Diaphorina citri psyllid: psy11746


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170--
MCAYHTCFVLQVVDKMLSEDIAHLMQQIPMDDEARVAAPVLKGGAFDGVKDMVSPFGYKRGEGIDAGQGEPDWIVNKDRHKYDSIFSSLNPVDGKVTGANAKAEMVKSKLPNSVLGKIWKLSDVDKDGFLDADEFALAMHLIQVKIGGYDIPTELPDHLVPPSKRGDARPEE
cccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccc
MCAYHTCFVLQVVDKMLSEDIAHLMQQIPMDDEA*******KGG*FDGVKDMVSPFGYKRGEGIDAGQGEPDWIVNKDRHKYDSIFSSLNPVDGKVTGANAKAEMVKSKLPNSVLGKIWKLSDVDKDGFLDADEFALAMHLIQVKIGGYDIPTELPDH**************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCAYHTCFVLQVVDKMLSEDIAHLMQQIPMDDEARVAAPVLKGGAFDGVKDMVSPFGYKRGEGIDAGQGEPDWIVNKDRHKYDSIFSSLNPVDGKVTGANAKAEMVKSKLPNSVLGKIWKLSDVDKDGFLDADEFALAMHLIQVKIGGYDIPTELPDHLVPPSKRGDARPEE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
EH domain-containing protein 1 Acts in early endocytic membrane fusion and membrane trafficking of recycling endosomes.confidentQ5RBP4
Actin cytoskeleton-regulatory complex protein END3 Component of the PAN1 actin cytoskeleton-regulatory complex required for the internalization of endosomes during actin-coupled endocytosis. The complex links the site of endocytosis to the cell membrane-associated actin cytoskeleton. Mediates uptake of external molecules and vacuolar degradation of plasma membrane proteins. Plays a role in the proper organization of the cell membrane-associated actin cytoskeleton and promotes its destabilization.confidentQ755V2
EH domain-containing protein 1 Acts in early endocytic membrane fusion and membrane trafficking of recycling endosomes.confidentQ9H4M9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0055038 [CC]recycling endosome membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0043227, GO:0055037, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0044444, GO:0044440, GO:0044424, GO:0005622, GO:0005768, GO:0043226, GO:0044422, GO:0010008
GO:0007596 [BP]blood coagulationprobableGO:0032501, GO:0007599, GO:0044707, GO:0050878, GO:0050896, GO:0009611, GO:0042060, GO:0006950, GO:0050817, GO:0008150, GO:0065007, GO:0065008, GO:0044699
GO:0043332 [CC]mating projection tipprobableGO:0044464, GO:0044463, GO:0030427, GO:0005623, GO:0005575, GO:0005937, GO:0042995
GO:0006886 [BP]intracellular protein transportprobableGO:0033036, GO:0034613, GO:0046907, GO:0070727, GO:0006810, GO:0045184, GO:0008104, GO:0044763, GO:0044699, GO:0071702, GO:0015031, GO:0008150, GO:0009987, GO:0051234, GO:0051179, GO:0051649, GO:0051641
GO:0032456 [BP]endocytic recyclingprobableGO:0016197, GO:0009987, GO:0016192, GO:0046907, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0006200 [BP]ATP catabolic processprobableGO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0042278, GO:0071704, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0009203, GO:0044238, GO:0046034, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0006897 [BP]endocytosisprobableGO:0006810, GO:0008150, GO:0016192, GO:0051234, GO:0051179
GO:0031095 [CC]platelet dense tubular network membraneprobableGO:0031094, GO:0031090, GO:0016020, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0003676 [MF]nucleic acid bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0005488
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0031901 [CC]early endosome membraneprobableGO:0005737, GO:0005575, GO:0043226, GO:0031090, GO:0043227, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0044444, GO:0044440, GO:0044424, GO:0005622, GO:0005768, GO:0005769, GO:0044422, GO:0010008
GO:0019904 [MF]protein domain specific bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0016887 [MF]ATPase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0005938 [CC]cell cortexprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0030122 [CC]AP-2 adaptor complexprobableGO:0043227, GO:0030139, GO:0043229, GO:0071944, GO:0030117, GO:0005905, GO:0030131, GO:0030119, GO:0030118, GO:0030135, GO:0043226, GO:0030136, GO:0005737, GO:0005575, GO:0030132, GO:0031982, GO:0030662, GO:0016023, GO:0031410, GO:0016020, GO:0030669, GO:0031988, GO:0044433, GO:0030666, GO:0044459, GO:0048475, GO:0030665, GO:0030659, GO:0030128, GO:0045334, GO:0012505, GO:0012506, GO:0005886, GO:0030120, GO:0030125, GO:0043234, GO:0032991, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0031090, GO:0044424, GO:0044425, GO:0044422
GO:0032879 [BP]regulation of localizationprobableGO:0008150, GO:0065007, GO:0050789
GO:0048268 [BP]clathrin coat assemblyprobableGO:0022607, GO:0070271, GO:0043933, GO:0006901, GO:0006900, GO:0061024, GO:0034622, GO:0044699, GO:0071822, GO:0016044, GO:0016043, GO:0065003, GO:0071840, GO:0006461, GO:0006810, GO:0044765, GO:0044763, GO:0051234, GO:0043623, GO:0051179, GO:0006996, GO:0016192, GO:0016050, GO:0044085, GO:0008150, GO:0009987
GO:0071363 [BP]cellular response to growth factor stimulusprobableGO:0051716, GO:0050896, GO:0009987, GO:0070848, GO:0008150, GO:0071310, GO:0044763, GO:0070887, GO:0042221, GO:0010033, GO:0044699
GO:0008021 [CC]synaptic vesicleprobableGO:0043227, GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044444, GO:0044464, GO:0031982, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044456, GO:0045202, GO:0044424, GO:0005622, GO:0030135, GO:0043226, GO:0030136
GO:0048878 [BP]chemical homeostasisprobableGO:0042592, GO:0008150, GO:0065008, GO:0065007
GO:0060170 [CC]cilium membraneprobableGO:0043229, GO:0071944, GO:0005929, GO:0043227, GO:0043226, GO:0044446, GO:0031090, GO:0031514, GO:0016020, GO:0044459, GO:0031253, GO:0005886, GO:0042995, GO:0043231, GO:0044463, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044441, GO:0044424, GO:0044425, GO:0044422
GO:0030866 [BP]cortical actin cytoskeleton organizationprobableGO:0006996, GO:0007010, GO:0030029, GO:0071840, GO:0009987, GO:0030865, GO:0044763, GO:0030036, GO:0008150, GO:0044699, GO:0016043
GO:0051260 [BP]protein homooligomerizationprobableGO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0001934 [BP]positive regulation of protein phosphorylationprobableGO:0019220, GO:0009893, GO:0019222, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0010562, GO:0051246, GO:0051247, GO:0032270, GO:0031399, GO:0048518, GO:0065007, GO:0045937, GO:0060255, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0042327, GO:0032268, GO:0031401, GO:0001932, GO:0048522

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2JQ6, chain A
Confidence level:very confident
Coverage over the Query: 29-167
View the alignment between query and template
View the model in PyMOL
Template: 2QPT, chain A
Confidence level:very confident
Coverage over the Query: 6-58,73-167
View the alignment between query and template
View the model in PyMOL