196  Sum_probs=24.0

Q ss_pred             CCccc---ccchhhhhhccccchhhhhHHHHHHHhh
Q psy11715         55 QCPFF---NNLFTLARITGCKEVMRKSAYMKMLKSS   87 (118)
Q Consensus        55 ~~sl~---eErRiaAkiAGprktMRRGVLMkmLQqs   87 (118)
                      ||-++   .|..|.+......++||-|.|+.+|+-.
T Consensus        27 Q~~IL~~~deeeIls~~t~~~r~~k~g~LLDIL~tr   62 (86)
T cd08806          27 QAKVLDQLDEEEVLHSPRLTNRAMRVGHLLDLLKTR   62 (86)
T ss_pred             HcCCCChhhHHHHHccchHHHHHHHHHHHHHHHHhc
Confidence            55555   4555666656677899999999999854


No 8  
>PF08199 E2:  Bacteriophage E2-like protein;  InterPro: IPR013184 This is a family of short conserved proteins of 37 amino acids, described in Lactococcus phage c2 and in related phage. The function of these proteins is unknown.
Probab=19.46  E-value=35  Score=21.42  Aligned_cols=13  Identities=46%  Similarity=0.935  Sum_probs=10.2

Q ss_pred             hhhhhccccchhh
Q psy11715         36 ELFHNFCGYHSIT   48 (118)
Q Consensus        36 ~~~~~~~~~~~~~   48 (118)
                      +-|.|||-|..|.
T Consensus        21 dnfsnfc~ynfi~   33 (37)
T PF08199_consen   21 DNFSNFCHYNFIG   33 (37)
T ss_pred             hccccceeeeeee
Confidence            4588999998764


No 9  
>cd02929 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain.  TMADH is an iron-sulfur flavoprotein that catalyzes the oxidative demethylation of trimethylamine to form dimethylamine and formaldehyde. The protein forms a symetrical dimer with each subunit containing one 4Fe-4S cluster and one FMN cofactor.  It contains a unique flavin, in the form of a 6-S-cysteinyl FMN  which is bent by ~25 degrees along the N5-N10 axis of the flavin isoalloxazine ring. This modification of the conformation of the flavin is thought to facilitate catalysis.The closely related histamine dehydrogenase catalyzes oxidative deamination of histamine.
Probab=18.02  E-value=40  Score=27.96  Aligned_cols=14  Identities=36%  Similarity=0.840  Sum_probs=11.3

Q ss_pred             chhhhhhhcCCCcc
Q psy11715         45 HSITKCLLCNQCPF   58 (118)
Q Consensus        45 ~~~~~~~~~~~~sl   58 (118)
                      ..|..|..||+|-.
T Consensus       338 ~~i~~Ci~Cn~C~~  351 (370)
T cd02929         338 DDIRECIGCNICIS  351 (370)
T ss_pred             cccccCCchhhhhc
Confidence            35888999999943


No 10 
>PF06217 GAGA_bind:  GAGA binding protein-like family;  InterPro: IPR010409 This family includes gbp a protein from Soybean that binds to GAGA element dinucleotide repeat DNA []. It seems likely that the region which defines this family mediates DNA binding. This putative domain contains several conserved cysteines and a histidine suggesting this may be a zinc-binding DNA interaction domain.
Probab=17.66  E-value=76  Score=27.15  Aligned_cols=29  Identities=34%  Similarity=0.307  Sum_probs=23.3

Q ss_pred             ccchhhhhhccccchhhhhHHHHHHHhhccc
Q psy11715         60 NNLFTLARITGCKEVMRKSAYMKMLKSSAHT   90 (118)
Q Consensus        60 eErRiaAkiAGprktMRRGVLMkmLQqsA~T   90 (118)
                      .-.|--|||+|-|  |..||+.+||.--|..
T Consensus       247 ~~nkRgaRi~GRK--MS~gAF~KlL~rLAaE  275 (301)
T PF06217_consen  247 SPNKRGARIGGRK--MSGGAFKKLLERLAAE  275 (301)
T ss_pred             CCCCCcccccccc--ccHHHHHHHHHHHHhc
Confidence            4455568899988  9999999999877653


Done!