Query         psy11761
Match_columns 198
No_of_seqs    130 out of 1813
Neff          9.8 
Searched_HMMs 46136
Date          Fri Aug 16 18:15:02 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy11761.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/11761hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.9 7.8E-27 1.7E-31  174.2   4.0  124   23-162   128-264 (279)
  2 KOG2462|consensus               99.9 2.2E-25 4.7E-30  166.5   4.3  125   43-185   130-257 (279)
  3 KOG3608|consensus               99.8   6E-22 1.3E-26  152.2   0.1  157    2-180   189-361 (467)
  4 KOG1074|consensus               99.8 3.1E-20 6.8E-25  156.0   4.1   51   45-95    607-657 (958)
  5 KOG1074|consensus               99.7 9.7E-18 2.1E-22  141.3   3.1   70  125-195   618-692 (958)
  6 KOG3608|consensus               99.6 6.1E-17 1.3E-21  124.9   1.5  165    1-184   216-401 (467)
  7 KOG3576|consensus               99.6 4.1E-17 8.8E-22  117.0  -0.4  111   43-166   117-237 (267)
  8 KOG3576|consensus               99.6 7.7E-17 1.7E-21  115.6  -0.4  103   69-185   115-226 (267)
  9 KOG3623|consensus               99.4 2.6E-14 5.6E-19  119.4   1.6   81   68-162   891-971 (1007)
 10 PLN03086 PRLI-interacting fact  99.4 2.3E-13   5E-18  113.4   4.7  130   26-166   434-565 (567)
 11 KOG3623|consensus               99.4   1E-13 2.2E-18  115.8   1.0   78   43-133   894-971 (1007)
 12 PHA00733 hypothetical protein   99.1 6.4E-11 1.4E-15   81.6   2.5   94   57-166    26-124 (128)
 13 PLN03086 PRLI-interacting fact  98.9 8.1E-10 1.8E-14   92.5   4.4  124   26-181   408-551 (567)
 14 KOG3993|consensus               98.7 3.4E-09 7.5E-14   84.2   1.7  113   43-166   267-381 (500)
 15 PHA00733 hypothetical protein   98.7 5.8E-09 1.2E-13   71.9   1.0   78   43-136    40-123 (128)
 16 PHA02768 hypothetical protein;  98.6 1.6E-08 3.6E-13   58.1   2.0   39   71-111     5-43  (55)
 17 PHA02768 hypothetical protein;  98.5 3.8E-08 8.2E-13   56.6   1.3   46   41-88      3-48  (55)
 18 PHA00616 hypothetical protein   98.5 6.8E-08 1.5E-12   52.9   1.9   32  141-172     1-32  (44)
 19 PF13465 zf-H2C2_2:  Zinc-finge  98.5 6.3E-08 1.4E-12   47.6   1.1   25   86-110     1-25  (26)
 20 PF13465 zf-H2C2_2:  Zinc-finge  98.5 3.2E-08 6.9E-13   48.7   0.0   23   14-36      3-25  (26)
 21 PHA00616 hypothetical protein   98.1 1.4E-06   3E-11   47.8   1.2   34   71-104     1-34  (44)
 22 KOG3993|consensus               98.1 1.4E-06   3E-11   69.7   1.5   70   26-95    268-380 (500)
 23 PHA00732 hypothetical protein   98.0   4E-06 8.6E-11   52.7   2.7   50   43-97      1-50  (79)
 24 PHA00732 hypothetical protein   98.0 1.5E-06 3.3E-11   54.5   0.6   47   99-164     1-47  (79)
 25 PF05605 zf-Di19:  Drought indu  98.0 3.5E-06 7.5E-11   49.1   1.3   52   99-166     2-54  (54)
 26 PF00096 zf-C2H2:  Zinc finger,  97.9 4.8E-06   1E-10   39.5   1.3   23  142-164     1-23  (23)
 27 PF13894 zf-C2H2_4:  C2H2-type   97.8 1.4E-05 2.9E-10   38.1   1.8   24  142-165     1-24  (24)
 28 PF13912 zf-C2H2_6:  C2H2-type   97.7 1.9E-05 4.1E-10   39.0   1.4   26  141-166     1-26  (27)
 29 COG5189 SFP1 Putative transcri  97.4 5.9E-05 1.3E-09   58.5   1.3   53   97-162   347-419 (423)
 30 PF12756 zf-C2H2_2:  C2H2 type   97.3 0.00018   4E-09   47.0   2.5   73   73-164     1-73  (100)
 31 PF09237 GAGA:  GAGA factor;  I  97.3  0.0003 6.4E-09   39.5   2.7   40  130-169    13-52  (54)
 32 PF05605 zf-Di19:  Drought indu  97.2 0.00038 8.3E-09   40.4   2.6   42  141-183     2-43  (54)
 33 PF00096 zf-C2H2:  Zinc finger,  97.0  0.0002 4.3E-09   33.7   0.5   21   73-93      2-22  (23)
 34 smart00355 ZnF_C2H2 zinc finge  96.9 0.00066 1.4E-08   32.5   1.7   24  142-165     1-24  (26)
 35 PF13912 zf-C2H2_6:  C2H2-type   96.8 0.00061 1.3E-08   33.4   1.2   24   44-67      2-25  (27)
 36 PF12756 zf-C2H2_2:  C2H2 type   96.6 0.00046   1E-08   45.1  -0.2   77   45-139     1-77  (100)
 37 PF13894 zf-C2H2_4:  C2H2-type   96.6   0.001 2.2E-08   31.2   1.0   23   72-94      1-23  (24)
 38 COG5189 SFP1 Putative transcri  96.5  0.0011 2.4E-08   51.6   1.4   25   68-92    395-419 (423)
 39 PF13909 zf-H2C2_5:  C2H2-type   96.4  0.0019 4.1E-08   30.6   1.3   24  142-166     1-24  (24)
 40 PF12874 zf-met:  Zinc-finger o  96.2  0.0024 5.3E-08   30.5   1.2   23  142-164     1-23  (25)
 41 PF12171 zf-C2H2_jaz:  Zinc-fin  95.9   0.004 8.7E-08   30.5   1.0   22  142-163     2-23  (27)
 42 PF09237 GAGA:  GAGA factor;  I  95.8  0.0079 1.7E-07   33.9   2.1   33   67-99     20-52  (54)
 43 smart00355 ZnF_C2H2 zinc finge  95.5   0.011 2.4E-07   28.0   1.6   23   72-94      1-23  (26)
 44 PRK04860 hypothetical protein;  95.2  0.0095 2.1E-07   42.7   1.4   38   70-111   118-155 (160)
 45 PF12874 zf-met:  Zinc-finger o  94.6   0.012 2.6E-07   28.0   0.4   22   72-93      1-22  (25)
 46 PRK04860 hypothetical protein;  94.5   0.013 2.8E-07   42.0   0.5   38   43-84    119-156 (160)
 47 PRK14890 putative Zn-ribbon RN  94.2   0.046   1E-06   31.9   2.3   50   24-79      6-56  (59)
 48 COG5048 FOG: Zn-finger [Genera  94.2   0.056 1.2E-06   44.3   3.7   62   43-104   289-356 (467)
 49 PF13913 zf-C2HC_2:  zinc-finge  94.1   0.034 7.3E-07   26.7   1.3   20  142-162     3-22  (25)
 50 COG2888 Predicted Zn-ribbon RN  94.0   0.042 9.1E-07   32.0   1.8   50   25-79      9-58  (61)
 51 PF12171 zf-C2H2_jaz:  Zinc-fin  93.9   0.021 4.6E-07   27.8   0.5   21   72-92      2-22  (27)
 52 PF13909 zf-H2C2_5:  C2H2-type   93.8   0.022 4.8E-07   26.8   0.4   23   72-95      1-23  (24)
 53 PRK00398 rpoP DNA-directed RNA  93.5   0.046   1E-06   30.4   1.4   29   25-53      3-31  (46)
 54 KOG2231|consensus               93.3   0.066 1.4E-06   46.5   2.7  120   26-165   100-236 (669)
 55 COG4049 Uncharacterized protei  93.2   0.047   1E-06   31.3   1.2   29  138-166    14-42  (65)
 56 smart00451 ZnF_U1 U1-like zinc  93.0   0.072 1.6E-06   27.5   1.6   23  140-162     2-24  (35)
 57 KOG2893|consensus               91.9   0.055 1.2E-06   40.8   0.4   44   45-92     12-55  (341)
 58 KOG2893|consensus               91.8    0.03 6.5E-07   42.1  -1.1   48  101-166    12-59  (341)
 59 COG5048 FOG: Zn-finger [Genera  91.7    0.12 2.6E-06   42.4   2.3   75   98-186   288-368 (467)
 60 COG1997 RPL43A Ribosomal prote  91.2    0.13 2.8E-06   32.5   1.4   33   24-56     34-66  (89)
 61 PF07754 DUF1610:  Domain of un  91.1    0.16 3.5E-06   24.0   1.4   21   30-50      3-23  (24)
 62 cd00350 rubredoxin_like Rubred  90.9    0.13 2.7E-06   26.4   1.0   24   26-51      2-25  (33)
 63 PF10571 UPF0547:  Uncharacteri  90.8    0.19 4.1E-06   24.3   1.5   24   27-54      2-25  (26)
 64 KOG1146|consensus               90.4    0.18 3.9E-06   46.8   2.2   97   49-162   442-539 (1406)
 65 PF09538 FYDLN_acid:  Protein o  90.2    0.18   4E-06   33.6   1.5   30  100-154    10-39  (108)
 66 cd00729 rubredoxin_SM Rubredox  89.9    0.16 3.5E-06   26.2   0.9   12   99-110     2-13  (34)
 67 PF09986 DUF2225:  Uncharacteri  89.1    0.18 3.9E-06   38.0   1.0   15   24-38      4-18  (214)
 68 PF09538 FYDLN_acid:  Protein o  89.0    0.27 5.7E-06   32.8   1.6   30   26-56     10-39  (108)
 69 PF14369 zf-RING_3:  zinc-finge  88.8    0.26 5.5E-06   25.7   1.2   30   25-54      2-32  (35)
 70 KOG4173|consensus               88.5    0.11 2.4E-06   38.3  -0.4   81   70-166    78-171 (253)
 71 smart00659 RPOLCX RNA polymera  88.1    0.31 6.6E-06   26.9   1.3   27   25-52      2-28  (44)
 72 PF01780 Ribosomal_L37ae:  Ribo  88.0    0.18 3.9E-06   32.2   0.3   31   25-55     35-65  (90)
 73 COG1996 RPC10 DNA-directed RNA  87.8    0.25 5.3E-06   27.8   0.7   29   24-52      5-33  (49)
 74 COG5236 Uncharacterized conser  87.3    0.54 1.2E-05   37.6   2.6   85   72-165   152-244 (493)
 75 KOG2231|consensus               85.9    0.51 1.1E-05   41.3   2.0   82   74-165   118-206 (669)
 76 PF03604 DNA_RNApol_7kD:  DNA d  85.9    0.56 1.2E-05   23.9   1.4   25   26-51      1-25  (32)
 77 PF09986 DUF2225:  Uncharacteri  85.5    0.48   1E-05   35.7   1.5   14   98-111     4-17  (214)
 78 TIGR00622 ssl1 transcription f  85.5     1.8 3.8E-05   29.0   4.0  102   26-165     2-105 (112)
 79 PF12013 DUF3505:  Protein of u  85.4     1.2 2.6E-05   29.6   3.3   27  140-166    79-109 (109)
 80 COG1592 Rubrerythrin [Energy p  85.1    0.47   1E-05   34.1   1.2   25   98-149   133-157 (166)
 81 PTZ00255 60S ribosomal protein  85.0    0.42 9.1E-06   30.6   0.8   33   24-56     35-67  (90)
 82 TIGR00280 L37a ribosomal prote  84.3    0.42 9.1E-06   30.6   0.6   32   25-56     35-66  (91)
 83 PF14353 CpXC:  CpXC protein     84.2    0.33 7.1E-06   33.4   0.1   40   27-66      3-61  (128)
 84 TIGR00622 ssl1 transcription f  84.1     1.2 2.7E-05   29.7   2.8   71   23-95     13-105 (112)
 85 KOG1146|consensus               84.0     0.5 1.1E-05   44.1   1.1  100   44-173  1261-1360(1406)
 86 KOG2186|consensus               83.9    0.43 9.3E-06   36.4   0.6   47   99-162     3-49  (276)
 87 smart00834 CxxC_CXXC_SSSS Puta  83.3    0.55 1.2E-05   25.0   0.7   26   26-51      6-34  (41)
 88 PRK03976 rpl37ae 50S ribosomal  82.0    0.55 1.2E-05   30.1   0.5   32   25-56     36-67  (90)
 89 PF09723 Zn-ribbon_8:  Zinc rib  82.0    0.59 1.3E-05   25.4   0.5   11   26-36      6-16  (42)
 90 TIGR02300 FYDLN_acid conserved  81.6    0.84 1.8E-05   31.1   1.3   33  100-157    10-42  (129)
 91 COG1592 Rubrerythrin [Energy p  78.5     1.1 2.4E-05   32.2   1.2   24   25-51    134-157 (166)
 92 COG4049 Uncharacterized protei  77.0    0.66 1.4E-05   26.7  -0.3   32   92-136    10-41  (65)
 93 TIGR02300 FYDLN_acid conserved  76.3     1.7 3.8E-05   29.6   1.5   30   26-56     10-39  (129)
 94 COG1198 PriA Primosomal protei  76.0     1.5 3.2E-05   39.2   1.5   45   27-80    437-484 (730)
 95 PF13719 zinc_ribbon_5:  zinc-r  75.9     1.2 2.7E-05   23.4   0.6   27   27-53      4-35  (37)
 96 TIGR02098 MJ0042_CXXC MJ0042 f  75.1    0.91   2E-05   23.8  -0.0   10   27-36      4-13  (38)
 97 TIGR00373 conserved hypothetic  75.0    0.98 2.1E-05   32.3   0.1   10   71-80    128-137 (158)
 98 smart00531 TFIIE Transcription  74.7       1 2.2E-05   31.8   0.1   36   43-82     99-134 (147)
 99 PF02176 zf-TRAF:  TRAF-type zi  74.5     1.4 2.9E-05   25.7   0.6   49   96-160     6-60  (60)
100 PF00301 Rubredoxin:  Rubredoxi  74.5     1.6 3.5E-05   24.3   0.9   11   26-36      2-12  (47)
101 PF13240 zinc_ribbon_2:  zinc-r  74.0     1.6 3.6E-05   20.3   0.7   20   28-51      2-21  (23)
102 TIGR01206 lysW lysine biosynth  73.7     2.1 4.5E-05   24.7   1.2   28   26-53      3-32  (54)
103 TIGR02605 CxxC_CxxC_SSSS putat  73.5     1.5 3.3E-05   24.8   0.6   11   44-54      6-16  (52)
104 smart00661 RPOL9 RNA polymeras  73.4     2.2 4.8E-05   24.0   1.3   28   28-55      3-32  (52)
105 PRK00464 nrdR transcriptional   73.2     1.3 2.8E-05   31.6   0.3   16   44-59     29-44  (154)
106 COG0068 HypF Hydrogenase matur  72.9     1.6 3.4E-05   38.5   0.8   77   26-108   102-182 (750)
107 PRK06266 transcription initiat  72.8     1.3 2.8E-05   32.4   0.3   31   43-82    117-147 (178)
108 COG3357 Predicted transcriptio  72.3     2.2 4.7E-05   27.3   1.1   27   25-51     58-84  (97)
109 PHA00626 hypothetical protein   72.2     2.8 6.1E-05   24.2   1.5   13   70-82     22-34  (59)
110 PF05191 ADK_lid:  Adenylate ki  71.5     1.4   3E-05   23.1   0.1   16  139-154    19-34  (36)
111 PF02892 zf-BED:  BED zinc fing  71.4     3.2   7E-05   22.5   1.6   27  138-164    13-43  (45)
112 cd00730 rubredoxin Rubredoxin;  71.3     2.7 5.9E-05   23.8   1.3   11   26-36      2-12  (50)
113 smart00734 ZnF_Rad18 Rad18-lik  70.9       3 6.6E-05   20.0   1.3   19  143-162     3-21  (26)
114 PF12013 DUF3505:  Protein of u  70.4     4.1 8.9E-05   27.0   2.3   21   43-64     11-31  (109)
115 TIGR00373 conserved hypothetic  70.2     2.5 5.5E-05   30.2   1.3   32  138-180   106-137 (158)
116 PF09845 DUF2072:  Zn-ribbon co  68.6     1.8 3.9E-05   29.7   0.2   27   25-51      1-27  (131)
117 PF13717 zinc_ribbon_4:  zinc-r  68.1     2.1 4.6E-05   22.3   0.4   11   27-37      4-14  (36)
118 PF12773 DZR:  Double zinc ribb  67.5     5.3 0.00012   22.2   2.0    9   46-54     15-23  (50)
119 PRK06266 transcription initiat  67.0     3.1 6.8E-05   30.4   1.2   32  139-181   115-146 (178)
120 PF06524 NOA36:  NOA36 protein;  66.9     3.3 7.2E-05   31.9   1.3   26   69-94    207-232 (314)
121 PF07282 OrfB_Zn_ribbon:  Putat  66.3       4 8.7E-05   24.5   1.4   29   27-55     30-58  (69)
122 PF08271 TF_Zn_Ribbon:  TFIIB z  65.8     3.9 8.4E-05   22.1   1.2   28   26-53      1-29  (43)
123 COG5236 Uncharacterized conser  64.8     2.8 6.1E-05   33.7   0.6   78   73-165   222-305 (493)
124 KOG0402|consensus               64.2     2.9 6.3E-05   26.2   0.5   31   25-55     36-66  (92)
125 PF13248 zf-ribbon_3:  zinc-rib  63.7     4.2 9.1E-05   19.4   0.9   23   26-52      3-25  (26)
126 PRK04023 DNA polymerase II lar  63.4     7.2 0.00016   36.0   3.0   22   25-52    626-647 (1121)
127 PF01286 XPA_N:  XPA protein N-  62.8     3.9 8.5E-05   21.1   0.8   24   27-50      5-28  (34)
128 smart00614 ZnF_BED BED zinc fi  62.6     5.7 0.00012   22.3   1.5   24  140-163    17-45  (50)
129 KOG2907|consensus               60.8     2.9 6.3E-05   27.8   0.1   29   26-54      8-36  (116)
130 COG1773 Rubredoxin [Energy pro  60.6     4.9 0.00011   23.2   1.0   11   26-36      4-14  (55)
131 PF12760 Zn_Tnp_IS1595:  Transp  60.5     7.7 0.00017   21.3   1.8   27   25-51     18-45  (46)
132 PF13453 zf-TFIIB:  Transcripti  60.0     7.4 0.00016   20.8   1.6   33   28-60      2-36  (41)
133 PRK14714 DNA polymerase II lar  59.2     8.4 0.00018   36.5   2.7   35   26-81    668-702 (1337)
134 PF04959 ARS2:  Arsenite-resist  58.5     2.6 5.7E-05   31.7  -0.5   31  138-168    74-104 (214)
135 KOG4173|consensus               58.4     2.8 6.2E-05   31.1  -0.3   65   44-111    80-158 (253)
136 PF07295 DUF1451:  Protein of u  58.3     3.8 8.3E-05   28.9   0.4   36   17-52    100-139 (146)
137 COG5151 SSL1 RNA polymerase II  57.9      11 0.00023   30.1   2.7   26  139-164   386-411 (421)
138 COG3364 Zn-ribbon containing p  57.2     3.1 6.7E-05   27.2  -0.3   26   25-50      2-27  (112)
139 KOG2186|consensus               56.7     4.8 0.00011   30.9   0.7   46   44-92      4-49  (276)
140 TIGR00595 priA primosomal prot  56.5     7.1 0.00015   33.5   1.7   44   27-79    215-261 (505)
141 PRK00432 30S ribosomal protein  56.3     8.7 0.00019   21.7   1.5   26   27-53     22-47  (50)
142 PF05443 ROS_MUCR:  ROS/MUCR tr  55.9     7.1 0.00015   27.0   1.3   26  139-167    70-95  (132)
143 PF08274 PhnA_Zn_Ribbon:  PhnA   55.6     6.8 0.00015   19.6   0.9   24   27-51      4-27  (30)
144 COG4530 Uncharacterized protei  55.5     9.6 0.00021   25.3   1.8   33  100-158    10-42  (129)
145 COG1571 Predicted DNA-binding   54.8     7.8 0.00017   32.2   1.6   30   27-57    352-381 (421)
146 COG1198 PriA Primosomal protei  52.9     9.9 0.00021   34.2   2.0   23  127-150   462-484 (730)
147 PF01155 HypA:  Hydrogenase exp  52.0     4.1 8.8E-05   27.4  -0.3   24   26-51     71-94  (113)
148 KOG1280|consensus               51.1      12 0.00026   30.2   2.1   43  139-181    77-119 (381)
149 smart00154 ZnF_AN1 AN1-like Zi  50.8      13 0.00027   19.8   1.5   13   43-55     12-24  (39)
150 PRK00420 hypothetical protein;  50.5      11 0.00024   25.3   1.6   30   25-55     23-52  (112)
151 PRK05580 primosome assembly pr  50.1      10 0.00022   33.9   1.7   46   26-80    382-430 (679)
152 PF01363 FYVE:  FYVE zinc finge  50.0      10 0.00022   22.7   1.2   28   26-55     10-37  (69)
153 KOG4167|consensus               49.7     5.2 0.00011   35.5  -0.1   27  139-165   790-816 (907)
154 KOG4124|consensus               48.4     8.3 0.00018   31.1   0.8   23  139-161   396-418 (442)
155 PRK12496 hypothetical protein;  48.0      10 0.00023   27.3   1.2   13   99-111   127-139 (164)
156 PF07975 C1_4:  TFIIH C1-like d  47.9      10 0.00022   21.6   0.9   20   71-90     21-40  (51)
157 COG1655 Uncharacterized protei  47.6     7.3 0.00016   29.6   0.4   17   23-39     17-33  (267)
158 PRK14873 primosome assembly pr  47.2     9.7 0.00021   33.9   1.1   44   27-80    385-431 (665)
159 PRK03564 formate dehydrogenase  47.2      17 0.00038   29.1   2.4   14   66-79    207-220 (309)
160 PRK03824 hypA hydrogenase nick  46.7      12 0.00027   26.0   1.4   13   43-55     70-82  (135)
161 PF10013 DUF2256:  Uncharacteri  46.5     9.8 0.00021   20.6   0.7   16  143-158    10-25  (42)
162 KOG2785|consensus               46.5     8.3 0.00018   31.5   0.6   54   98-164   165-243 (390)
163 PF14803 Nudix_N_2:  Nudix N-te  45.9      11 0.00024   19.4   0.8   25   28-52      3-31  (34)
164 PF15135 UPF0515:  Uncharacteri  45.7      16 0.00036   28.0   2.0   11  100-110   156-166 (278)
165 PF05129 Elf1:  Transcription e  45.7     8.2 0.00018   24.3   0.3   32   24-55     21-58  (81)
166 COG1998 RPS31 Ribosomal protei  45.3      14 0.00031   20.8   1.2   25   28-52     22-46  (51)
167 KOG2482|consensus               43.2      17 0.00036   29.4   1.7   24  141-164   195-218 (423)
168 PF14446 Prok-RING_1:  Prokaryo  43.1      13 0.00029   21.4   0.9   12  100-111     6-17  (54)
169 PRK14559 putative protein seri  42.8      20 0.00043   31.8   2.4   23   27-53      3-25  (645)
170 PRK12380 hydrogenase nickel in  41.6      14  0.0003   24.8   1.0   10   26-35     71-80  (113)
171 KOG2593|consensus               40.8      18  0.0004   30.1   1.7   40   94-150   123-162 (436)
172 COG4957 Predicted transcriptio  40.1      12 0.00026   25.9   0.5   27  140-169    75-101 (148)
173 TIGR00100 hypA hydrogenase nic  39.8      14  0.0003   24.9   0.8   10   44-53     71-80  (115)
174 PF09082 DUF1922:  Domain of un  39.6      12 0.00026   22.6   0.4   27   25-53      3-29  (68)
175 TIGR00686 phnA alkylphosphonat  38.8      20 0.00044   23.8   1.4   29   27-56      4-32  (109)
176 PF11781 RRN7:  RNA polymerase   38.4      21 0.00046   18.6   1.2   27   24-51      7-33  (36)
177 COG4888 Uncharacterized Zn rib  38.2      12 0.00027   24.4   0.3   30   25-54     22-57  (104)
178 KOG1842|consensus               38.2      20 0.00042   30.1   1.5   28  140-167    14-41  (505)
179 KOG0978|consensus               37.9      13 0.00028   33.1   0.4   12   73-84    680-691 (698)
180 PRK10220 hypothetical protein;  37.6      24 0.00051   23.5   1.5   29   27-56      5-33  (111)
181 KOG2636|consensus               37.5      20 0.00044   30.0   1.5   25  138-162   398-423 (497)
182 PF00130 C1_1:  Phorbol esters/  37.2      24 0.00052   19.6   1.4   29   23-52      9-37  (53)
183 PRK09678 DNA-binding transcrip  36.8      12 0.00026   23.0   0.1    7   27-33      3-9   (72)
184 cd00065 FYVE FYVE domain; Zinc  36.3      22 0.00048   20.1   1.2   25   28-54      5-29  (57)
185 PF14599 zinc_ribbon_6:  Zinc-r  35.4      16 0.00034   21.7   0.4   26   26-51     31-56  (61)
186 PF11023 DUF2614:  Protein of u  34.4      26 0.00056   23.5   1.3   31   23-55     67-97  (114)
187 PRK03681 hypA hydrogenase nick  34.2      21 0.00045   24.0   0.9   10   26-35     71-80  (114)
188 PF01485 IBR:  IBR domain;  Int  33.7      29 0.00062   20.0   1.4   30   27-56     20-53  (64)
189 smart00440 ZnF_C2C2 C2C2 Zinc   33.4      19 0.00042   19.1   0.5   12  141-152    28-39  (40)
190 smart00778 Prim_Zn_Ribbon Zinc  33.1      36 0.00078   17.9   1.5   26   26-51      4-33  (37)
191 PF08792 A2L_zn_ribbon:  A2L zi  32.9      31 0.00068   17.5   1.3   28   26-53      4-31  (33)
192 COG4338 Uncharacterized protei  32.9      14 0.00031   20.6  -0.0   17  142-158    13-29  (54)
193 PF13005 zf-IS66:  zinc-finger   32.8      29 0.00064   18.8   1.3   10   27-36      4-13  (47)
194 COG3880 Modulator of heat shoc  32.8     8.3 0.00018   27.7  -1.2   32   25-56     74-105 (176)
195 PRK00564 hypA hydrogenase nick  32.4      20 0.00044   24.2   0.6   12  100-111    72-83  (117)
196 TIGR00143 hypF [NiFe] hydrogen  32.1      16 0.00035   32.8   0.2   78   26-109    69-150 (711)
197 PF05290 Baculo_IE-1:  Baculovi  32.1      27 0.00058   24.2   1.2   11  101-111   123-133 (140)
198 KOG3408|consensus               32.0      34 0.00073   23.3   1.6   28  137-164    53-80  (129)
199 PF01096 TFIIS_C:  Transcriptio  31.9      11 0.00025   19.9  -0.5   11  141-151    28-38  (39)
200 KOG2593|consensus               31.8      19 0.00041   30.0   0.5   31   23-53    126-163 (436)
201 PF03107 C1_2:  C1 domain;  Int  31.2      29 0.00063   17.0   1.0   22   26-50      1-22  (30)
202 COG3091 SprT Zn-dependent meta  31.2      21 0.00046   25.3   0.6   36   96-150   114-149 (156)
203 KOG2785|consensus               31.1      33 0.00072   28.1   1.7   51   43-93    166-242 (390)
204 PF10263 SprT-like:  SprT-like   30.2      27 0.00059   24.5   1.1   31   43-81    123-153 (157)
205 KOG4167|consensus               29.5      12 0.00027   33.2  -0.9   26   71-96    792-817 (907)
206 PF08273 Prim_Zn_Ribbon:  Zinc-  29.4      31 0.00067   18.5   0.9   25   26-50      4-33  (40)
207 PF01428 zf-AN1:  AN1-like Zinc  28.3      19  0.0004   19.4  -0.1   15  140-154    12-26  (43)
208 smart00064 FYVE Protein presen  28.3      31 0.00067   20.4   0.9   12  100-111    11-22  (68)
209 PF04810 zf-Sec23_Sec24:  Sec23  28.3      37 0.00079   18.0   1.1   14  138-151    21-34  (40)
210 TIGR00416 sms DNA repair prote  28.2      31 0.00067   29.3   1.2   25   24-52      6-30  (454)
211 PF04216 FdhE:  Protein involve  28.0      18 0.00039   28.6  -0.2   10  100-109   173-182 (290)
212 PF09297 zf-NADH-PPase:  NADH p  28.0      37  0.0008   16.9   1.0   24   28-51      6-29  (32)
213 PF04423 Rad50_zn_hook:  Rad50   27.8      22 0.00047   20.2   0.2   12  143-154    22-33  (54)
214 TIGR01384 TFS_arch transcripti  27.8      38 0.00082   22.1   1.3   26   28-55      3-28  (104)
215 PF03119 DNA_ligase_ZBD:  NAD-d  27.7      32 0.00069   16.7   0.7   19   28-46      2-20  (28)
216 PF08790 zf-LYAR:  LYAR-type C2  27.2      20 0.00044   17.6  -0.0   11  100-110     1-11  (28)
217 TIGR03831 YgiT_finger YgiT-typ  26.9      26 0.00057   18.7   0.4    8   45-52     34-41  (46)
218 PRK11823 DNA repair protein Ra  26.8      38 0.00082   28.6   1.5   26   23-52      5-30  (446)
219 PF14690 zf-ISL3:  zinc-finger   26.6      42 0.00091   18.1   1.2    9   25-33      2-10  (47)
220 PF02150 RNA_POL_M_15KD:  RNA p  26.6      23  0.0005   18.2   0.1    9   45-53     22-30  (35)
221 PF07649 C1_3:  C1-like domain;  26.5      36 0.00077   16.6   0.8    8   43-50     15-22  (30)
222 COG5188 PRP9 Splicing factor 3  26.1      38 0.00082   27.6   1.3   25  138-162   371-396 (470)
223 PF10276 zf-CHCC:  Zinc-finger   25.6      26 0.00057   18.7   0.2   11   25-35     29-39  (40)
224 smart00731 SprT SprT homologue  25.2      44 0.00096   23.3   1.4   32   43-81    112-143 (146)
225 KOG0782|consensus               25.0      22 0.00047   30.9  -0.2   47    6-57    239-290 (1004)
226 COG0068 HypF Hydrogenase matur  24.9      30 0.00065   30.9   0.6   46   28-79    126-181 (750)
227 COG1645 Uncharacterized Zn-fin  24.7      41  0.0009   23.2   1.1   26   26-53     29-54  (131)
228 PRK00762 hypA hydrogenase nick  24.5      34 0.00074   23.3   0.7   12   43-55     70-81  (124)
229 COG1779 C4-type Zn-finger prot  24.4      33 0.00072   25.5   0.6   10   27-36     16-25  (201)
230 COG3677 Transposase and inacti  24.4      48   0.001   22.8   1.4   17  138-154    50-66  (129)
231 cd01121 Sms Sms (bacterial rad  24.1      43 0.00093   27.6   1.3   23   26-52      1-23  (372)
232 COG2331 Uncharacterized protei  23.7      28 0.00061   21.5   0.1   12  100-111    13-24  (82)
233 PRK11827 hypothetical protein;  23.7      61  0.0013   19.1   1.5   11   44-54     27-37  (60)
234 PRK12286 rpmF 50S ribosomal pr  23.5      73  0.0016   18.5   1.8   22   25-51     27-48  (57)
235 PRK05452 anaerobic nitric oxid  23.2      47   0.001   28.4   1.4   14   43-56    425-438 (479)
236 PF12907 zf-met2:  Zinc-binding  23.0      67  0.0014   17.2   1.5   27  142-168     2-31  (40)
237 PF10083 DUF2321:  Uncharacteri  23.0      23 0.00049   25.2  -0.4   18   68-85     65-82  (158)
238 KOG1280|consensus               22.9      70  0.0015   26.0   2.2   38   69-106    77-116 (381)
239 PRK11032 hypothetical protein;  22.9      40 0.00087   24.2   0.8   37   16-52    111-151 (160)
240 cd00924 Cyt_c_Oxidase_Vb Cytoc  22.9      30 0.00066   22.6   0.2   12   25-36     79-90  (97)
241 COG1675 TFA1 Transcription ini  22.7      29 0.00062   25.4   0.0   31   22-52    110-141 (176)
242 KOG4118|consensus               22.6      54  0.0012   19.6   1.1   31  141-171    38-68  (74)
243 PF04780 DUF629:  Protein of un  22.4      61  0.0013   27.6   1.9   27  140-166    56-82  (466)
244 PF14206 Cys_rich_CPCC:  Cystei  22.2      57  0.0012   20.3   1.3    9   26-34      2-10  (78)
245 PRK04351 hypothetical protein;  21.9      54  0.0012   23.2   1.3   33   43-83    112-144 (149)
246 smart00109 C1 Protein kinase C  21.9      62  0.0013   17.2   1.3   25   25-51     11-35  (49)
247 PRK08402 replication factor A;  21.8      52  0.0011   27.0   1.3   26   26-51    213-238 (355)
248 PF13878 zf-C2H2_3:  zinc-finge  21.5      81  0.0018   16.8   1.7   24  141-164    13-38  (41)
249 COG4896 Uncharacterized protei  21.0      48   0.001   19.6   0.7   38   73-110     4-42  (68)
250 PF10122 Mu-like_Com:  Mu-like   21.0      66  0.0014   18.2   1.2   27   26-52      5-33  (51)
251 PRK05978 hypothetical protein;  20.9      58  0.0013   23.1   1.3    9   45-53     54-62  (148)
252 PF02591 DUF164:  Putative zinc  20.8      55  0.0012   18.6   1.0   14   20-33     41-54  (56)
253 PF11672 DUF3268:  Protein of u  20.7      72  0.0016   21.0   1.6   11   98-108     1-11  (102)
254 KOG3214|consensus               20.6      73  0.0016   20.9   1.6   18  138-155    44-61  (109)
255 PF11931 DUF3449:  Domain of un  20.4      34 0.00073   25.5   0.0   24  139-162    99-123 (196)
256 TIGR00595 priA primosomal prot  20.4      61  0.0013   27.9   1.5   10   43-52    253-262 (505)
257 PF06044 DRP:  Dam-replacing fa  20.2      46   0.001   25.6   0.7   31   26-56     32-66  (254)
258 TIGR00340 zpr1_rel ZPR1-relate  20.2      48   0.001   23.9   0.7   12   43-54     28-39  (163)
259 TIGR02159 PA_CoA_Oxy4 phenylac  20.2      34 0.00073   24.1  -0.0   30   26-55    106-142 (146)
260 smart00132 LIM Zinc-binding do  20.1      60  0.0013   16.1   1.0    7   72-78     28-34  (39)
261 PF09963 DUF2197:  Uncharacteri  20.0      46   0.001   19.3   0.5   36   73-108     4-40  (56)
262 KOG3507|consensus               20.0      60  0.0013   19.0   0.9    9   43-51     37-45  (62)

No 1  
>KOG2462|consensus
Probab=99.93  E-value=7.8e-27  Score=174.20  Aligned_cols=124  Identities=33%  Similarity=0.619  Sum_probs=105.4

Q ss_pred             CCccccCcccchhhcccCCC-------------ceecCccccccCChhHHhhcccCCCCCCCccCccchhcccCchhHHH
Q psy11761         23 DNAYKCHQCQRLIFLSANAG-------------VHKCEYCHKVFDQQSSLLSHNCPQMKPRPYKCDTCEKSFTNSQNLNT   89 (198)
Q Consensus        23 ~~~~~C~~C~~~f~~~~~~~-------------~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~   89 (198)
                      ..-|+|+.||+.+.+.++|.             .+.|..|++.+.....|..|+++|+  .+..|.+||+.|+....|+-
T Consensus       128 ~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQG  205 (279)
T KOG2462|consen  128 HPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQG  205 (279)
T ss_pred             CCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhc
Confidence            34588888998888877654             5678889998888888888888888  68888999999988888888


Q ss_pred             hhhhcCCCCcccCCcCchhhhcccCCCcccCCCcCcccccccccccccCCCCeeCCcchhhhcChhHHHhhhh
Q psy11761         90 HQLIHSGIRPFKCTTCDKSFVNQINPTSTHTPTYTKSNLAQHSCMNSHFPKPYQCDRCSQFFGDRMNLISHHC  162 (198)
Q Consensus        90 H~~~h~~~k~~~C~~C~~~f~~~~~~~~~~~~~~~~~~l~~H~~~~~~~~~~~~C~~C~k~f~~~~~L~~H~~  162 (198)
                      |+|+|+|||||.|+.|+++|.+             +++|+.|+.+|. +.|.|+|..|+|.|...+-|.+|..
T Consensus       206 HiRTHTGEKPF~C~hC~kAFAD-------------RSNLRAHmQTHS-~~K~~qC~~C~KsFsl~SyLnKH~E  264 (279)
T KOG2462|consen  206 HIRTHTGEKPFSCPHCGKAFAD-------------RSNLRAHMQTHS-DVKKHQCPRCGKSFALKSYLNKHSE  264 (279)
T ss_pred             ccccccCCCCccCCcccchhcc-------------hHHHHHHHHhhc-CCccccCcchhhHHHHHHHHHHhhh
Confidence            9999999999999999999988             888888988888 6788999999999988888888864


No 2  
>KOG2462|consensus
Probab=99.91  E-value=2.2e-25  Score=166.49  Aligned_cols=125  Identities=26%  Similarity=0.448  Sum_probs=116.0

Q ss_pred             ceecCccccccCChhHHhhcccCCCC---CCCccCccchhcccCchhHHHhhhhcCCCCcccCCcCchhhhcccCCCccc
Q psy11761         43 VHKCEYCHKVFDQQSSLLSHNCPQMK---PRPYKCDTCEKSFTNSQNLNTHQLIHSGIRPFKCTTCDKSFVNQINPTSTH  119 (198)
Q Consensus        43 ~~~C~~C~~~f~~~~~l~~H~~~h~~---~~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~~~~~~~~  119 (198)
                      .|+|.+|++.+...++|.+|+.+|..   .+.+.|..|++.+..-..|..|+++|+  -+.+|.+||+.|.+        
T Consensus       130 r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSR--------  199 (279)
T KOG2462|consen  130 RYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSR--------  199 (279)
T ss_pred             ceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccc--------
Confidence            68999999999999999999999853   678999999999999999999999999  57899999999998        


Q ss_pred             CCCcCcccccccccccccCCCCeeCCcchhhhcChhHHHhhhhhhCCCCCCCcccccccCCCcccc
Q psy11761        120 TPTYTKSNLAQHSCMNSHFPKPYQCDRCSQFFGDRMNLISHHCHKHKQSCLPFISRLFGFDDGDKV  185 (198)
Q Consensus       120 ~~~~~~~~l~~H~~~~~~~~~~~~C~~C~k~f~~~~~L~~H~~~~~~~~~~~~~~~~~~~~~~~~~  185 (198)
                           ..-|..|+|+|+ |||||.|+.|+|.|..+++|+.||.+|.+.|  .|.|..|++.++.+-
T Consensus       200 -----PWLLQGHiRTHT-GEKPF~C~hC~kAFADRSNLRAHmQTHS~~K--~~qC~~C~KsFsl~S  257 (279)
T KOG2462|consen  200 -----PWLLQGHIRTHT-GEKPFSCPHCGKAFADRSNLRAHMQTHSDVK--KHQCPRCGKSFALKS  257 (279)
T ss_pred             -----hHHhhccccccc-CCCCccCCcccchhcchHHHHHHHHhhcCCc--cccCcchhhHHHHHH
Confidence                 888999999999 9999999999999999999999999999999  788999998876553


No 3  
>KOG3608|consensus
Probab=99.83  E-value=6e-22  Score=152.23  Aligned_cols=157  Identities=25%  Similarity=0.457  Sum_probs=118.0

Q ss_pred             CccccceeeeechhhhhhhCCCCccccCcccchhhcccCCC------------ceecCccccccCChhHHhhcccCCCCC
Q psy11761          2 FTQTPNLVLFSQQTLLCIHGNDNAYKCHQCQRLIFLSANAG------------VHKCEYCHKVFDQQSSLLSHNCPQMKP   69 (198)
Q Consensus         2 f~~~~~l~~~~~~~h~~~h~~~~~~~C~~C~~~f~~~~~~~------------~~~C~~C~~~f~~~~~l~~H~~~h~~~   69 (198)
                      |.++..|+     +|++.|++++...|+.||..|.++..+-            +|.|..|.+.|.....|..|+..|.  
T Consensus       189 ~~~k~~Lr-----eH~r~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHv--  261 (467)
T KOG3608|consen  189 MGNKYRLR-----EHIRTHSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHV--  261 (467)
T ss_pred             hccHHHHH-----HHHHhcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhh--
Confidence            55677888     9999999999999999999998765432            7888888888888888888877766  


Q ss_pred             CCccCccchhcccCchhHHHhhh-hcCCCCcccCCcCchhhhcccCCCcccCCCcCcccccccccccccCCCCeeCCc--
Q psy11761         70 RPYKCDTCEKSFTNSQNLNTHQL-IHSGIRPFKCTTCDKSFVNQINPTSTHTPTYTKSNLAQHSCMNSHFPKPYQCDR--  146 (198)
Q Consensus        70 ~~~~C~~C~~~f~~~~~l~~H~~-~h~~~k~~~C~~C~~~f~~~~~~~~~~~~~~~~~~l~~H~~~~~~~~~~~~C~~--  146 (198)
                      .-|+|+.|+...+..++|..|++ .|...|||+|+.|++.|.+             .+.|.+|...|+  +..|.|+.  
T Consensus       262 n~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~-------------esdL~kH~~~HS--~~~y~C~h~~  326 (467)
T KOG3608|consen  262 NCYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVR-------------ESDLAKHVQVHS--KTVYQCEHPD  326 (467)
T ss_pred             hcccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhcc-------------HHHHHHHHHhcc--ccceecCCCC
Confidence            56788888888888888888877 4667788888888888887             666777776554  55666666  


Q ss_pred             chhhhcChhHHHhhhhhhC-CCCCCCcccccccCC
Q psy11761        147 CSQFFGDRMNLISHHCHKH-KQSCLPFISRLFGFD  180 (198)
Q Consensus       147 C~k~f~~~~~L~~H~~~~~-~~~~~~~~~~~~~~~  180 (198)
                      |..+|.+..++++|++.++ |.-|.+|.|-.|..-
T Consensus       327 C~~s~r~~~q~~~H~~evhEg~np~~Y~CH~Cdr~  361 (467)
T KOG3608|consen  327 CHYSVRTYTQMRRHFLEVHEGNNPILYACHCCDRF  361 (467)
T ss_pred             CcHHHHHHHHHHHHHHHhccCCCCCceeeecchhh
Confidence            6666666666677766555 555555555555443


No 4  
>KOG1074|consensus
Probab=99.79  E-value=3.1e-20  Score=156.02  Aligned_cols=51  Identities=33%  Similarity=0.705  Sum_probs=48.0

Q ss_pred             ecCccccccCChhHHhhcccCCCCCCCccCccchhcccCchhHHHhhhhcC
Q psy11761         45 KCEYCHKVFDQQSSLLSHNCPQMKPRPYKCDTCEKSFTNSQNLNTHQLIHS   95 (198)
Q Consensus        45 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~   95 (198)
                      +|-+|-+.+...+.|..|+++|+|++||+|.+|+++|..+.+|..|+..|.
T Consensus       607 qCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHk  657 (958)
T KOG1074|consen  607 QCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHK  657 (958)
T ss_pred             ceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccc
Confidence            799999999999999999999999999999999999999999999987664


No 5  
>KOG1074|consensus
Probab=99.69  E-value=9.7e-18  Score=141.26  Aligned_cols=70  Identities=17%  Similarity=0.237  Sum_probs=59.4

Q ss_pred             cccccccccccccCCCCeeCCcchhhhcChhHHHhhhhhhCCCCC--CCcccc---cccCCCcccchhcccceecC
Q psy11761        125 KSNLAQHSCMNSHFPKPYQCDRCSQFFGDRMNLISHHCHKHKQSC--LPFISR---LFGFDDGDKVAKFSGRVVDT  195 (198)
Q Consensus       125 ~~~l~~H~~~~~~~~~~~~C~~C~k~f~~~~~L~~H~~~~~~~~~--~~~~~~---~~~~~~~~~~~~~~~~~~~~  195 (198)
                      .+.|.-|.+.|+ |++||+|.+||+.|+++.+|+.||-+|....|  .++.|+   +|..++.+.+....+-.+..
T Consensus       618 ~saLqmHyrtHt-GERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn~V~lpQhIriH~  692 (958)
T KOG1074|consen  618 PSALQMHYRTHT-GERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTNAVTLPQHIRIHL  692 (958)
T ss_pred             hhhhhhhhhccc-CcCccccccccchhccccchhhcccccccCccccccccCCchhhhcccccccccccceEEeec
Confidence            468899999999 99999999999999999999999998865433  578899   99999988887776665544


No 6  
>KOG3608|consensus
Probab=99.63  E-value=6.1e-17  Score=124.89  Aligned_cols=165  Identities=24%  Similarity=0.434  Sum_probs=137.8

Q ss_pred             CCccccceeeeechhhhhhh--CCCCccccCcccchhhcccCCC--------ceecCccccccCChhHHhhcccC-CCCC
Q psy11761          1 MFTQTPNLVLFSQQTLLCIH--GNDNAYKCHQCQRLIFLSANAG--------VHKCEYCHKVFDQQSSLLSHNCP-QMKP   69 (198)
Q Consensus         1 ~f~~~~~l~~~~~~~h~~~h--~~~~~~~C~~C~~~f~~~~~~~--------~~~C~~C~~~f~~~~~l~~H~~~-h~~~   69 (198)
                      +|..+..|.     .|++-.  ....+|.|..|.+.|.+...|.        -|+|+.|.++.+..++|..|++. |...
T Consensus       216 ~F~~~tkl~-----DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn~ykCplCdmtc~~~ssL~~H~r~rHs~d  290 (467)
T KOG3608|consen  216 LFRTKTKLF-----DHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHVNCYKCPLCDMTCSSASSLTTHIRYRHSKD  290 (467)
T ss_pred             HhccccHHH-----HHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhhhcccccccccCCCChHHHHHHHHhhhccC
Confidence            366677776     775443  3556999999999998866554        68999999999999999999886 5568


Q ss_pred             CCccCccchhcccCchhHHHhhhhcCCCCcccCCc--CchhhhcccCCCcccCCCcCcccccccccccccCC--CCeeCC
Q psy11761         70 RPYKCDTCEKSFTNSQNLNTHQLIHSGIRPFKCTT--CDKSFVNQINPTSTHTPTYTKSNLAQHSCMNSHFP--KPYQCD  145 (198)
Q Consensus        70 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~--C~~~f~~~~~~~~~~~~~~~~~~l~~H~~~~~~~~--~~~~C~  145 (198)
                      +||+|+.|++.+....+|..|..+|+ +..|.|..  |...|..             ...+.+|++.++.|.  -+|.|.
T Consensus       291 kpfKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~-------------~~q~~~H~~evhEg~np~~Y~CH  356 (467)
T KOG3608|consen  291 KPFKCDECDTRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRT-------------YTQMRRHFLEVHEGNNPILYACH  356 (467)
T ss_pred             CCccccchhhhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHH-------------HHHHHHHHHHhccCCCCCceeee
Confidence            99999999999999999999999999 66799976  9999998             889999999887554  479999


Q ss_pred             cchhhhcChhHHHhhhhhhC------CCCCCCcccccccCCCccc
Q psy11761        146 RCSQFFGDRMNLISHHCHKH------KQSCLPFISRLFGFDDGDK  184 (198)
Q Consensus       146 ~C~k~f~~~~~L~~H~~~~~------~~~~~~~~~~~~~~~~~~~  184 (198)
                      .|++.|++..+|..|+...|      |.+.|.|....-|++.-..
T Consensus       357 ~Cdr~ft~G~~L~~HL~kkH~f~~PsGh~RFtYk~~edG~mRLqt  401 (467)
T KOG3608|consen  357 CCDRFFTSGKSLSAHLMKKHGFRLPSGHKRFTYKVDEDGFMRLQT  401 (467)
T ss_pred             cchhhhccchhHHHHHHHhhcccCCCCCCceeeeeccCceeeeee
Confidence            99999999999999987665      4666777777777765433


No 7  
>KOG3576|consensus
Probab=99.62  E-value=4.1e-17  Score=117.05  Aligned_cols=111  Identities=27%  Similarity=0.491  Sum_probs=68.4

Q ss_pred             ceecCccccccCChhHHhhcccCCCCCCCccCccchhcccCchhHHHhhhhcCCCCcccCCcCchhhhcccCCCcccCCC
Q psy11761         43 VHKCEYCHKVFDQQSSLLSHNCPQMKPRPYKCDTCEKSFTNSQNLNTHQLIHSGIRPFKCTTCDKSFVNQINPTSTHTPT  122 (198)
Q Consensus        43 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~~~~~~~~~~~  122 (198)
                      .|.|.+|++.|....-|.+|+.-|...+.+.|..||+.|.+.-+|.+|+++|+|.+||.|..|++.|..           
T Consensus       117 ~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftq-----------  185 (267)
T KOG3576|consen  117 SFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQ-----------  185 (267)
T ss_pred             eeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHh-----------
Confidence            456666666666666666666666666666666666666666666666666666666666666666665           


Q ss_pred             cCccccccccccccc----------CCCCeeCCcchhhhcChhHHHhhhhhhCC
Q psy11761        123 YTKSNLAQHSCMNSH----------FPKPYQCDRCSQFFGDRMNLISHHCHKHK  166 (198)
Q Consensus       123 ~~~~~l~~H~~~~~~----------~~~~~~C~~C~k~f~~~~~L~~H~~~~~~  166 (198)
                        .-.|..|.+..+.          ..+-|+|+.||..-.....+..|+..||.
T Consensus       186 --rcsleshl~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp  237 (267)
T KOG3576|consen  186 --RCSLESHLKKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHP  237 (267)
T ss_pred             --hccHHHHHHHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCC
Confidence              4444444433321          13456666666666666666666666654


No 8  
>KOG3576|consensus
Probab=99.60  E-value=7.7e-17  Score=115.64  Aligned_cols=103  Identities=26%  Similarity=0.515  Sum_probs=92.7

Q ss_pred             CCCccCccchhcccCchhHHHhhhhcCCCCcccCCcCchhhhcccCCCcccCCCcCcccccccccccccCCCCeeCCcch
Q psy11761         69 PRPYKCDTCEKSFTNSQNLNTHQLIHSGIRPFKCTTCDKSFVNQINPTSTHTPTYTKSNLAQHSCMNSHFPKPYQCDRCS  148 (198)
Q Consensus        69 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~~~~~~~~~~~~~~~~l~~H~~~~~~~~~~~~C~~C~  148 (198)
                      ...|.|.+|++.|.-..-|.+|++-|.+.+.+.|..||+.|-+             .-+|++|+++|+ |-+||+|..|+
T Consensus       115 ~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfnd-------------tfdlkrh~rtht-gvrpykc~~c~  180 (267)
T KOG3576|consen  115 QDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFND-------------TFDLKRHTRTHT-GVRPYKCSLCE  180 (267)
T ss_pred             CCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccc-------------hhhhhhhhcccc-Cccccchhhhh
Confidence            4568999999999999999999999999999999999999987             889999999999 89999999999


Q ss_pred             hhhcChhHHHhhhhhhCCC---------CCCCcccccccCCCcccc
Q psy11761        149 QFFGDRMNLISHHCHKHKQ---------SCLPFISRLFGFDDGDKV  185 (198)
Q Consensus       149 k~f~~~~~L~~H~~~~~~~---------~~~~~~~~~~~~~~~~~~  185 (198)
                      |+|+++.+|..|++..||.         +..-|.|+.||+...+.-
T Consensus       181 kaftqrcsleshl~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e  226 (267)
T KOG3576|consen  181 KAFTQRCSLESHLKKVHGVQHQYAYKERRAKLYVCEDCGYTSERPE  226 (267)
T ss_pred             HHHHhhccHHHHHHHHcCchHHHHHHHhhhheeeecccCCCCCChh
Confidence            9999999999999888762         344678999999876543


No 9  
>KOG3623|consensus
Probab=99.44  E-value=2.6e-14  Score=119.36  Aligned_cols=81  Identities=36%  Similarity=0.773  Sum_probs=76.3

Q ss_pred             CCCCccCccchhcccCchhHHHhhhhcCCCCcccCCcCchhhhcccCCCcccCCCcCcccccccccccccCCCCeeCCcc
Q psy11761         68 KPRPYKCDTCEKSFTNSQNLNTHQLIHSGIRPFKCTTCDKSFVNQINPTSTHTPTYTKSNLAQHSCMNSHFPKPYQCDRC  147 (198)
Q Consensus        68 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~~~~~~~~~~~~~~~~l~~H~~~~~~~~~~~~C~~C  147 (198)
                      ...+|.|+.|++.|--..+|.+|.-.|+|.+||.|.+|.++|..             +.+|..|+|.|. |+|||+|+.|
T Consensus       891 e~gmyaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKH-------------KHHLtEHkRLHS-GEKPfQCdKC  956 (1007)
T KOG3623|consen  891 EDGMYACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKH-------------KHHLTEHKRLHS-GEKPFQCDKC  956 (1007)
T ss_pred             ccccchHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhh-------------hhhhhhhhhhcc-CCCcchhhhh
Confidence            45689999999999999999999999999999999999999998             999999999999 8999999999


Q ss_pred             hhhhcChhHHHhhhh
Q psy11761        148 SQFFGDRMNLISHHC  162 (198)
Q Consensus       148 ~k~f~~~~~L~~H~~  162 (198)
                      +|+|....++.+||.
T Consensus       957 lKRFSHSGSYSQHMN  971 (1007)
T KOG3623|consen  957 LKRFSHSGSYSQHMN  971 (1007)
T ss_pred             hhhcccccchHhhhc
Confidence            999999999999985


No 10 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.40  E-value=2.3e-13  Score=113.38  Aligned_cols=130  Identities=17%  Similarity=0.356  Sum_probs=102.7

Q ss_pred             cccCc--ccchhhcccCCCceecCccccccCChhHHhhcccCCCCCCCccCccchhcccCchhHHHhhhhcCCCCcccCC
Q psy11761         26 YKCHQ--CQRLIFLSANAGVHKCEYCHKVFDQQSSLLSHNCPQMKPRPYKCDTCEKSFTNSQNLNTHQLIHSGIRPFKCT  103 (198)
Q Consensus        26 ~~C~~--C~~~f~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~  103 (198)
                      ..|+.  |+..|....-...+.|+.|++.|. ...|..|+..++  .++.|+ |+..+ ....|..|+.+|.+.+++.|+
T Consensus       434 V~Cp~~~Cg~v~~r~el~~H~~C~~Cgk~f~-~s~LekH~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~  508 (567)
T PLN03086        434 VVCPHDGCGIVLRVEEAKNHVHCEKCGQAFQ-QGEMEKHMKVFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCR  508 (567)
T ss_pred             eeCCcccccceeeccccccCccCCCCCCccc-hHHHHHHHHhcC--CCccCC-CCCCc-chhHHHhhhhccCCCCceeCC
Confidence            45875  999887777777889999999996 577999999886  789999 99765 568899999999999999999


Q ss_pred             cCchhhhcccCCCcccCCCcCcccccccccccccCCCCeeCCcchhhhcChhHHHhhhhhhCC
Q psy11761        104 TCDKSFVNQINPTSTHTPTYTKSNLAQHSCMNSHFPKPYQCDRCSQFFGDRMNLISHHCHKHK  166 (198)
Q Consensus       104 ~C~~~f~~~~~~~~~~~~~~~~~~l~~H~~~~~~~~~~~~C~~C~k~f~~~~~L~~H~~~~~~  166 (198)
                      .|++.|....++.+   .....+.|..|....  +.+++.|..||+.+..+ .+..|+...|.
T Consensus       509 fC~~~v~~g~~~~d---~~d~~s~Lt~HE~~C--G~rt~~C~~Cgk~Vrlr-dm~~H~~~~h~  565 (567)
T PLN03086        509 FCGDMVQAGGSAMD---VRDRLRGMSEHESIC--GSRTAPCDSCGRSVMLK-EMDIHQIAVHQ  565 (567)
T ss_pred             CCCCccccCccccc---hhhhhhhHHHHHHhc--CCcceEccccCCeeeeh-hHHHHHHHhhc
Confidence            99999853111000   000145788998886  68999999999999888 88999877664


No 11 
>KOG3623|consensus
Probab=99.37  E-value=1e-13  Score=115.84  Aligned_cols=78  Identities=37%  Similarity=0.800  Sum_probs=74.2

Q ss_pred             ceecCccccccCChhHHhhcccCCCCCCCccCccchhcccCchhHHHhhhhcCCCCcccCCcCchhhhcccCCCcccCCC
Q psy11761         43 VHKCEYCHKVFDQQSSLLSHNCPQMKPRPYKCDTCEKSFTNSQNLNTHQLIHSGIRPFKCTTCDKSFVNQINPTSTHTPT  122 (198)
Q Consensus        43 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~~~~~~~~~~~  122 (198)
                      +|.|.+|.+.|...++|.+|.=-|+|.+||.|.+|.++|..+..|..|+|.|.|+|||.|+.|+++|..           
T Consensus       894 myaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRFSH-----------  962 (1007)
T KOG3623|consen  894 MYACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSH-----------  962 (1007)
T ss_pred             cchHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhccc-----------
Confidence            799999999999999999999999999999999999999999999999999999999999999999998           


Q ss_pred             cCccccccccc
Q psy11761        123 YTKSNLAQHSC  133 (198)
Q Consensus       123 ~~~~~l~~H~~  133 (198)
                        ...+.+||.
T Consensus       963 --SGSYSQHMN  971 (1007)
T KOG3623|consen  963 --SGSYSQHMN  971 (1007)
T ss_pred             --ccchHhhhc
Confidence              677777773


No 12 
>PHA00733 hypothetical protein
Probab=99.07  E-value=6.4e-11  Score=81.58  Aligned_cols=94  Identities=20%  Similarity=0.357  Sum_probs=70.1

Q ss_pred             hHHhhcccCCCCCCCccCccchhcccCchhHHHh--h---hhcCCCCcccCCcCchhhhcccCCCcccCCCcCccccccc
Q psy11761         57 SSLLSHNCPQMKPRPYKCDTCEKSFTNSQNLNTH--Q---LIHSGIRPFKCTTCDKSFVNQINPTSTHTPTYTKSNLAQH  131 (198)
Q Consensus        57 ~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H--~---~~h~~~k~~~C~~C~~~f~~~~~~~~~~~~~~~~~~l~~H  131 (198)
                      .+|..+-..-...+++.|.+|...|.....|..+  +   ..+.+.+||.|+.|++.|.+             .+.|..|
T Consensus        26 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss-------------~s~L~~H   92 (128)
T PHA00733         26 EELKRYHSLTPEQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSS-------------SVSLKQH   92 (128)
T ss_pred             HHhhhhhcCChhhhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCC-------------HHHHHHH
Confidence            3443332223335678899998888776555544  1   12345789999999999998             8889999


Q ss_pred             ccccccCCCCeeCCcchhhhcChhHHHhhhhhhCC
Q psy11761        132 SCMNSHFPKPYQCDRCSQFFGDRMNLISHHCHKHK  166 (198)
Q Consensus       132 ~~~~~~~~~~~~C~~C~k~f~~~~~L~~H~~~~~~  166 (198)
                      ++.+   +.++.|+.|++.|.....|..|+...|+
T Consensus        93 ~r~h---~~~~~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         93 IRYT---EHSKVCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             HhcC---CcCccCCCCCCccCCHHHHHHHHHHhcC
Confidence            9865   3579999999999999999999988775


No 13 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.94  E-value=8.1e-10  Score=92.48  Aligned_cols=124  Identities=18%  Similarity=0.374  Sum_probs=91.2

Q ss_pred             cccCcccchhhcccCCC--------ceecCc--cccccCChhHHhhcccCCCCCCCccCccchhcccCchhHHHhhhhcC
Q psy11761         26 YKCHQCQRLIFLSANAG--------VHKCEY--CHKVFDQQSSLLSHNCPQMKPRPYKCDTCEKSFTNSQNLNTHQLIHS   95 (198)
Q Consensus        26 ~~C~~C~~~f~~~~~~~--------~~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~   95 (198)
                      ..|+.|.+......-..        .-.|+.  |+..|.. ..+..|         +.|+.|++.|. ...+..|+..++
T Consensus       408 V~C~NC~~~i~l~~l~lHe~~C~r~~V~Cp~~~Cg~v~~r-~el~~H---------~~C~~Cgk~f~-~s~LekH~~~~H  476 (567)
T PLN03086        408 VECRNCKHYIPSRSIALHEAYCSRHNVVCPHDGCGIVLRV-EEAKNH---------VHCEKCGQAFQ-QGEMEKHMKVFH  476 (567)
T ss_pred             EECCCCCCccchhHHHHHHhhCCCcceeCCcccccceeec-cccccC---------ccCCCCCCccc-hHHHHHHHHhcC
Confidence            46888887654432211        235774  8887733 334444         48999999996 577999999975


Q ss_pred             CCCcccCCcCchhhhcccCCCcccCCCcCcccccccccccccCCCCeeCCcchhhhcC----------hhHHHhhhhhhC
Q psy11761         96 GIRPFKCTTCDKSFVNQINPTSTHTPTYTKSNLAQHSCMNSHFPKPYQCDRCSQFFGD----------RMNLISHHCHKH  165 (198)
Q Consensus        96 ~~k~~~C~~C~~~f~~~~~~~~~~~~~~~~~~l~~H~~~~~~~~~~~~C~~C~k~f~~----------~~~L~~H~~~~~  165 (198)
                        +++.|+ ||+.+ .             +..|..|...+. ..+++.|+.|++.|..          .+.|..|.... 
T Consensus       477 --kpv~Cp-Cg~~~-~-------------R~~L~~H~~thC-p~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-  537 (567)
T PLN03086        477 --EPLQCP-CGVVL-E-------------KEQMVQHQASTC-PLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC-  537 (567)
T ss_pred             --CCccCC-CCCCc-c-------------hhHHHhhhhccC-CCCceeCCCCCCccccCccccchhhhhhhHHHHHHhc-
Confidence              789999 99765 4             789999998888 6899999999999952          34788897774 


Q ss_pred             CCCCCCcccccccCCC
Q psy11761        166 KQSCLPFISRLFGFDD  181 (198)
Q Consensus       166 ~~~~~~~~~~~~~~~~  181 (198)
                      |.++  +.|..|+...
T Consensus       538 G~rt--~~C~~Cgk~V  551 (567)
T PLN03086        538 GSRT--APCDSCGRSV  551 (567)
T ss_pred             CCcc--eEccccCCee
Confidence            7774  5668887543


No 14 
>KOG3993|consensus
Probab=98.74  E-value=3.4e-09  Score=84.22  Aligned_cols=113  Identities=19%  Similarity=0.423  Sum_probs=79.8

Q ss_pred             ceecCccccccCChhHHhhcccCCCCCCCccCccchhcccCchhHHHhhhhcCCCCcccCCcCchhhhcccCCCcccCCC
Q psy11761         43 VHKCEYCHKVFDQQSSLLSHNCPQMKPRPYKCDTCEKSFTNSQNLNTHQLIHSGIRPFKCTTCDKSFVNQINPTSTHTPT  122 (198)
Q Consensus        43 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~~~~~~~~~~~  122 (198)
                      -|.|+.|...|...-.|..|.-.......|+|++|++.|+..++|..|.++|.+...-.-        ....+.+.... 
T Consensus       267 dyiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~--------a~~~P~k~~~~-  337 (500)
T KOG3993|consen  267 DYICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAK--------AGSPPPKQAVE-  337 (500)
T ss_pred             HHHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhh--------cCCCChhhhhh-
Confidence            589999999999999999999988888899999999999999999999999986542110        00001000000 


Q ss_pred             cCccccccccc-c-cccCCCCeeCCcchhhhcChhHHHhhhhhhCC
Q psy11761        123 YTKSNLAQHSC-M-NSHFPKPYQCDRCSQFFGDRMNLISHHCHKHK  166 (198)
Q Consensus       123 ~~~~~l~~H~~-~-~~~~~~~~~C~~C~k~f~~~~~L~~H~~~~~~  166 (198)
                        ...+.+-.- . ....+.-|.|..|+|.|.+..-|++|+.+|+.
T Consensus       338 --~rae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~  381 (500)
T KOG3993|consen  338 --TRAEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQR  381 (500)
T ss_pred             --hhhhhhhccccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhc
Confidence              000000000 0 00124589999999999999999999988863


No 15 
>PHA00733 hypothetical protein
Probab=98.67  E-value=5.8e-09  Score=71.89  Aligned_cols=78  Identities=21%  Similarity=0.330  Sum_probs=60.4

Q ss_pred             ceecCccccccCChhH------HhhcccCCCCCCCccCccchhcccCchhHHHhhhhcCCCCcccCCcCchhhhcccCCC
Q psy11761         43 VHKCEYCHKVFDQQSS------LLSHNCPQMKPRPYKCDTCEKSFTNSQNLNTHQLIHSGIRPFKCTTCDKSFVNQINPT  116 (198)
Q Consensus        43 ~~~C~~C~~~f~~~~~------l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~~~~~  116 (198)
                      ++.|.+|...|.....      |..|+. +++.+||.|+.|++.|.....|..|++.+  ..+|.|..|++.|..     
T Consensus        40 ~~~~~~~~~~~~~~~~l~~~~~l~~~~~-~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~-----  111 (128)
T PHA00733         40 RLIRAVVKTLIYNPQLLDESSYLYKLLT-SKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRN-----  111 (128)
T ss_pred             hHHHHHHhhhccChhhhcchHHHHhhcc-cCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCC-----
Confidence            3456666665555443      344443 34588999999999999999999999876  357999999999998     


Q ss_pred             cccCCCcCcccccccccccc
Q psy11761        117 STHTPTYTKSNLAQHSCMNS  136 (198)
Q Consensus       117 ~~~~~~~~~~~l~~H~~~~~  136 (198)
                              ...|..|++..+
T Consensus       112 --------~~sL~~H~~~~h  123 (128)
T PHA00733        112 --------TDSTLDHVCKKH  123 (128)
T ss_pred             --------HHHHHHHHHHhc
Confidence                    888999987766


No 16 
>PHA02768 hypothetical protein; Provisional
Probab=98.64  E-value=1.6e-08  Score=58.11  Aligned_cols=39  Identities=21%  Similarity=0.526  Sum_probs=29.8

Q ss_pred             CccCccchhcccCchhHHHhhhhcCCCCcccCCcCchhhhc
Q psy11761         71 PYKCDTCEKSFTNSQNLNTHQLIHSGIRPFKCTTCDKSFVN  111 (198)
Q Consensus        71 ~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~  111 (198)
                      .|.|+.||+.|.....|..|+++|+  +++.|..|++.|..
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~   43 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLR   43 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceecc
Confidence            4677778888877777778877777  57777778777765


No 17 
>PHA02768 hypothetical protein; Provisional
Probab=98.51  E-value=3.8e-08  Score=56.62  Aligned_cols=46  Identities=13%  Similarity=0.275  Sum_probs=40.4

Q ss_pred             CCceecCccccccCChhHHhhcccCCCCCCCccCccchhcccCchhHH
Q psy11761         41 AGVHKCEYCHKVFDQQSSLLSHNCPQMKPRPYKCDTCEKSFTNSQNLN   88 (198)
Q Consensus        41 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~   88 (198)
                      +..|.|+.||+.|.....|..|++.|+  ++++|..|++.|.....|.
T Consensus         3 ~~~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          3 LLGYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceecccceeE
Confidence            446899999999999999999999999  7999999999998765543


No 18 
>PHA00616 hypothetical protein
Probab=98.50  E-value=6.8e-08  Score=52.89  Aligned_cols=32  Identities=38%  Similarity=0.664  Sum_probs=29.4

Q ss_pred             CeeCCcchhhhcChhHHHhhhhhhCCCCCCCc
Q psy11761        141 PYQCDRCSQFFGDRMNLISHHCHKHKQSCLPF  172 (198)
Q Consensus       141 ~~~C~~C~k~f~~~~~L~~H~~~~~~~~~~~~  172 (198)
                      ||+|+.||+.|..+++|.+|++.|||++++..
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~   32 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTL   32 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccce
Confidence            68999999999999999999999999986653


No 19 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.46  E-value=6.3e-08  Score=47.58  Aligned_cols=25  Identities=48%  Similarity=0.970  Sum_probs=21.8

Q ss_pred             hHHHhhhhcCCCCcccCCcCchhhh
Q psy11761         86 NLNTHQLIHSGIRPFKCTTCDKSFV  110 (198)
Q Consensus        86 ~l~~H~~~h~~~k~~~C~~C~~~f~  110 (198)
                      +|..|+++|++++||.|+.|++.|.
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEES
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeC
Confidence            4778999999999999999998885


No 20 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.46  E-value=3.2e-08  Score=48.65  Aligned_cols=23  Identities=22%  Similarity=0.544  Sum_probs=21.3

Q ss_pred             hhhhhhhCCCCccccCcccchhh
Q psy11761         14 QTLLCIHGNDNAYKCHQCQRLIF   36 (198)
Q Consensus        14 ~~h~~~h~~~~~~~C~~C~~~f~   36 (198)
                      +.||++|+|++||.|+.|++.|.
T Consensus         3 ~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    3 RRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHSSSSSEEESSSSEEES
T ss_pred             HHHhhhcCCCCCCCCCCCcCeeC
Confidence            49999999999999999999885


No 21 
>PHA00616 hypothetical protein
Probab=98.09  E-value=1.4e-06  Score=47.77  Aligned_cols=34  Identities=18%  Similarity=0.302  Sum_probs=24.4

Q ss_pred             CccCccchhcccCchhHHHhhhhcCCCCcccCCc
Q psy11761         71 PYKCDTCEKSFTNSQNLNTHQLIHSGIRPFKCTT  104 (198)
Q Consensus        71 ~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~  104 (198)
                      ||+|+.||+.|....++..|++.|++++++.|+.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccceeE
Confidence            5677777777777777777777777777776654


No 22 
>KOG3993|consensus
Probab=98.07  E-value=1.4e-06  Score=69.73  Aligned_cols=70  Identities=30%  Similarity=0.533  Sum_probs=55.6

Q ss_pred             cccCcccchhhcccCCC----------ceecCccccccCChhHHhhcccCCCC--------C------------------
Q psy11761         26 YKCHQCQRLIFLSANAG----------VHKCEYCHKVFDQQSSLLSHNCPQMK--------P------------------   69 (198)
Q Consensus        26 ~~C~~C~~~f~~~~~~~----------~~~C~~C~~~f~~~~~l~~H~~~h~~--------~------------------   69 (198)
                      |.|..|-..|.....|.          .|+|++|++.|....+|..|++=|..        .                  
T Consensus       268 yiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~r  347 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAER  347 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccc
Confidence            78888887776544443          58999999999999999999776631        1                  


Q ss_pred             -------CCccCccchhcccCchhHHHhhhhcC
Q psy11761         70 -------RPYKCDTCEKSFTNSQNLNTHQLIHS   95 (198)
Q Consensus        70 -------~~~~C~~C~~~f~~~~~l~~H~~~h~   95 (198)
                             .-|.|..|++.|...+-|..|+.+|.
T Consensus       348 sg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq  380 (500)
T KOG3993|consen  348 SGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQ  380 (500)
T ss_pred             cCCcccCceeecHHhhhhhHHHHHHHHhHHhhh
Confidence                   12889999999999999999988764


No 23 
>PHA00732 hypothetical protein
Probab=98.03  E-value=4e-06  Score=52.67  Aligned_cols=50  Identities=28%  Similarity=0.422  Sum_probs=39.2

Q ss_pred             ceecCccccccCChhHHhhcccCCCCCCCccCccchhcccCchhHHHhhhhcCCC
Q psy11761         43 VHKCEYCHKVFDQQSSLLSHNCPQMKPRPYKCDTCEKSFTNSQNLNTHQLIHSGI   97 (198)
Q Consensus        43 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~   97 (198)
                      ||.|..|++.|.....|..|++.++.  ++.|+.|++.|.   .+..|.+++.+.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~--~~~C~~CgKsF~---~l~~H~~~~~~~   50 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT--LTKCPVCNKSYR---RLNQHFYSQYDI   50 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC--CCccCCCCCEeC---ChhhhhcccCCc
Confidence            57899999999999999999875332  358999999987   477788777654


No 24 
>PHA00732 hypothetical protein
Probab=98.01  E-value=1.5e-06  Score=54.54  Aligned_cols=47  Identities=28%  Similarity=0.480  Sum_probs=36.4

Q ss_pred             cccCCcCchhhhcccCCCcccCCCcCcccccccccccccCCCCeeCCcchhhhcChhHHHhhhhhh
Q psy11761         99 PFKCTTCDKSFVNQINPTSTHTPTYTKSNLAQHSCMNSHFPKPYQCDRCSQFFGDRMNLISHHCHK  164 (198)
Q Consensus        99 ~~~C~~C~~~f~~~~~~~~~~~~~~~~~~l~~H~~~~~~~~~~~~C~~C~k~f~~~~~L~~H~~~~  164 (198)
                      ||.|..|++.|.+             .++|..|++.++.   ++.|+.|++.|.   .|..|..++
T Consensus         1 py~C~~Cgk~F~s-------------~s~Lk~H~r~~H~---~~~C~~CgKsF~---~l~~H~~~~   47 (79)
T PHA00732          1 MFKCPICGFTTVT-------------LFALKQHARRNHT---LTKCPVCNKSYR---RLNQHFYSQ   47 (79)
T ss_pred             CccCCCCCCccCC-------------HHHHHHHhhcccC---CCccCCCCCEeC---Chhhhhccc
Confidence            5789999999988             8889999885431   358999999997   467776544


No 25 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.96  E-value=3.5e-06  Score=49.10  Aligned_cols=52  Identities=33%  Similarity=0.547  Sum_probs=38.8

Q ss_pred             cccCCcCchhhhcccCCCcccCCCcCcccccccccccccCC-CCeeCCcchhhhcChhHHHhhhhhhCC
Q psy11761         99 PFKCTTCDKSFVNQINPTSTHTPTYTKSNLAQHSCMNSHFP-KPYQCDRCSQFFGDRMNLISHHCHKHK  166 (198)
Q Consensus        99 ~~~C~~C~~~f~~~~~~~~~~~~~~~~~~l~~H~~~~~~~~-~~~~C~~C~k~f~~~~~L~~H~~~~~~  166 (198)
                      .|.|+.|++.|.              ...|..|....+..+ +.+.|++|...++  .+|..|+..+|+
T Consensus         2 ~f~CP~C~~~~~--------------~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H~   54 (54)
T PF05605_consen    2 SFTCPYCGKGFS--------------ESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQHR   54 (54)
T ss_pred             CcCCCCCCCccC--------------HHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhcC
Confidence            478999999554              678888987765443 5688999998754  388888887663


No 26 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.92  E-value=4.8e-06  Score=39.47  Aligned_cols=23  Identities=30%  Similarity=0.677  Sum_probs=21.3

Q ss_pred             eeCCcchhhhcChhHHHhhhhhh
Q psy11761        142 YQCDRCSQFFGDRMNLISHHCHK  164 (198)
Q Consensus       142 ~~C~~C~k~f~~~~~L~~H~~~~  164 (198)
                      |+|+.|++.|.+++.|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            68999999999999999999874


No 27 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.81  E-value=1.4e-05  Score=38.06  Aligned_cols=24  Identities=29%  Similarity=0.641  Sum_probs=20.5

Q ss_pred             eeCCcchhhhcChhHHHhhhhhhC
Q psy11761        142 YQCDRCSQFFGDRMNLISHHCHKH  165 (198)
Q Consensus       142 ~~C~~C~k~f~~~~~L~~H~~~~~  165 (198)
                      |.|++|++.|.+...|..|+.++|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            689999999999999999998875


No 28 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.70  E-value=1.9e-05  Score=38.96  Aligned_cols=26  Identities=27%  Similarity=0.662  Sum_probs=23.7

Q ss_pred             CeeCCcchhhhcChhHHHhhhhhhCC
Q psy11761        141 PYQCDRCSQFFGDRMNLISHHCHKHK  166 (198)
Q Consensus       141 ~~~C~~C~k~f~~~~~L~~H~~~~~~  166 (198)
                      +|+|+.|++.|.+...|..|++.|++
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhcC
Confidence            68999999999999999999988763


No 29 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.42  E-value=5.9e-05  Score=58.54  Aligned_cols=53  Identities=28%  Similarity=0.632  Sum_probs=40.7

Q ss_pred             CCcccCCc--CchhhhcccCCCcccCCCcCcccccccccccc------------------cCCCCeeCCcchhhhcChhH
Q psy11761         97 IRPFKCTT--CDKSFVNQINPTSTHTPTYTKSNLAQHSCMNS------------------HFPKPYQCDRCSQFFGDRMN  156 (198)
Q Consensus        97 ~k~~~C~~--C~~~f~~~~~~~~~~~~~~~~~~l~~H~~~~~------------------~~~~~~~C~~C~k~f~~~~~  156 (198)
                      +|||.|++  |.+.+.+             ..+|+-|+.--+                  ...|||.|++|+|.|.....
T Consensus       347 ~KpykCpV~gC~K~Ykn-------------qnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNG  413 (423)
T COG5189         347 GKPYKCPVEGCNKKYKN-------------QNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNG  413 (423)
T ss_pred             CceecCCCCCchhhhcc-------------ccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCcc
Confidence            69999987  9999998             555555553221                  02589999999999999988


Q ss_pred             HHhhhh
Q psy11761        157 LISHHC  162 (198)
Q Consensus       157 L~~H~~  162 (198)
                      |..|..
T Consensus       414 LKYHr~  419 (423)
T COG5189         414 LKYHRK  419 (423)
T ss_pred             ceeccc
Confidence            888853


No 30 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.29  E-value=0.00018  Score=47.00  Aligned_cols=73  Identities=23%  Similarity=0.419  Sum_probs=21.4

Q ss_pred             cCccchhcccCchhHHHhhhhcCCCCcccCCcCchhhhcccCCCcccCCCcCcccccccccccccCCCCeeCCcchhhhc
Q psy11761         73 KCDTCEKSFTNSQNLNTHQLIHSGIRPFKCTTCDKSFVNQINPTSTHTPTYTKSNLAQHSCMNSHFPKPYQCDRCSQFFG  152 (198)
Q Consensus        73 ~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~~~~~~~~~~~~~~~~l~~H~~~~~~~~~~~~C~~C~k~f~  152 (198)
                      .|..|+..|.+...+..|+...++...   +.. ..+..             ...+..+....  ....+.|..|++.|.
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~---~~~-~~l~~-------------~~~~~~~~~~~--~~~~~~C~~C~~~f~   61 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDI---PDQ-KYLVD-------------PNRLLNYLRKK--VKESFRCPYCNKTFR   61 (100)
T ss_dssp             -------------------------------------------------------------------SSEEBSSSS-EES
T ss_pred             Ccccccccccccccccccccccccccc---ccc-ccccc-------------ccccccccccc--cCCCCCCCccCCCCc
Confidence            377788888877778888765554321   111 11112             33333333322  234799999999999


Q ss_pred             ChhHHHhhhhhh
Q psy11761        153 DRMNLISHHCHK  164 (198)
Q Consensus       153 ~~~~L~~H~~~~  164 (198)
                      +...|..|+..+
T Consensus        62 s~~~l~~Hm~~~   73 (100)
T PF12756_consen   62 SREALQEHMRSK   73 (100)
T ss_dssp             SHHHHHHHHHHT
T ss_pred             CHHHHHHHHcCc
Confidence            999999999865


No 31 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.27  E-value=0.0003  Score=39.53  Aligned_cols=40  Identities=20%  Similarity=0.279  Sum_probs=26.6

Q ss_pred             ccccccccCCCCeeCCcchhhhcChhHHHhhhhhhCCCCC
Q psy11761        130 QHSCMNSHFPKPYQCDRCSQFFGDRMNLISHHCHKHKQSC  169 (198)
Q Consensus       130 ~H~~~~~~~~~~~~C~~C~k~f~~~~~L~~H~~~~~~~~~  169 (198)
                      .+.+.+...+.|..|++|+..+.+.-+|.+|+...|+.+|
T Consensus        13 ~~~k~~~~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   13 KKPKSKSQSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             ---CCCCTTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             hHHHHhhccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            3444444457899999999999999999999999998886


No 32 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.16  E-value=0.00038  Score=40.41  Aligned_cols=42  Identities=17%  Similarity=0.392  Sum_probs=34.6

Q ss_pred             CeeCCcchhhhcChhHHHhhhhhhCCCCCCCcccccccCCCcc
Q psy11761        141 PYQCDRCSQFFGDRMNLISHHCHKHKQSCLPFISRLFGFDDGD  183 (198)
Q Consensus       141 ~~~C~~C~k~f~~~~~L~~H~~~~~~~~~~~~~~~~~~~~~~~  183 (198)
                      .|.|++|++.| +...|..|....|...+..+.|++|....++
T Consensus         2 ~f~CP~C~~~~-~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~~   43 (54)
T PF05605_consen    2 SFTCPYCGKGF-SESSLVEHCEDEHRSESKNVVCPICSSRVTD   43 (54)
T ss_pred             CcCCCCCCCcc-CHHHHHHHHHhHCcCCCCCccCCCchhhhhh
Confidence            58999999955 5669999999888777778999999976554


No 33 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.04  E-value=0.0002  Score=33.71  Aligned_cols=21  Identities=43%  Similarity=0.762  Sum_probs=11.1

Q ss_pred             cCccchhcccCchhHHHhhhh
Q psy11761         73 KCDTCEKSFTNSQNLNTHQLI   93 (198)
Q Consensus        73 ~C~~C~~~f~~~~~l~~H~~~   93 (198)
                      .|+.|++.|.....|..|++.
T Consensus         2 ~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    2 KCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCccCCHHHHHHHHhH
Confidence            455555555555555555543


No 34 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.90  E-value=0.00066  Score=32.48  Aligned_cols=24  Identities=25%  Similarity=0.632  Sum_probs=21.4

Q ss_pred             eeCCcchhhhcChhHHHhhhhhhC
Q psy11761        142 YQCDRCSQFFGDRMNLISHHCHKH  165 (198)
Q Consensus       142 ~~C~~C~k~f~~~~~L~~H~~~~~  165 (198)
                      |+|+.|++.|.+...|..|+..|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            579999999999999999998653


No 35 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=96.82  E-value=0.00061  Score=33.37  Aligned_cols=24  Identities=29%  Similarity=0.592  Sum_probs=13.2

Q ss_pred             eecCccccccCChhHHhhcccCCC
Q psy11761         44 HKCEYCHKVFDQQSSLLSHNCPQM   67 (198)
Q Consensus        44 ~~C~~C~~~f~~~~~l~~H~~~h~   67 (198)
                      |.|..|++.|.....|..|++.|.
T Consensus         2 ~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    2 FECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             EEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCccCCccCChhHHHHHhHHhc
Confidence            455555555555555555555443


No 36 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=96.62  E-value=0.00046  Score=45.06  Aligned_cols=77  Identities=21%  Similarity=0.374  Sum_probs=22.1

Q ss_pred             ecCccccccCChhHHhhcccCCCCCCCccCccchhcccCchhHHHhhhhcCCCCcccCCcCchhhhcccCCCcccCCCcC
Q psy11761         45 KCEYCHKVFDQQSSLLSHNCPQMKPRPYKCDTCEKSFTNSQNLNTHQLIHSGIRPFKCTTCDKSFVNQINPTSTHTPTYT  124 (198)
Q Consensus        45 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~~~~~~~~~~~~~  124 (198)
                      +|..|+..|.....|..|+...++...-    ....+.....+..+.+.... ..+.|..|++.|.+             
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~----~~~~l~~~~~~~~~~~~~~~-~~~~C~~C~~~f~s-------------   62 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIP----DQKYLVDPNRLLNYLRKKVK-ESFRCPYCNKTFRS-------------   62 (100)
T ss_dssp             -----------------------------------------------------SSEEBSSSS-EESS-------------
T ss_pred             Cccccccccccccccccccccccccccc----cccccccccccccccccccC-CCCCCCccCCCCcC-------------
Confidence            4889999999999999998776653211    11111222233333332222 26899999999988             


Q ss_pred             cccccccccccccCC
Q psy11761        125 KSNLAQHSCMNSHFP  139 (198)
Q Consensus       125 ~~~l~~H~~~~~~~~  139 (198)
                      ...|..|++.+.+..
T Consensus        63 ~~~l~~Hm~~~~H~~   77 (100)
T PF12756_consen   63 REALQEHMRSKHHKK   77 (100)
T ss_dssp             HHHHHHHHHHTTTTC
T ss_pred             HHHHHHHHcCccCCC
Confidence            888999998765433


No 37 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=96.57  E-value=0.001  Score=31.23  Aligned_cols=23  Identities=35%  Similarity=0.787  Sum_probs=11.5

Q ss_pred             ccCccchhcccCchhHHHhhhhc
Q psy11761         72 YKCDTCEKSFTNSQNLNTHQLIH   94 (198)
Q Consensus        72 ~~C~~C~~~f~~~~~l~~H~~~h   94 (198)
                      |.|+.|+..|.+...|..|+..+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            34555555555555555555543


No 38 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=96.53  E-value=0.0011  Score=51.62  Aligned_cols=25  Identities=36%  Similarity=0.946  Sum_probs=20.0

Q ss_pred             CCCCccCccchhcccCchhHHHhhh
Q psy11761         68 KPRPYKCDTCEKSFTNSQNLNTHQL   92 (198)
Q Consensus        68 ~~~~~~C~~C~~~f~~~~~l~~H~~   92 (198)
                      ..+||+|+.|++++.+...|.-|+.
T Consensus       395 ~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         395 KDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             cCCceeccccchhhccCccceeccc
Confidence            3589999999999988877766643


No 39 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.40  E-value=0.0019  Score=30.65  Aligned_cols=24  Identities=33%  Similarity=0.595  Sum_probs=19.3

Q ss_pred             eeCCcchhhhcChhHHHhhhhhhCC
Q psy11761        142 YQCDRCSQFFGDRMNLISHHCHKHK  166 (198)
Q Consensus       142 ~~C~~C~k~f~~~~~L~~H~~~~~~  166 (198)
                      |+|+.|+.... ...|..|+..+|+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhCc
Confidence            68999999988 8899999998764


No 40 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.23  E-value=0.0024  Score=30.52  Aligned_cols=23  Identities=30%  Similarity=0.609  Sum_probs=20.5

Q ss_pred             eeCCcchhhhcChhHHHhhhhhh
Q psy11761        142 YQCDRCSQFFGDRMNLISHHCHK  164 (198)
Q Consensus       142 ~~C~~C~k~f~~~~~L~~H~~~~  164 (198)
                      |.|++|++.|.+...|..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            67999999999999999998643


No 41 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=95.87  E-value=0.004  Score=30.47  Aligned_cols=22  Identities=27%  Similarity=0.730  Sum_probs=20.2

Q ss_pred             eeCCcchhhhcChhHHHhhhhh
Q psy11761        142 YQCDRCSQFFGDRMNLISHHCH  163 (198)
Q Consensus       142 ~~C~~C~k~f~~~~~L~~H~~~  163 (198)
                      |.|+.|++.|.+...|..|+..
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            7899999999999999999864


No 42 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=95.83  E-value=0.0079  Score=33.88  Aligned_cols=33  Identities=27%  Similarity=0.478  Sum_probs=20.7

Q ss_pred             CCCCCccCccchhcccCchhHHHhhhhcCCCCc
Q psy11761         67 MKPRPYKCDTCEKSFTNSQNLNTHQLIHSGIRP   99 (198)
Q Consensus        67 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~   99 (198)
                      ..+.|-.|++|+..++...+|.+|+...++.||
T Consensus        20 ~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   20 QSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             ccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            346677888888888888888888877776665


No 43 
>smart00355 ZnF_C2H2 zinc finger.
Probab=95.45  E-value=0.011  Score=27.97  Aligned_cols=23  Identities=35%  Similarity=0.797  Sum_probs=14.6

Q ss_pred             ccCccchhcccCchhHHHhhhhc
Q psy11761         72 YKCDTCEKSFTNSQNLNTHQLIH   94 (198)
Q Consensus        72 ~~C~~C~~~f~~~~~l~~H~~~h   94 (198)
                      |.|+.|++.|.....+..|++.|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            35666666666666666666644


No 44 
>PRK04860 hypothetical protein; Provisional
Probab=95.24  E-value=0.0095  Score=42.66  Aligned_cols=38  Identities=24%  Similarity=0.753  Sum_probs=31.6

Q ss_pred             CCccCccchhcccCchhHHHhhhhcCCCCcccCCcCchhhhc
Q psy11761         70 RPYKCDTCEKSFTNSQNLNTHQLIHSGIRPFKCTTCDKSFVN  111 (198)
Q Consensus        70 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~  111 (198)
                      -+|.|. |+.   ....+..|.+++.++++|.|..|+..|..
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~  155 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVF  155 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEE
Confidence            368997 886   55668899999999999999999988764


No 45 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=94.61  E-value=0.012  Score=27.99  Aligned_cols=22  Identities=36%  Similarity=0.792  Sum_probs=13.3

Q ss_pred             ccCccchhcccCchhHHHhhhh
Q psy11761         72 YKCDTCEKSFTNSQNLNTHQLI   93 (198)
Q Consensus        72 ~~C~~C~~~f~~~~~l~~H~~~   93 (198)
                      |.|.+|+..|.+...+..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            3466666666666666666554


No 46 
>PRK04860 hypothetical protein; Provisional
Probab=94.48  E-value=0.013  Score=41.96  Aligned_cols=38  Identities=21%  Similarity=0.531  Sum_probs=33.2

Q ss_pred             ceecCccccccCChhHHhhcccCCCCCCCccCccchhcccCc
Q psy11761         43 VHKCEYCHKVFDQQSSLLSHNCPQMKPRPYKCDTCEKSFTNS   84 (198)
Q Consensus        43 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~   84 (198)
                      +|.|. |+.   ....+.+|.+++.++++|.|..|+..|...
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEe
Confidence            68998 987   567789999999999999999999988654


No 47 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=94.25  E-value=0.046  Score=31.86  Aligned_cols=50  Identities=24%  Similarity=0.441  Sum_probs=31.6

Q ss_pred             CccccCcccchhhcccCCCceecCccccc-cCChhHHhhcccCCCCCCCccCccchh
Q psy11761         24 NAYKCHQCQRLIFLSANAGVHKCEYCHKV-FDQQSSLLSHNCPQMKPRPYKCDTCEK   79 (198)
Q Consensus        24 ~~~~C~~C~~~f~~~~~~~~~~C~~C~~~-f~~~~~l~~H~~~h~~~~~~~C~~C~~   79 (198)
                      .+..|..||...........|.|+.||+. ..+-..-+      ....+|.|+.||.
T Consensus         6 ~~~~CtSCg~~i~~~~~~~~F~CPnCG~~~I~RC~~CR------k~~~~Y~CP~CGF   56 (59)
T PRK14890          6 EPPKCTSCGIEIAPREKAVKFLCPNCGEVIIYRCEKCR------KQSNPYTCPKCGF   56 (59)
T ss_pred             cCccccCCCCcccCCCccCEeeCCCCCCeeEeechhHH------hcCCceECCCCCC
Confidence            45678888887766666678889999876 33222111      1135677777764


No 48 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=94.18  E-value=0.056  Score=44.34  Aligned_cols=62  Identities=29%  Similarity=0.535  Sum_probs=52.9

Q ss_pred             ceecCccccccCChhHHhhccc--CCCCC--CCccCc--cchhcccCchhHHHhhhhcCCCCcccCCc
Q psy11761         43 VHKCEYCHKVFDQQSSLLSHNC--PQMKP--RPYKCD--TCEKSFTNSQNLNTHQLIHSGIRPFKCTT  104 (198)
Q Consensus        43 ~~~C~~C~~~f~~~~~l~~H~~--~h~~~--~~~~C~--~C~~~f~~~~~l~~H~~~h~~~k~~~C~~  104 (198)
                      ++.|..|...|.....+..|..  .|.++  +++.|+  .|++.|.....+..|...|.+..++.+..
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  356 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKL  356 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCcccccc
Confidence            5778889999999999999988  78888  899999  79999999888889999888877766644


No 49 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=94.05  E-value=0.034  Score=26.66  Aligned_cols=20  Identities=25%  Similarity=0.464  Sum_probs=16.8

Q ss_pred             eeCCcchhhhcChhHHHhhhh
Q psy11761        142 YQCDRCSQFFGDRMNLISHHC  162 (198)
Q Consensus       142 ~~C~~C~k~f~~~~~L~~H~~  162 (198)
                      ..|+.||+.| ..+.|.+|..
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHH
Confidence            4799999999 6668999975


No 50 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=94.00  E-value=0.042  Score=31.98  Aligned_cols=50  Identities=24%  Similarity=0.424  Sum_probs=32.4

Q ss_pred             ccccCcccchhhcccCCCceecCccccccCChhHHhhcccCCCCCCCccCccchh
Q psy11761         25 AYKCHQCQRLIFLSANAGVHKCEYCHKVFDQQSSLLSHNCPQMKPRPYKCDTCEK   79 (198)
Q Consensus        25 ~~~C~~C~~~f~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~   79 (198)
                      +-.|..||...........|.|+.||+..-....--     .....+|.|+.||.
T Consensus         9 ~~~CtSCg~~i~p~e~~v~F~CPnCGe~~I~Rc~~C-----Rk~g~~Y~Cp~CGF   58 (61)
T COG2888           9 PPVCTSCGREIAPGETAVKFPCPNCGEVEIYRCAKC-----RKLGNPYRCPKCGF   58 (61)
T ss_pred             CceeccCCCEeccCCceeEeeCCCCCceeeehhhhH-----HHcCCceECCCcCc
Confidence            457888998876667777889999986533322211     11235788888764


No 51 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=93.94  E-value=0.021  Score=27.81  Aligned_cols=21  Identities=33%  Similarity=0.857  Sum_probs=11.3

Q ss_pred             ccCccchhcccCchhHHHhhh
Q psy11761         72 YKCDTCEKSFTNSQNLNTHQL   92 (198)
Q Consensus        72 ~~C~~C~~~f~~~~~l~~H~~   92 (198)
                      |.|..|++.|.+...+..|++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~   22 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMK   22 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTT
T ss_pred             CCcccCCCCcCCHHHHHHHHc
Confidence            345555555555555555544


No 52 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=93.77  E-value=0.022  Score=26.81  Aligned_cols=23  Identities=39%  Similarity=0.681  Sum_probs=13.5

Q ss_pred             ccCccchhcccCchhHHHhhhhcC
Q psy11761         72 YKCDTCEKSFTNSQNLNTHQLIHS   95 (198)
Q Consensus        72 ~~C~~C~~~f~~~~~l~~H~~~h~   95 (198)
                      |.|+.|+.... ...|..|++.+.
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            45777776666 666777766543


No 53 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=93.50  E-value=0.046  Score=30.40  Aligned_cols=29  Identities=31%  Similarity=0.695  Sum_probs=21.4

Q ss_pred             ccccCcccchhhcccCCCceecCcccccc
Q psy11761         25 AYKCHQCQRLIFLSANAGVHKCEYCHKVF   53 (198)
Q Consensus        25 ~~~C~~C~~~f~~~~~~~~~~C~~C~~~f   53 (198)
                      .|.|+.||..|.-........|+.||..+
T Consensus         3 ~y~C~~CG~~~~~~~~~~~~~Cp~CG~~~   31 (46)
T PRK00398          3 EYKCARCGREVELDEYGTGVRCPYCGYRI   31 (46)
T ss_pred             EEECCCCCCEEEECCCCCceECCCCCCeE
Confidence            57888888877665555578888887654


No 54 
>KOG2231|consensus
Probab=93.33  E-value=0.066  Score=46.54  Aligned_cols=120  Identities=23%  Similarity=0.396  Sum_probs=60.1

Q ss_pred             cccCcccchhhcccCCCceecCccccccCChhHHhhcccCCCCCCCccCccch---hcc------cCchhHHHhhhhcCC
Q psy11761         26 YKCHQCQRLIFLSANAGVHKCEYCHKVFDQQSSLLSHNCPQMKPRPYKCDTCE---KSF------TNSQNLNTHQLIHSG   96 (198)
Q Consensus        26 ~~C~~C~~~f~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~---~~f------~~~~~l~~H~~~h~~   96 (198)
                      +.|..|++.+...  .....|..| ..|.....|..|+...|.  -+.|..|-   +.|      -....|..|++....
T Consensus       100 ~~C~~C~~~~~~~--~~~~~~~~c-~~~~s~~~Lk~H~~~~H~--~~~c~lC~~~~kif~~e~k~Yt~~el~~h~~~gd~  174 (669)
T KOG2231|consen  100 HSCHICDRRFRAL--YNKKECLHC-TEFKSVENLKNHMRDQHK--LHLCSLCLQNLKIFINERKLYTRAELNLHLMFGDP  174 (669)
T ss_pred             hhcCccccchhhh--cccCCCccc-cchhHHHHHHHHHHHhhh--hhccccccccceeeeeeeehehHHHHHHHHhcCCC
Confidence            4577777765321  112346666 666677788888755442  33343332   122      223556666654322


Q ss_pred             -CC----cccCCcCchhhhcccCCCcccCCCcCcccccccccccccCCCCeeC---CcchhhhcChhHHHhhhhhhC
Q psy11761         97 -IR----PFKCTTCDKSFVNQINPTSTHTPTYTKSNLAQHSCMNSHFPKPYQC---DRCSQFFGDRMNLISHHCHKH  165 (198)
Q Consensus        97 -~k----~~~C~~C~~~f~~~~~~~~~~~~~~~~~~l~~H~~~~~~~~~~~~C---~~C~k~f~~~~~L~~H~~~~~  165 (198)
                       ++    --.|..|...|..             ...|.+|++..+.  --.-|   +.++.-|.....|..|.+..|
T Consensus       175 d~~s~rGhp~C~~C~~~fld-------------~~el~rH~~~~h~--~chfC~~~~~~neyy~~~~dLe~HfR~~H  236 (669)
T KOG2231|consen  175 DDESCRGHPLCKFCHERFLD-------------DDELYRHLRFDHE--FCHFCDYKTGQNEYYNDYDDLEEHFRKGH  236 (669)
T ss_pred             ccccccCCccchhhhhhhcc-------------HHHHHHhhcccee--heeecCcccccchhcccchHHHHHhhhcC
Confidence             11    1366677777766             5556666654441  11112   112344444555555555444


No 55 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=93.25  E-value=0.047  Score=31.28  Aligned_cols=29  Identities=28%  Similarity=0.484  Sum_probs=25.8

Q ss_pred             CCCCeeCCcchhhhcChhHHHhhhhhhCC
Q psy11761        138 FPKPYQCDRCSQFFGDRMNLISHHCHKHK  166 (198)
Q Consensus       138 ~~~~~~C~~C~k~f~~~~~L~~H~~~~~~  166 (198)
                      |+.-+.|+.||..|....++.+|....|+
T Consensus        14 GE~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          14 GEEFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             CceeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            67788999999999999999999987765


No 56 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=93.03  E-value=0.072  Score=27.46  Aligned_cols=23  Identities=22%  Similarity=0.509  Sum_probs=20.4

Q ss_pred             CCeeCCcchhhhcChhHHHhhhh
Q psy11761        140 KPYQCDRCSQFFGDRMNLISHHC  162 (198)
Q Consensus       140 ~~~~C~~C~k~f~~~~~L~~H~~  162 (198)
                      .+|.|+.|++.|.....+..|+.
T Consensus         2 ~~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        2 GGFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             cCeEccccCCccCCHHHHHHHHC
Confidence            36889999999999999999975


No 57 
>KOG2893|consensus
Probab=91.89  E-value=0.055  Score=40.79  Aligned_cols=44  Identities=30%  Similarity=0.736  Sum_probs=35.4

Q ss_pred             ecCccccccCChhHHhhcccCCCCCCCccCccchhcccCchhHHHhhh
Q psy11761         45 KCEYCHKVFDQQSSLLSHNCPQMKPRPYKCDTCEKSFTNSQNLNTHQL   92 (198)
Q Consensus        45 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~   92 (198)
                      +|..|+..|....-|+.|++.    +-|+|-+|.+.+-+-..|..|..
T Consensus        12 wcwycnrefddekiliqhqka----khfkchichkkl~sgpglsihcm   55 (341)
T KOG2893|consen   12 WCWYCNREFDDEKILIQHQKA----KHFKCHICHKKLFSGPGLSIHCM   55 (341)
T ss_pred             eeeecccccchhhhhhhhhhh----ccceeeeehhhhccCCCceeehh
Confidence            588899999999888888875    44889999888777777777743


No 58 
>KOG2893|consensus
Probab=91.80  E-value=0.03  Score=42.14  Aligned_cols=48  Identities=27%  Similarity=0.477  Sum_probs=38.2

Q ss_pred             cCCcCchhhhcccCCCcccCCCcCcccccccccccccCCCCeeCCcchhhhcChhHHHhhhhhhCC
Q psy11761        101 KCTTCDKSFVNQINPTSTHTPTYTKSNLAQHSCMNSHFPKPYQCDRCSQFFGDRMNLISHHCHKHK  166 (198)
Q Consensus       101 ~C~~C~~~f~~~~~~~~~~~~~~~~~~l~~H~~~~~~~~~~~~C~~C~k~f~~~~~L~~H~~~~~~  166 (198)
                      =|..|.+.|..             ..-|.+|++     .+-|+|.+|.|..-+-..|..|....|+
T Consensus        12 wcwycnrefdd-------------ekiliqhqk-----akhfkchichkkl~sgpglsihcmqvhk   59 (341)
T KOG2893|consen   12 WCWYCNREFDD-------------EKILIQHQK-----AKHFKCHICHKKLFSGPGLSIHCMQVHK   59 (341)
T ss_pred             eeeecccccch-------------hhhhhhhhh-----hccceeeeehhhhccCCCceeehhhhhh
Confidence            38899999998             888888884     4678999998877666688888665554


No 59 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=91.74  E-value=0.12  Score=42.40  Aligned_cols=75  Identities=23%  Similarity=0.239  Sum_probs=62.2

Q ss_pred             CcccCCcCchhhhcccCCCcccCCCcCccccccccc--ccccCC--CCeeCC--cchhhhcChhHHHhhhhhhCCCCCCC
Q psy11761         98 RPFKCTTCDKSFVNQINPTSTHTPTYTKSNLAQHSC--MNSHFP--KPYQCD--RCSQFFGDRMNLISHHCHKHKQSCLP  171 (198)
Q Consensus        98 k~~~C~~C~~~f~~~~~~~~~~~~~~~~~~l~~H~~--~~~~~~--~~~~C~--~C~k~f~~~~~L~~H~~~~~~~~~~~  171 (198)
                      .++.|..|...|..             ...+.+|.+  .|. ++  +++.|+  .|++.|.+...+..|..+|.+..+..
T Consensus       288 ~~~~~~~~~~~~s~-------------~~~l~~~~~~~~h~-~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~  353 (467)
T COG5048         288 LPIKSKQCNISFSR-------------SSPLTRHLRSVNHS-GESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAK  353 (467)
T ss_pred             cCCCCccccCCccc-------------cccccccccccccc-cccCCceeeeccCCCccccccccccCCcccccCCCccc
Confidence            46788889988888             888999999  566 78  999999  79999999999999999999888777


Q ss_pred             cccccccCCCcccch
Q psy11761        172 FISRLFGFDDGDKVA  186 (198)
Q Consensus       172 ~~~~~~~~~~~~~~~  186 (198)
                      +.-..+.........
T Consensus       354 ~~~~~~~~~~~~~~~  368 (467)
T COG5048         354 EKLLNSSSKFSPLLN  368 (467)
T ss_pred             cccccCccccccccC
Confidence            777766666555444


No 60 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=91.18  E-value=0.13  Score=32.50  Aligned_cols=33  Identities=24%  Similarity=0.490  Sum_probs=27.0

Q ss_pred             CccccCcccchhhcccCCCceecCccccccCCh
Q psy11761         24 NAYKCHQCQRLIFLSANAGVHKCEYCHKVFDQQ   56 (198)
Q Consensus        24 ~~~~C~~C~~~f~~~~~~~~~~C~~C~~~f~~~   56 (198)
                      ..|.||.|++.--.......|.|.-|+..|.-.
T Consensus        34 ~~~~Cp~C~~~~VkR~a~GIW~C~kCg~~fAGg   66 (89)
T COG1997          34 AKHVCPFCGRTTVKRIATGIWKCRKCGAKFAGG   66 (89)
T ss_pred             cCCcCCCCCCcceeeeccCeEEcCCCCCeeccc
Confidence            368999999986667777799999999988553


No 61 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=91.09  E-value=0.16  Score=24.02  Aligned_cols=21  Identities=29%  Similarity=0.466  Sum_probs=9.4

Q ss_pred             cccchhhcccCCCceecCccc
Q psy11761         30 QCQRLIFLSANAGVHKCEYCH   50 (198)
Q Consensus        30 ~C~~~f~~~~~~~~~~C~~C~   50 (198)
                      .|+...........|.|+.||
T Consensus         3 sC~~~i~~r~~~v~f~CPnCG   23 (24)
T PF07754_consen    3 SCGRPIAPREQAVPFPCPNCG   23 (24)
T ss_pred             cCCCcccCcccCceEeCCCCC
Confidence            344443333334455555554


No 62 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=90.93  E-value=0.13  Score=26.43  Aligned_cols=24  Identities=21%  Similarity=0.458  Sum_probs=13.1

Q ss_pred             cccCcccchhhcccCCCceecCcccc
Q psy11761         26 YKCHQCQRLIFLSANAGVHKCEYCHK   51 (198)
Q Consensus        26 ~~C~~C~~~f~~~~~~~~~~C~~C~~   51 (198)
                      |.|..||..+...  ..++.|+.|+.
T Consensus         2 ~~C~~CGy~y~~~--~~~~~CP~Cg~   25 (33)
T cd00350           2 YVCPVCGYIYDGE--EAPWVCPVCGA   25 (33)
T ss_pred             EECCCCCCEECCC--cCCCcCcCCCC
Confidence            4566666655332  24566666654


No 63 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=90.77  E-value=0.19  Score=24.30  Aligned_cols=24  Identities=29%  Similarity=0.574  Sum_probs=14.0

Q ss_pred             ccCcccchhhcccCCCceecCccccccC
Q psy11761         27 KCHQCQRLIFLSANAGVHKCEYCHKVFD   54 (198)
Q Consensus        27 ~C~~C~~~f~~~~~~~~~~C~~C~~~f~   54 (198)
                      .||.|+.......    -.|+.||..|.
T Consensus         2 ~CP~C~~~V~~~~----~~Cp~CG~~F~   25 (26)
T PF10571_consen    2 TCPECGAEVPESA----KFCPHCGYDFE   25 (26)
T ss_pred             cCCCCcCCchhhc----CcCCCCCCCCc
Confidence            3677776653332    34777777664


No 64 
>KOG1146|consensus
Probab=90.43  E-value=0.18  Score=46.84  Aligned_cols=97  Identities=21%  Similarity=0.285  Sum_probs=58.2

Q ss_pred             cccccCChhHHhhccc-CCCCCCCccCccchhcccCchhHHHhhhhcCCCCcccCCcCchhhhcccCCCcccCCCcCccc
Q psy11761         49 CHKVFDQQSSLLSHNC-PQMKPRPYKCDTCEKSFTNSQNLNTHQLIHSGIRPFKCTTCDKSFVNQINPTSTHTPTYTKSN  127 (198)
Q Consensus        49 C~~~f~~~~~l~~H~~-~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~~~~~~~~~~~~~~~~  127 (198)
                      |+..+.....+..|.. .+...+.+.|+.|+..+.....|..|+|+.+.+-.-  ..|. .+..             ...
T Consensus       442 ~e~~~~s~r~~~~~t~~L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~--~~c~-~gq~-------------~~~  505 (1406)
T KOG1146|consen  442 AEPLLESKRSLEGQTVVLHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQS--AYCK-AGQN-------------HPR  505 (1406)
T ss_pred             hhhhhhhhcccccceeeeecccccccCCccchhhhhHHHhhhcccccccccch--hHhH-hccc-------------ccc
Confidence            4444444444444422 344457789999999999888999998875543211  2221 1111             001


Q ss_pred             ccccccccccCCCCeeCCcchhhhcChhHHHhhhh
Q psy11761        128 LAQHSCMNSHFPKPYQCDRCSQFFGDRMNLISHHC  162 (198)
Q Consensus       128 l~~H~~~~~~~~~~~~C~~C~k~f~~~~~L~~H~~  162 (198)
                      +.+-..... +.++|.|..|...++...+|..|+.
T Consensus       506 ~arg~~~~~-~~~p~~C~~C~~stttng~Lsihlq  539 (1406)
T KOG1146|consen  506 LARGEVYRC-PGKPYPCRACNYSTTTNGNLSIHLQ  539 (1406)
T ss_pred             ccccccccC-CCCcccceeeeeeeecchHHHHHHH
Confidence            111111111 4689999999999999999999975


No 65 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=90.15  E-value=0.18  Score=33.59  Aligned_cols=30  Identities=23%  Similarity=0.624  Sum_probs=24.6

Q ss_pred             ccCCcCchhhhcccCCCcccCCCcCcccccccccccccCCCCeeCCcchhhhcCh
Q psy11761        100 FKCTTCDKSFVNQINPTSTHTPTYTKSNLAQHSCMNSHFPKPYQCDRCSQFFGDR  154 (198)
Q Consensus       100 ~~C~~C~~~f~~~~~~~~~~~~~~~~~~l~~H~~~~~~~~~~~~C~~C~k~f~~~  154 (198)
                      ..|+.||..|..             .            +..|..|+.||..|.-.
T Consensus        10 R~Cp~CG~kFYD-------------L------------nk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCPSCGAKFYD-------------L------------NKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCcchhcc-------------C------------CCCCccCCCCCCccCcc
Confidence            699999999976             2            35788999999998655


No 66 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=89.92  E-value=0.16  Score=26.25  Aligned_cols=12  Identities=17%  Similarity=0.484  Sum_probs=9.5

Q ss_pred             cccCCcCchhhh
Q psy11761         99 PFKCTTCDKSFV  110 (198)
Q Consensus        99 ~~~C~~C~~~f~  110 (198)
                      .|+|..||..+.
T Consensus         2 ~~~C~~CG~i~~   13 (34)
T cd00729           2 VWVCPVCGYIHE   13 (34)
T ss_pred             eEECCCCCCEeE
Confidence            478999997764


No 67 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=89.12  E-value=0.18  Score=38.01  Aligned_cols=15  Identities=13%  Similarity=0.348  Sum_probs=11.4

Q ss_pred             CccccCcccchhhcc
Q psy11761         24 NAYKCHQCQRLIFLS   38 (198)
Q Consensus        24 ~~~~C~~C~~~f~~~   38 (198)
                      +.+.||+|++.|...
T Consensus         4 k~~~CPvC~~~F~~~   18 (214)
T PF09986_consen    4 KKITCPVCGKEFKTK   18 (214)
T ss_pred             CceECCCCCCeeeee
Confidence            457788888888764


No 68 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=89.02  E-value=0.27  Score=32.82  Aligned_cols=30  Identities=17%  Similarity=0.408  Sum_probs=22.3

Q ss_pred             cccCcccchhhcccCCCceecCccccccCCh
Q psy11761         26 YKCHQCQRLIFLSANAGVHKCEYCHKVFDQQ   56 (198)
Q Consensus        26 ~~C~~C~~~f~~~~~~~~~~C~~C~~~f~~~   56 (198)
                      -.|+.||+.|---.. .|..|+.||..|.-.
T Consensus        10 R~Cp~CG~kFYDLnk-~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCPSCGAKFYDLNK-DPIVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCcchhccCCC-CCccCCCCCCccCcc
Confidence            358888888866554 678888888887665


No 69 
>PF14369 zf-RING_3:  zinc-finger
Probab=88.85  E-value=0.26  Score=25.71  Aligned_cols=30  Identities=33%  Similarity=0.817  Sum_probs=16.9

Q ss_pred             ccccCcccchhhcccCCCce-ecCccccccC
Q psy11761         25 AYKCHQCQRLIFLSANAGVH-KCEYCHKVFD   54 (198)
Q Consensus        25 ~~~C~~C~~~f~~~~~~~~~-~C~~C~~~f~   54 (198)
                      .|.|..|.+.+........- .|+.|+.+|.
T Consensus         2 ~ywCh~C~~~V~~~~~~~~~~~CP~C~~gFv   32 (35)
T PF14369_consen    2 RYWCHQCNRFVRIAPSPDSDVACPRCHGGFV   32 (35)
T ss_pred             CEeCccCCCEeEeCcCCCCCcCCcCCCCcEe
Confidence            46777777666543222222 4777776663


No 70 
>KOG4173|consensus
Probab=88.51  E-value=0.11  Score=38.27  Aligned_cols=81  Identities=22%  Similarity=0.420  Sum_probs=54.8

Q ss_pred             CCccCcc--chhcccCchhHHHhhhhcCCCCcccCCcCchhhhcccCCCcccCCCcCccccccccccccc---------C
Q psy11761         70 RPYKCDT--CEKSFTNSQNLNTHQLIHSGIRPFKCTTCDKSFVNQINPTSTHTPTYTKSNLAQHSCMNSH---------F  138 (198)
Q Consensus        70 ~~~~C~~--C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~~~~~~~~~~~~~~~~l~~H~~~~~~---------~  138 (198)
                      ..+.|++  |-..|.+.-.+..|..+-++.   .|.+|.+.|++             ..-|..|+...+.         |
T Consensus        78 ~~~~cqvagc~~~~d~lD~~E~hY~~~h~~---sCs~C~r~~Pt-------------~hLLd~HI~E~HDs~Fqa~veRG  141 (253)
T KOG4173|consen   78 PAFACQVAGCCQVFDALDDYEHHYHTLHGN---SCSFCKRAFPT-------------GHLLDAHILEWHDSLFQALVERG  141 (253)
T ss_pred             ccccccccchHHHHhhhhhHHHhhhhcccc---hhHHHHHhCCc-------------hhhhhHHHHHHHHHHHHHHHHcC
Confidence            3466766  666777766677776655543   78888888887             5555556543331         3


Q ss_pred             CCCeeCC--cchhhhcChhHHHhhhhhhCC
Q psy11761        139 PKPYQCD--RCSQFFGDRMNLISHHCHKHK  166 (198)
Q Consensus       139 ~~~~~C~--~C~k~f~~~~~L~~H~~~~~~  166 (198)
                      ...|+|-  .|+..|.+...-..|+...|.
T Consensus       142 ~dMy~ClvEgCt~KFkT~r~RkdH~I~~Hk  171 (253)
T KOG4173|consen  142 QDMYQCLVEGCTEKFKTSRDRKDHMIRMHK  171 (253)
T ss_pred             ccHHHHHHHhhhhhhhhhhhhhhHHHHhcc
Confidence            5568884  499999888888888876653


No 71 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=88.11  E-value=0.31  Score=26.86  Aligned_cols=27  Identities=26%  Similarity=0.559  Sum_probs=16.8

Q ss_pred             ccccCcccchhhcccCCCceecCccccc
Q psy11761         25 AYKCHQCQRLIFLSANAGVHKCEYCHKV   52 (198)
Q Consensus        25 ~~~C~~C~~~f~~~~~~~~~~C~~C~~~   52 (198)
                      .|.|..||..|... ...+..|+.||..
T Consensus         2 ~Y~C~~Cg~~~~~~-~~~~irC~~CG~r   28 (44)
T smart00659        2 IYICGECGRENEIK-SKDVVRCRECGYR   28 (44)
T ss_pred             EEECCCCCCEeecC-CCCceECCCCCce
Confidence            36677777766554 3446677777654


No 72 
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=87.95  E-value=0.18  Score=32.25  Aligned_cols=31  Identities=29%  Similarity=0.684  Sum_probs=25.1

Q ss_pred             ccccCcccchhhcccCCCceecCccccccCC
Q psy11761         25 AYKCHQCQRLIFLSANAGVHKCEYCHKVFDQ   55 (198)
Q Consensus        25 ~~~C~~C~~~f~~~~~~~~~~C~~C~~~f~~   55 (198)
                      .|.|+.||+.--.......|.|..|+..|.-
T Consensus        35 ky~Cp~Cgk~~vkR~a~GIW~C~~C~~~~AG   65 (90)
T PF01780_consen   35 KYTCPFCGKTSVKRVATGIWKCKKCGKKFAG   65 (90)
T ss_dssp             -BEESSSSSSEEEEEETTEEEETTTTEEEE-
T ss_pred             CCcCCCCCCceeEEeeeEEeecCCCCCEEeC
Confidence            7999999998777777778999999988743


No 73 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=87.79  E-value=0.25  Score=27.82  Aligned_cols=29  Identities=31%  Similarity=0.708  Sum_probs=21.4

Q ss_pred             CccccCcccchhhcccCCCceecCccccc
Q psy11761         24 NAYKCHQCQRLIFLSANAGVHKCEYCHKV   52 (198)
Q Consensus        24 ~~~~C~~C~~~f~~~~~~~~~~C~~C~~~   52 (198)
                      ..|.|-.||+.|..........|+.||..
T Consensus         5 ~~Y~C~~Cg~~~~~~~~~~~irCp~Cg~r   33 (49)
T COG1996           5 MEYKCARCGREVELDQETRGIRCPYCGSR   33 (49)
T ss_pred             EEEEhhhcCCeeehhhccCceeCCCCCcE
Confidence            45888888888865666667788888764


No 74 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=87.30  E-value=0.54  Score=37.61  Aligned_cols=85  Identities=27%  Similarity=0.461  Sum_probs=51.3

Q ss_pred             ccCcc--chhcccCchhHHHhhhhcCCCCcccCCcCc---hhhhcccCCCcccCCCcCccccccccccccc--CCC-Cee
Q psy11761         72 YKCDT--CEKSFTNSQNLNTHQLIHSGIRPFKCTTCD---KSFVNQINPTSTHTPTYTKSNLAQHSCMNSH--FPK-PYQ  143 (198)
Q Consensus        72 ~~C~~--C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~---~~f~~~~~~~~~~~~~~~~~~l~~H~~~~~~--~~~-~~~  143 (198)
                      |.|+.  |.........|..|.+..++.  +.|.+|-   +.|..+..+       ...+.|..|...-..  |-+ --.
T Consensus       152 F~CP~skc~~~C~~~k~lk~H~K~~H~~--~~C~~C~~nKk~F~~E~~l-------F~~~~Lr~H~~~G~~e~GFKGHP~  222 (493)
T COG5236         152 FKCPKSKCHRRCGSLKELKKHYKAQHGF--VLCSECIGNKKDFWNEIRL-------FRSSTLRDHKNGGLEEEGFKGHPL  222 (493)
T ss_pred             hcCCchhhhhhhhhHHHHHHHHHhhcCc--EEhHhhhcCcccCccceee-------eecccccccccCCccccCcCCCch
Confidence            67765  555555566788898877764  5777663   344432211       013344444432211  111 236


Q ss_pred             CCcchhhhcChhHHHhhhhhhC
Q psy11761        144 CDRCSQFFGDRMNLISHHCHKH  165 (198)
Q Consensus       144 C~~C~k~f~~~~~L~~H~~~~~  165 (198)
                      |.+|..-|-....|..|++..|
T Consensus       223 C~FC~~~FYdDDEL~~HcR~~H  244 (493)
T COG5236         223 CIFCKIYFYDDDELRRHCRLRH  244 (493)
T ss_pred             hhhccceecChHHHHHHHHhhh
Confidence            9999999999999999998766


No 75 
>KOG2231|consensus
Probab=85.94  E-value=0.51  Score=41.27  Aligned_cols=82  Identities=27%  Similarity=0.446  Sum_probs=49.8

Q ss_pred             CccchhcccCchhHHHhhhhcCCCCcccCCcCc---hhhhcccCCCcccCCCcCcccccccccccccCCC---C-eeCCc
Q psy11761         74 CDTCEKSFTNSQNLNTHQLIHSGIRPFKCTTCD---KSFVNQINPTSTHTPTYTKSNLAQHSCMNSHFPK---P-YQCDR  146 (198)
Q Consensus        74 C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~---~~f~~~~~~~~~~~~~~~~~~l~~H~~~~~~~~~---~-~~C~~  146 (198)
                      |..| ..|.....|..|+...++  .+.|..|-   +.|..+..+       .....|..|+....++++   . -.|..
T Consensus       118 ~~~c-~~~~s~~~Lk~H~~~~H~--~~~c~lC~~~~kif~~e~k~-------Yt~~el~~h~~~gd~d~~s~rGhp~C~~  187 (669)
T KOG2231|consen  118 CLHC-TEFKSVENLKNHMRDQHK--LHLCSLCLQNLKIFINERKL-------YTRAELNLHLMFGDPDDESCRGHPLCKF  187 (669)
T ss_pred             Cccc-cchhHHHHHHHHHHHhhh--hhccccccccceeeeeeeeh-------ehHHHHHHHHhcCCCccccccCCccchh
Confidence            3344 344466788899865442  24554442   223222111       115677777776554322   2 47999


Q ss_pred             chhhhcChhHHHhhhhhhC
Q psy11761        147 CSQFFGDRMNLISHHCHKH  165 (198)
Q Consensus       147 C~k~f~~~~~L~~H~~~~~  165 (198)
                      |...|-....|.+|++..|
T Consensus       188 C~~~fld~~el~rH~~~~h  206 (669)
T KOG2231|consen  188 CHERFLDDDELYRHLRFDH  206 (669)
T ss_pred             hhhhhccHHHHHHhhccce
Confidence            9999999999999998775


No 76 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=85.92  E-value=0.56  Score=23.90  Aligned_cols=25  Identities=24%  Similarity=0.604  Sum_probs=12.8

Q ss_pred             cccCcccchhhcccCCCceecCcccc
Q psy11761         26 YKCHQCQRLIFLSANAGVHKCEYCHK   51 (198)
Q Consensus        26 ~~C~~C~~~f~~~~~~~~~~C~~C~~   51 (198)
                      |.|..||..+..+ ...+-+|+.||.
T Consensus         1 Y~C~~Cg~~~~~~-~~~~irC~~CG~   25 (32)
T PF03604_consen    1 YICGECGAEVELK-PGDPIRCPECGH   25 (32)
T ss_dssp             EBESSSSSSE-BS-TSSTSSBSSSS-
T ss_pred             CCCCcCCCeeEcC-CCCcEECCcCCC
Confidence            4566666666532 233556666654


No 77 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=85.51  E-value=0.48  Score=35.73  Aligned_cols=14  Identities=29%  Similarity=0.847  Sum_probs=12.0

Q ss_pred             CcccCCcCchhhhc
Q psy11761         98 RPFKCTTCDKSFVN  111 (198)
Q Consensus        98 k~~~C~~C~~~f~~  111 (198)
                      +...||+|++.|..
T Consensus         4 k~~~CPvC~~~F~~   17 (214)
T PF09986_consen    4 KKITCPVCGKEFKT   17 (214)
T ss_pred             CceECCCCCCeeee
Confidence            56799999999987


No 78 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=85.47  E-value=1.8  Score=29.02  Aligned_cols=102  Identities=16%  Similarity=0.281  Sum_probs=59.1

Q ss_pred             cccCcccchhhcccCCCceecCccccccCChhHHhhcccCCC--CCCCccCccchhcccCchhHHHhhhhcCCCCcccCC
Q psy11761         26 YKCHQCQRLIFLSANAGVHKCEYCHKVFDQQSSLLSHNCPQM--KPRPYKCDTCEKSFTNSQNLNTHQLIHSGIRPFKCT  103 (198)
Q Consensus        26 ~~C~~C~~~f~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~--~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~  103 (198)
                      |.||.|+...    =..|-.|+.|+...-....|++-.  |+  ..++|.         ... +.      .....-.|-
T Consensus         2 Y~CPrC~skv----C~LP~~CpiCgLtLVss~HLARSy--HHLfPl~~f~---------ev~-~~------~~~~~~~C~   59 (112)
T TIGR00622         2 YFCPQCRAKV----CELPVECPICGLTLILSTHLARSY--HHLFPLKAFQ---------EIP-LE------EYNGSRFCF   59 (112)
T ss_pred             ccCCCCCCCc----cCCCCcCCcCCCEEeccchHHHhh--hccCCCcccc---------ccc-cc------ccCCCCccc
Confidence            7788887543    123677999998887777776432  33  122221         000 00      011113588


Q ss_pred             cCchhhhcccCCCcccCCCcCcccccccccccccCCCCeeCCcchhhhcChhHHHhhhhhhC
Q psy11761        104 TCDKSFVNQINPTSTHTPTYTKSNLAQHSCMNSHFPKPYQCDRCSQFFGDRMNLISHHCHKH  165 (198)
Q Consensus       104 ~C~~~f~~~~~~~~~~~~~~~~~~l~~H~~~~~~~~~~~~C~~C~k~f~~~~~L~~H~~~~~  165 (198)
                      .|...|+.             ......-.  .. ....|+|+.|...|--.-+.-.|-.+|.
T Consensus        60 ~C~~~f~~-------------~~~~~~~~--~~-~~~~y~C~~C~~~FC~dCD~fiHe~Lh~  105 (112)
T TIGR00622        60 GCQGPFPK-------------PPVSPFDE--LK-DSHRYVCAVCKNVFCVDCDVFVHESLHC  105 (112)
T ss_pred             CcCCCCCC-------------cccccccc--cc-cccceeCCCCCCccccccchhhhhhccC
Confidence            89888875             21100000  11 3468999999999988888888876663


No 79 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=85.43  E-value=1.2  Score=29.61  Aligned_cols=27  Identities=19%  Similarity=0.496  Sum_probs=24.5

Q ss_pred             CCeeC----CcchhhhcChhHHHhhhhhhCC
Q psy11761        140 KPYQC----DRCSQFFGDRMNLISHHCHKHK  166 (198)
Q Consensus       140 ~~~~C----~~C~k~f~~~~~L~~H~~~~~~  166 (198)
                      ..|.|    ..|+....+...+..|...+||
T Consensus        79 ~G~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   79 DGYRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CCeeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            56899    9999999999999999998875


No 80 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=85.06  E-value=0.47  Score=34.15  Aligned_cols=25  Identities=20%  Similarity=0.545  Sum_probs=20.6

Q ss_pred             CcccCCcCchhhhcccCCCcccCCCcCcccccccccccccCCCCeeCCcchh
Q psy11761         98 RPFKCTTCDKSFVNQINPTSTHTPTYTKSNLAQHSCMNSHFPKPYQCDRCSQ  149 (198)
Q Consensus        98 k~~~C~~C~~~f~~~~~~~~~~~~~~~~~~l~~H~~~~~~~~~~~~C~~C~k  149 (198)
                      +-|+|++||..+.                           |+-|-+||+||.
T Consensus       133 ~~~vC~vCGy~~~---------------------------ge~P~~CPiCga  157 (166)
T COG1592         133 KVWVCPVCGYTHE---------------------------GEAPEVCPICGA  157 (166)
T ss_pred             CEEEcCCCCCccc---------------------------CCCCCcCCCCCC
Confidence            3699999998864                           577889999994


No 81 
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=85.01  E-value=0.42  Score=30.59  Aligned_cols=33  Identities=21%  Similarity=0.535  Sum_probs=26.1

Q ss_pred             CccccCcccchhhcccCCCceecCccccccCCh
Q psy11761         24 NAYKCHQCQRLIFLSANAGVHKCEYCHKVFDQQ   56 (198)
Q Consensus        24 ~~~~C~~C~~~f~~~~~~~~~~C~~C~~~f~~~   56 (198)
                      ..|.|+.|++.--.......|.|..|+..|.-.
T Consensus        35 a~y~CpfCgk~~vkR~a~GIW~C~~C~~~~AGG   67 (90)
T PTZ00255         35 AKYFCPFCGKHAVKRQAVGIWRCKGCKKTVAGG   67 (90)
T ss_pred             CCccCCCCCCCceeeeeeEEEEcCCCCCEEeCC
Confidence            379999999865556666799999999987553


No 82 
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=84.25  E-value=0.42  Score=30.65  Aligned_cols=32  Identities=22%  Similarity=0.577  Sum_probs=26.0

Q ss_pred             ccccCcccchhhcccCCCceecCccccccCCh
Q psy11761         25 AYKCHQCQRLIFLSANAGVHKCEYCHKVFDQQ   56 (198)
Q Consensus        25 ~~~C~~C~~~f~~~~~~~~~~C~~C~~~f~~~   56 (198)
                      .|.|+.|++.--.......|.|..|+..|.-.
T Consensus        35 ~y~CpfCgk~~vkR~a~GIW~C~~C~~~~AGG   66 (91)
T TIGR00280        35 KYVCPFCGKKTVKRGSTGIWTCRKCGAKFAGG   66 (91)
T ss_pred             CccCCCCCCCceEEEeeEEEEcCCCCCEEeCC
Confidence            79999999876666667799999999987553


No 83 
>PF14353 CpXC:  CpXC protein
Probab=84.17  E-value=0.33  Score=33.35  Aligned_cols=40  Identities=20%  Similarity=0.368  Sum_probs=25.5

Q ss_pred             ccCcccchhhcccC-------------------CCceecCccccccCChhHHhhcccCC
Q psy11761         27 KCHQCQRLIFLSAN-------------------AGVHKCEYCHKVFDQQSSLLSHNCPQ   66 (198)
Q Consensus        27 ~C~~C~~~f~~~~~-------------------~~~~~C~~C~~~f~~~~~l~~H~~~h   66 (198)
                      .||.|+..|....-                   +-.+.|+.||..|.-...+..|...+
T Consensus         3 tCP~C~~~~~~~v~~~I~~~~~p~l~e~il~g~l~~~~CP~Cg~~~~~~~p~lY~D~~~   61 (128)
T PF14353_consen    3 TCPHCGHEFEFEVWTSINADEDPELKEKILDGSLFSFTCPSCGHKFRLEYPLLYHDPEK   61 (128)
T ss_pred             CCCCCCCeeEEEEEeEEcCcCCHHHHHHHHcCCcCEEECCCCCCceecCCCEEEEcCCC
Confidence            68888877653211                   11567888888877766666665443


No 84 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=84.15  E-value=1.2  Score=29.73  Aligned_cols=71  Identities=18%  Similarity=0.368  Sum_probs=43.2

Q ss_pred             CCccccCcccchhhcccCCC----------ce------------ecCccccccCChhHHhhcccCCCCCCCccCccchhc
Q psy11761         23 DNAYKCHQCQRLIFLSANAG----------VH------------KCEYCHKVFDQQSSLLSHNCPQMKPRPYKCDTCEKS   80 (198)
Q Consensus        23 ~~~~~C~~C~~~f~~~~~~~----------~~------------~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~   80 (198)
                      +.|..|+.||-..-....|.          +|            .|.-|...|........  ..-.....|.|+.|...
T Consensus        13 ~LP~~CpiCgLtLVss~HLARSyHHLfPl~~f~ev~~~~~~~~~~C~~C~~~f~~~~~~~~--~~~~~~~~y~C~~C~~~   90 (112)
T TIGR00622        13 ELPVECPICGLTLILSTHLARSYHHLFPLKAFQEIPLEEYNGSRFCFGCQGPFPKPPVSPF--DELKDSHRYVCAVCKNV   90 (112)
T ss_pred             CCCCcCCcCCCEEeccchHHHhhhccCCCcccccccccccCCCCcccCcCCCCCCcccccc--cccccccceeCCCCCCc
Confidence            46788888885543333322          22            37778887765431110  00223457889999999


Q ss_pred             ccCchhHHHhhhhcC
Q psy11761         81 FTNSQNLNTHQLIHS   95 (198)
Q Consensus        81 f~~~~~l~~H~~~h~   95 (198)
                      |-..-++..|...|.
T Consensus        91 FC~dCD~fiHe~Lh~  105 (112)
T TIGR00622        91 FCVDCDVFVHESLHC  105 (112)
T ss_pred             cccccchhhhhhccC
Confidence            988888888865554


No 85 
>KOG1146|consensus
Probab=83.96  E-value=0.5  Score=44.13  Aligned_cols=100  Identities=13%  Similarity=0.119  Sum_probs=55.3

Q ss_pred             eecCccccccCChhHHhhcccCCCCCCCccCccchhcccCchhHHHhhhhcCCCCcccCCcCchhhhcccCCCcccCCCc
Q psy11761         44 HKCEYCHKVFDQQSSLLSHNCPQMKPRPYKCDTCEKSFTNSQNLNTHQLIHSGIRPFKCTTCDKSFVNQINPTSTHTPTY  123 (198)
Q Consensus        44 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~~~~~~~~~~~~  123 (198)
                      +.|..|...+...-.+. ++-   ....|.|..|...|.....+..|.+           .|.+.+..            
T Consensus      1261 ~~c~~~~~~~~~~~~~~-~l~---~~~~~~~~~~~~~~~~~~~l~~~~~-----------k~~~~~~~------------ 1313 (1406)
T KOG1146|consen 1261 GECGAVDELLTPSFGIS-TLD---VTHRYLCRQCKMAFDGEAPLTAHQR-----------KFCFAGRG------------ 1313 (1406)
T ss_pred             chhhhccccccCcccee-ecc---cchhHHHHHHHhhhcchhHHHHHHH-----------HHHhccCc------------
Confidence            45555555554444333 221   1235666666666666665555551           12222222            


Q ss_pred             CcccccccccccccCCCCeeCCcchhhhcChhHHHhhhhhhCCCCCCCcc
Q psy11761        124 TKSNLAQHSCMNSHFPKPYQCDRCSQFFGDRMNLISHHCHKHKQSCLPFI  173 (198)
Q Consensus       124 ~~~~l~~H~~~~~~~~~~~~C~~C~k~f~~~~~L~~H~~~~~~~~~~~~~  173 (198)
                       .....-+...+. .-+.| |..|...|.....|..||+..+++.-.++.
T Consensus      1314 -~~~~~~~~l~~~-d~~~~-c~~c~~~~~~~~alqihm~~~~~~~kt~~~ 1360 (1406)
T KOG1146|consen 1314 -SGGSMPPPLRVP-DCTYH-CLACEVLLSGREALQIHMRSSAHRRKTAPP 1360 (1406)
T ss_pred             -cccCCCCcccCc-ccccc-chHHHhhcchhHHHHHHHHHhhhcccCCCC
Confidence             222333443333 44566 999999999999999999855444333444


No 86 
>KOG2186|consensus
Probab=83.87  E-value=0.43  Score=36.42  Aligned_cols=47  Identities=21%  Similarity=0.460  Sum_probs=39.5

Q ss_pred             cccCCcCchhhhcccCCCcccCCCcCcccccccccccccCCCCeeCCcchhhhcChhHHHhhhh
Q psy11761         99 PFKCTTCDKSFVNQINPTSTHTPTYTKSNLAQHSCMNSHFPKPYQCDRCSQFFGDRMNLISHHC  162 (198)
Q Consensus        99 ~~~C~~C~~~f~~~~~~~~~~~~~~~~~~l~~H~~~~~~~~~~~~C~~C~k~f~~~~~L~~H~~  162 (198)
                      -|.|..||....              +..+.+|+...+ + .-|-|-.|++.|.. .++.-|..
T Consensus         3 ~FtCnvCgEsvK--------------Kp~vekH~srCr-n-~~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    3 FFTCNVCGESVK--------------KPQVEKHMSRCR-N-AYFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             EEehhhhhhhcc--------------ccchHHHHHhcc-C-CeeEEeeccccccc-chhhhhhh
Confidence            378999999987              788899999887 3 78899999999987 57777754


No 87 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=83.28  E-value=0.55  Score=25.04  Aligned_cols=26  Identities=19%  Similarity=0.603  Sum_probs=12.6

Q ss_pred             cccCcccchhhcccC---CCceecCcccc
Q psy11761         26 YKCHQCQRLIFLSAN---AGVHKCEYCHK   51 (198)
Q Consensus        26 ~~C~~C~~~f~~~~~---~~~~~C~~C~~   51 (198)
                      |.|+.||..|.....   ...-.|+.||.
T Consensus         6 y~C~~Cg~~fe~~~~~~~~~~~~CP~Cg~   34 (41)
T smart00834        6 YRCEDCGHTFEVLQKISDDPLATCPECGG   34 (41)
T ss_pred             EEcCCCCCEEEEEEecCCCCCCCCCCCCC
Confidence            556666665543221   22344666654


No 88 
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=82.02  E-value=0.55  Score=30.06  Aligned_cols=32  Identities=22%  Similarity=0.489  Sum_probs=26.1

Q ss_pred             ccccCcccchhhcccCCCceecCccccccCCh
Q psy11761         25 AYKCHQCQRLIFLSANAGVHKCEYCHKVFDQQ   56 (198)
Q Consensus        25 ~~~C~~C~~~f~~~~~~~~~~C~~C~~~f~~~   56 (198)
                      .|.|+.|++.--.......|.|..|+..|.-.
T Consensus        36 ~y~CpfCgk~~vkR~a~GIW~C~~C~~~~AGG   67 (90)
T PRK03976         36 KHVCPVCGRPKVKRVGTGIWECRKCGAKFAGG   67 (90)
T ss_pred             CccCCCCCCCceEEEEEEEEEcCCCCCEEeCC
Confidence            79999999876666777799999999987543


No 89 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=82.01  E-value=0.59  Score=25.37  Aligned_cols=11  Identities=27%  Similarity=0.893  Sum_probs=5.6

Q ss_pred             cccCcccchhh
Q psy11761         26 YKCHQCQRLIF   36 (198)
Q Consensus        26 ~~C~~C~~~f~   36 (198)
                      |.|..||..|.
T Consensus         6 y~C~~Cg~~fe   16 (42)
T PF09723_consen    6 YRCEECGHEFE   16 (42)
T ss_pred             EEeCCCCCEEE
Confidence            45555554443


No 90 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=81.60  E-value=0.84  Score=31.12  Aligned_cols=33  Identities=15%  Similarity=0.190  Sum_probs=25.6

Q ss_pred             ccCCcCchhhhcccCCCcccCCCcCcccccccccccccCCCCeeCCcchhhhcChhHH
Q psy11761        100 FKCTTCDKSFVNQINPTSTHTPTYTKSNLAQHSCMNSHFPKPYQCDRCSQFFGDRMNL  157 (198)
Q Consensus       100 ~~C~~C~~~f~~~~~~~~~~~~~~~~~~l~~H~~~~~~~~~~~~C~~C~k~f~~~~~L  157 (198)
                      ..|+.||+.|..             .            +..|..|+.||..|.-...+
T Consensus        10 r~Cp~cg~kFYD-------------L------------nk~p~vcP~cg~~~~~~~~~   42 (129)
T TIGR02300        10 RICPNTGSKFYD-------------L------------NRRPAVSPYTGEQFPPEEAL   42 (129)
T ss_pred             ccCCCcCccccc-------------c------------CCCCccCCCcCCccCcchhh
Confidence            699999999875             2            45789999999998655333


No 91 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=78.53  E-value=1.1  Score=32.23  Aligned_cols=24  Identities=17%  Similarity=0.358  Sum_probs=14.5

Q ss_pred             ccccCcccchhhcccCCCceecCcccc
Q psy11761         25 AYKCHQCQRLIFLSANAGVHKCEYCHK   51 (198)
Q Consensus        25 ~~~C~~C~~~f~~~~~~~~~~C~~C~~   51 (198)
                      .+.|+.||..+..   ..|.+||+||.
T Consensus       134 ~~vC~vCGy~~~g---e~P~~CPiCga  157 (166)
T COG1592         134 VWVCPVCGYTHEG---EAPEVCPICGA  157 (166)
T ss_pred             EEEcCCCCCcccC---CCCCcCCCCCC
Confidence            4667777666544   33666777663


No 92 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=77.00  E-value=0.66  Score=26.68  Aligned_cols=32  Identities=16%  Similarity=0.347  Sum_probs=25.9

Q ss_pred             hhcCCCCcccCCcCchhhhcccCCCcccCCCcCcccccccccccc
Q psy11761         92 LIHSGIRPFKCTTCDKSFVNQINPTSTHTPTYTKSNLAQHSCMNS  136 (198)
Q Consensus        92 ~~h~~~k~~~C~~C~~~f~~~~~~~~~~~~~~~~~~l~~H~~~~~  136 (198)
                      .+-.|+.-+.|+-|+..|..             ..++.+|+...+
T Consensus        10 ~~RDGE~~lrCPRC~~~FR~-------------~K~Y~RHVNKaH   41 (65)
T COG4049          10 RDRDGEEFLRCPRCGMVFRR-------------RKDYIRHVNKAH   41 (65)
T ss_pred             eccCCceeeeCCchhHHHHH-------------hHHHHHHhhHHh
Confidence            34567888999999999998             888888886555


No 93 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=76.27  E-value=1.7  Score=29.62  Aligned_cols=30  Identities=10%  Similarity=0.125  Sum_probs=21.2

Q ss_pred             cccCcccchhhcccCCCceecCccccccCCh
Q psy11761         26 YKCHQCQRLIFLSANAGVHKCEYCHKVFDQQ   56 (198)
Q Consensus        26 ~~C~~C~~~f~~~~~~~~~~C~~C~~~f~~~   56 (198)
                      ..|+.||+.|-.-.. .|-.|+.||..|...
T Consensus        10 r~Cp~cg~kFYDLnk-~p~vcP~cg~~~~~~   39 (129)
T TIGR02300        10 RICPNTGSKFYDLNR-RPAVSPYTGEQFPPE   39 (129)
T ss_pred             ccCCCcCccccccCC-CCccCCCcCCccCcc
Confidence            468888888765443 577888888877555


No 94 
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=76.02  E-value=1.5  Score=39.17  Aligned_cols=45  Identities=24%  Similarity=0.679  Sum_probs=29.6

Q ss_pred             ccCcccchhhcccCCCceecCccccccCC---hhHHhhcccCCCCCCCccCccchhc
Q psy11761         27 KCHQCQRLIFLSANAGVHKCEYCHKVFDQ---QSSLLSHNCPQMKPRPYKCDTCEKS   80 (198)
Q Consensus        27 ~C~~C~~~f~~~~~~~~~~C~~C~~~f~~---~~~l~~H~~~h~~~~~~~C~~C~~~   80 (198)
                      .|..||.         ..+|+.|...+..   ...|..|.--+....|..|+.|+..
T Consensus       437 ~C~~Cg~---------v~~Cp~Cd~~lt~H~~~~~L~CH~Cg~~~~~p~~Cp~Cgs~  484 (730)
T COG1198         437 LCRDCGY---------IAECPNCDSPLTLHKATGQLRCHYCGYQEPIPQSCPECGSE  484 (730)
T ss_pred             ecccCCC---------cccCCCCCcceEEecCCCeeEeCCCCCCCCCCCCCCCCCCC
Confidence            3888887         4568888765432   2355666666666777888888754


No 95 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=75.94  E-value=1.2  Score=23.37  Aligned_cols=27  Identities=26%  Similarity=0.659  Sum_probs=14.1

Q ss_pred             ccCcccchhhcccC-----CCceecCcccccc
Q psy11761         27 KCHQCQRLIFLSAN-----AGVHKCEYCHKVF   53 (198)
Q Consensus        27 ~C~~C~~~f~~~~~-----~~~~~C~~C~~~f   53 (198)
                      .||.|+..|.....     ....+|+.|+..|
T Consensus         4 ~CP~C~~~f~v~~~~l~~~~~~vrC~~C~~~f   35 (37)
T PF13719_consen    4 TCPNCQTRFRVPDDKLPAGGRKVRCPKCGHVF   35 (37)
T ss_pred             ECCCCCceEEcCHHHcccCCcEEECCCCCcEe
Confidence            56666666644332     1234566666554


No 96 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=75.11  E-value=0.91  Score=23.84  Aligned_cols=10  Identities=20%  Similarity=0.703  Sum_probs=5.1

Q ss_pred             ccCcccchhh
Q psy11761         27 KCHQCQRLIF   36 (198)
Q Consensus        27 ~C~~C~~~f~   36 (198)
                      .|+.|+..|.
T Consensus         4 ~CP~C~~~~~   13 (38)
T TIGR02098         4 QCPNCKTSFR   13 (38)
T ss_pred             ECCCCCCEEE
Confidence            4555555443


No 97 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=75.03  E-value=0.98  Score=32.34  Aligned_cols=10  Identities=20%  Similarity=0.793  Sum_probs=4.9

Q ss_pred             CccCccchhc
Q psy11761         71 PYKCDTCEKS   80 (198)
Q Consensus        71 ~~~C~~C~~~   80 (198)
                      .|.|+.||..
T Consensus       128 ~F~Cp~Cg~~  137 (158)
T TIGR00373       128 NFTCPRCGAM  137 (158)
T ss_pred             CCcCCCCCCE
Confidence            4555555543


No 98 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=74.65  E-value=1  Score=31.79  Aligned_cols=36  Identities=17%  Similarity=0.432  Sum_probs=18.9

Q ss_pred             ceecCccccccCChhHHhhcccCCCCCCCccCccchhccc
Q psy11761         43 VHKCEYCHKVFDQQSSLLSHNCPQMKPRPYKCDTCEKSFT   82 (198)
Q Consensus        43 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~   82 (198)
                      .|.|+.|+..|.....+.. .  .. ...|.|+.||....
T Consensus        99 ~Y~Cp~C~~~y~~~ea~~~-~--d~-~~~f~Cp~Cg~~l~  134 (147)
T smart00531       99 YYKCPNCQSKYTFLEANQL-L--DM-DGTFTCPRCGEELE  134 (147)
T ss_pred             EEECcCCCCEeeHHHHHHh-c--CC-CCcEECCCCCCEEE
Confidence            4666777666655433221 0  11 23377777776553


No 99 
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=74.50  E-value=1.4  Score=25.66  Aligned_cols=49  Identities=22%  Similarity=0.518  Sum_probs=27.1

Q ss_pred             CCCcccCCc--CchhhhcccCCCcccCCCcCcccccccccccccCCCCeeCCc----chhhhcChhHHHhh
Q psy11761         96 GIRPFKCTT--CDKSFVNQINPTSTHTPTYTKSNLAQHSCMNSHFPKPYQCDR----CSQFFGDRMNLISH  160 (198)
Q Consensus        96 ~~k~~~C~~--C~~~f~~~~~~~~~~~~~~~~~~l~~H~~~~~~~~~~~~C~~----C~k~f~~~~~L~~H  160 (198)
                      +..+..|+.  |...+.              +..|..|....- ..++..|+.    |+..+... .|..|
T Consensus         6 ~~~~v~C~~~cc~~~i~--------------r~~l~~H~~~~C-~~~~v~C~~~~~GC~~~~~~~-~l~~H   60 (60)
T PF02176_consen    6 PFRPVPCPNGCCNEMIP--------------RKELDDHLENEC-PKRPVPCPYSPYGCKERVPRE-DLEEH   60 (60)
T ss_dssp             TTSEEE-TT--S-BEEE--------------CCCHHHHHHTTS-TTSEEE-SS----S--EEEHH-HHHHC
T ss_pred             CCCEeeCCCCCccccee--------------HHHHHHHHHccC-CCCcEECCCCCCCCCCccchh-HHhCC
Confidence            445667776  555555              567788887443 356778888    88776543 44443


No 100
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=74.47  E-value=1.6  Score=24.34  Aligned_cols=11  Identities=27%  Similarity=0.712  Sum_probs=5.5

Q ss_pred             cccCcccchhh
Q psy11761         26 YKCHQCQRLIF   36 (198)
Q Consensus        26 ~~C~~C~~~f~   36 (198)
                      |.|..|+..+.
T Consensus         2 y~C~~CgyvYd   12 (47)
T PF00301_consen    2 YQCPVCGYVYD   12 (47)
T ss_dssp             EEETTTSBEEE
T ss_pred             cCCCCCCEEEc
Confidence            44555555443


No 101
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=73.96  E-value=1.6  Score=20.29  Aligned_cols=20  Identities=30%  Similarity=0.592  Sum_probs=10.6

Q ss_pred             cCcccchhhcccCCCceecCcccc
Q psy11761         28 CHQCQRLIFLSANAGVHKCEYCHK   51 (198)
Q Consensus        28 C~~C~~~f~~~~~~~~~~C~~C~~   51 (198)
                      |+.||.........    |+.||.
T Consensus         2 Cp~CG~~~~~~~~f----C~~CG~   21 (23)
T PF13240_consen    2 CPNCGAEIEDDAKF----CPNCGT   21 (23)
T ss_pred             CcccCCCCCCcCcc----hhhhCC
Confidence            66666655433322    666654


No 102
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=73.66  E-value=2.1  Score=24.69  Aligned_cols=28  Identities=21%  Similarity=0.548  Sum_probs=15.5

Q ss_pred             cccCcccchhhcccCC--CceecCcccccc
Q psy11761         26 YKCHQCQRLIFLSANA--GVHKCEYCHKVF   53 (198)
Q Consensus        26 ~~C~~C~~~f~~~~~~--~~~~C~~C~~~f   53 (198)
                      +.||.||..+.-....  ....|+.||..+
T Consensus         3 ~~CP~CG~~iev~~~~~GeiV~Cp~CGael   32 (54)
T TIGR01206         3 FECPDCGAEIELENPELGELVICDECGAEL   32 (54)
T ss_pred             cCCCCCCCEEecCCCccCCEEeCCCCCCEE
Confidence            5677777665443222  134677776654


No 103
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=73.51  E-value=1.5  Score=24.77  Aligned_cols=11  Identities=27%  Similarity=0.851  Sum_probs=5.4

Q ss_pred             eecCccccccC
Q psy11761         44 HKCEYCHKVFD   54 (198)
Q Consensus        44 ~~C~~C~~~f~   54 (198)
                      |+|..|+..|.
T Consensus         6 y~C~~Cg~~fe   16 (52)
T TIGR02605         6 YRCTACGHRFE   16 (52)
T ss_pred             EEeCCCCCEeE
Confidence            44555555444


No 104
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=73.44  E-value=2.2  Score=23.96  Aligned_cols=28  Identities=14%  Similarity=0.379  Sum_probs=15.4

Q ss_pred             cCcccchhhcccCC--CceecCccccccCC
Q psy11761         28 CHQCQRLIFLSANA--GVHKCEYCHKVFDQ   55 (198)
Q Consensus        28 C~~C~~~f~~~~~~--~~~~C~~C~~~f~~   55 (198)
                      |+.||.........  ..+.|+.|+..+..
T Consensus         3 Cp~Cg~~l~~~~~~~~~~~vC~~Cg~~~~~   32 (52)
T smart00661        3 CPKCGNMLIPKEGKEKRRFVCRKCGYEEPI   32 (52)
T ss_pred             CCCCCCccccccCCCCCEEECCcCCCeEEC
Confidence            66676655443322  25667777765544


No 105
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=73.19  E-value=1.3  Score=31.57  Aligned_cols=16  Identities=25%  Similarity=0.538  Sum_probs=11.2

Q ss_pred             eecCccccccCChhHH
Q psy11761         44 HKCEYCHKVFDQQSSL   59 (198)
Q Consensus        44 ~~C~~C~~~f~~~~~l   59 (198)
                      ++|+.||..|.....+
T Consensus        29 ~~c~~c~~~f~~~e~~   44 (154)
T PRK00464         29 RECLACGKRFTTFERV   44 (154)
T ss_pred             eeccccCCcceEeEec
Confidence            6788888877765443


No 106
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=72.90  E-value=1.6  Score=38.51  Aligned_cols=77  Identities=21%  Similarity=0.460  Sum_probs=55.9

Q ss_pred             cccCcccchhhcccCCC---ce-ecCccccccCChhHHhhcccCCCCCCCccCccchhcccCchhHHHhhhhcCCCCccc
Q psy11761         26 YKCHQCQRLIFLSANAG---VH-KCEYCHKVFDQQSSLLSHNCPQMKPRPYKCDTCEKSFTNSQNLNTHQLIHSGIRPFK  101 (198)
Q Consensus        26 ~~C~~C~~~f~~~~~~~---~~-~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~  101 (198)
                      -.|+.|=+.+....+..   || .|..||-.|.-...|-.-+.-.+...--.|+.|.+.+.+..+    +|.|.  .|..
T Consensus       102 a~C~~Cl~Ei~dp~~rrY~YPF~~CT~CGPRfTIi~alPYDR~nTsM~~F~lC~~C~~EY~dP~n----RRfHA--Qp~a  175 (750)
T COG0068         102 ATCEDCLEEIFDPNSRRYLYPFINCTNCGPRFTIIEALPYDRENTSMADFPLCPFCDKEYKDPLN----RRFHA--QPIA  175 (750)
T ss_pred             hhhHHHHHHhcCCCCcceeccccccCCCCcceeeeccCCCCcccCccccCcCCHHHHHHhcCccc----ccccc--cccc
Confidence            45888888877766655   44 699999999888777666555554455579999998877654    34454  4679


Q ss_pred             CCcCchh
Q psy11761        102 CTTCDKS  108 (198)
Q Consensus       102 C~~C~~~  108 (198)
                      |+.||-.
T Consensus       176 Cp~CGP~  182 (750)
T COG0068         176 CPKCGPH  182 (750)
T ss_pred             CcccCCC
Confidence            9999964


No 107
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=72.82  E-value=1.3  Score=32.41  Aligned_cols=31  Identities=19%  Similarity=0.580  Sum_probs=16.3

Q ss_pred             ceecCccccccCChhHHhhcccCCCCCCCccCccchhccc
Q psy11761         43 VHKCEYCHKVFDQQSSLLSHNCPQMKPRPYKCDTCEKSFT   82 (198)
Q Consensus        43 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~   82 (198)
                      -|.|+.|+..|.....+.         ..|.|+.||....
T Consensus       117 ~Y~Cp~C~~rytf~eA~~---------~~F~Cp~Cg~~L~  147 (178)
T PRK06266        117 FFFCPNCHIRFTFDEAME---------YGFRCPQCGEMLE  147 (178)
T ss_pred             EEECCCCCcEEeHHHHhh---------cCCcCCCCCCCCe
Confidence            355666665555444331         2566666665543


No 108
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=72.31  E-value=2.2  Score=27.26  Aligned_cols=27  Identities=15%  Similarity=0.375  Sum_probs=14.9

Q ss_pred             ccccCcccchhhcccCCCceecCcccc
Q psy11761         25 AYKCHQCQRLIFLSANAGVHKCEYCHK   51 (198)
Q Consensus        25 ~~~C~~C~~~f~~~~~~~~~~C~~C~~   51 (198)
                      |-.|..||..|....--.|..|+.|..
T Consensus        58 Pa~CkkCGfef~~~~ik~pSRCP~CKS   84 (97)
T COG3357          58 PARCKKCGFEFRDDKIKKPSRCPKCKS   84 (97)
T ss_pred             ChhhcccCccccccccCCcccCCcchh
Confidence            455666666665533333566666643


No 109
>PHA00626 hypothetical protein
Probab=72.24  E-value=2.8  Score=24.17  Aligned_cols=13  Identities=23%  Similarity=0.511  Sum_probs=6.3

Q ss_pred             CCccCccchhccc
Q psy11761         70 RPYKCDTCEKSFT   82 (198)
Q Consensus        70 ~~~~C~~C~~~f~   82 (198)
                      ..|.|+.|++.|+
T Consensus        22 nrYkCkdCGY~ft   34 (59)
T PHA00626         22 DDYVCCDCGYNDS   34 (59)
T ss_pred             cceEcCCCCCeec
Confidence            3455555554444


No 110
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=71.52  E-value=1.4  Score=23.10  Aligned_cols=16  Identities=25%  Similarity=0.407  Sum_probs=9.9

Q ss_pred             CCCeeCCcchhhhcCh
Q psy11761        139 PKPYQCDRCSQFFGDR  154 (198)
Q Consensus       139 ~~~~~C~~C~k~f~~~  154 (198)
                      ...-.|+.||-.+.++
T Consensus        19 ~~~~~Cd~cg~~L~qR   34 (36)
T PF05191_consen   19 KVEGVCDNCGGELVQR   34 (36)
T ss_dssp             SSTTBCTTTTEBEBEE
T ss_pred             CCCCccCCCCCeeEeC
Confidence            4455788887655443


No 111
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=71.39  E-value=3.2  Score=22.51  Aligned_cols=27  Identities=26%  Similarity=0.330  Sum_probs=17.5

Q ss_pred             CCCCeeCCcchhhhcCh----hHHHhhhhhh
Q psy11761        138 FPKPYQCDRCSQFFGDR----MNLISHHCHK  164 (198)
Q Consensus       138 ~~~~~~C~~C~k~f~~~----~~L~~H~~~~  164 (198)
                      +.....|..|++.+...    +.|..|+...
T Consensus        13 ~~~~a~C~~C~~~~~~~~~~ts~l~~HL~~~   43 (45)
T PF02892_consen   13 DKKKAKCKYCGKVIKYSSGGTSNLKRHLKKK   43 (45)
T ss_dssp             CSS-EEETTTTEE-----SSTHHHHHHHHHT
T ss_pred             CcCeEEeCCCCeEEeeCCCcHHHHHHhhhhh
Confidence            45678999999999774    6899998543


No 112
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=71.28  E-value=2.7  Score=23.79  Aligned_cols=11  Identities=27%  Similarity=0.772  Sum_probs=5.4

Q ss_pred             cccCcccchhh
Q psy11761         26 YKCHQCQRLIF   36 (198)
Q Consensus        26 ~~C~~C~~~f~   36 (198)
                      |.|..||..+.
T Consensus         2 y~C~~CgyiYd   12 (50)
T cd00730           2 YECRICGYIYD   12 (50)
T ss_pred             cCCCCCCeEEC
Confidence            44555555443


No 113
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=70.93  E-value=3  Score=20.00  Aligned_cols=19  Identities=26%  Similarity=0.273  Sum_probs=15.2

Q ss_pred             eCCcchhhhcChhHHHhhhh
Q psy11761        143 QCDRCSQFFGDRMNLISHHC  162 (198)
Q Consensus       143 ~C~~C~k~f~~~~~L~~H~~  162 (198)
                      .|++|++.+ ....+..|..
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            699999998 5567888864


No 114
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=70.43  E-value=4.1  Score=27.00  Aligned_cols=21  Identities=29%  Similarity=0.406  Sum_probs=11.4

Q ss_pred             ceecCccccccCChhHHhhccc
Q psy11761         43 VHKCEYCHKVFDQQSSLLSHNC   64 (198)
Q Consensus        43 ~~~C~~C~~~f~~~~~l~~H~~   64 (198)
                      ...|..|+.+... +++..|++
T Consensus        11 vlIC~~C~~av~~-~~v~~HL~   31 (109)
T PF12013_consen   11 VLICRQCQYAVQP-SEVESHLR   31 (109)
T ss_pred             EEEeCCCCcccCc-hHHHHHHH
Confidence            3456666655544 45555555


No 115
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=70.21  E-value=2.5  Score=30.21  Aligned_cols=32  Identities=16%  Similarity=0.066  Sum_probs=26.2

Q ss_pred             CCCCeeCCcchhhhcChhHHHhhhhhhCCCCCCCcccccccCC
Q psy11761        138 FPKPYQCDRCSQFFGDRMNLISHHCHKHKQSCLPFISRLFGFD  180 (198)
Q Consensus       138 ~~~~~~C~~C~k~f~~~~~L~~H~~~~~~~~~~~~~~~~~~~~  180 (198)
                      ....|.|+.|+..|+....+.           +-|.|+.||..
T Consensus       106 ~~~~Y~Cp~c~~r~tf~eA~~-----------~~F~Cp~Cg~~  137 (158)
T TIGR00373       106 NNMFFICPNMCVRFTFNEAME-----------LNFTCPRCGAM  137 (158)
T ss_pred             CCCeEECCCCCcEeeHHHHHH-----------cCCcCCCCCCE
Confidence            356799999999998877763           48999999975


No 116
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=68.57  E-value=1.8  Score=29.74  Aligned_cols=27  Identities=19%  Similarity=0.470  Sum_probs=17.2

Q ss_pred             ccccCcccchhhcccCCCceecCcccc
Q psy11761         25 AYKCHQCQRLIFLSANAGVHKCEYCHK   51 (198)
Q Consensus        25 ~~~C~~C~~~f~~~~~~~~~~C~~C~~   51 (198)
                      |++|-.||+.|...+...---|+.||.
T Consensus         1 PH~Ct~Cg~~f~dgs~eil~GCP~CGg   27 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGSKEILSGCPECGG   27 (131)
T ss_pred             CcccCcCCCCcCCCcHHHHccCcccCC
Confidence            567777777776655443445777754


No 117
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=68.15  E-value=2.1  Score=22.32  Aligned_cols=11  Identities=27%  Similarity=0.634  Sum_probs=5.6

Q ss_pred             ccCcccchhhc
Q psy11761         27 KCHQCQRLIFL   37 (198)
Q Consensus        27 ~C~~C~~~f~~   37 (198)
                      .|+.|+..|.-
T Consensus         4 ~Cp~C~~~y~i   14 (36)
T PF13717_consen    4 TCPNCQAKYEI   14 (36)
T ss_pred             ECCCCCCEEeC
Confidence            45555555543


No 118
>PF12773 DZR:  Double zinc ribbon
Probab=67.45  E-value=5.3  Score=22.22  Aligned_cols=9  Identities=22%  Similarity=0.685  Sum_probs=4.9

Q ss_pred             cCccccccC
Q psy11761         46 CEYCHKVFD   54 (198)
Q Consensus        46 C~~C~~~f~   54 (198)
                      |+.||..+.
T Consensus        15 C~~CG~~l~   23 (50)
T PF12773_consen   15 CPHCGTPLP   23 (50)
T ss_pred             ChhhcCChh
Confidence            566655544


No 119
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=66.98  E-value=3.1  Score=30.41  Aligned_cols=32  Identities=16%  Similarity=0.086  Sum_probs=25.7

Q ss_pred             CCCeeCCcchhhhcChhHHHhhhhhhCCCCCCCcccccccCCC
Q psy11761        139 PKPYQCDRCSQFFGDRMNLISHHCHKHKQSCLPFISRLFGFDD  181 (198)
Q Consensus       139 ~~~~~C~~C~k~f~~~~~L~~H~~~~~~~~~~~~~~~~~~~~~  181 (198)
                      ...|.|+.|+..|+....+.           +.|.|+.||...
T Consensus       115 ~~~Y~Cp~C~~rytf~eA~~-----------~~F~Cp~Cg~~L  146 (178)
T PRK06266        115 NMFFFCPNCHIRFTFDEAME-----------YGFRCPQCGEML  146 (178)
T ss_pred             CCEEECCCCCcEEeHHHHhh-----------cCCcCCCCCCCC
Confidence            46799999999998776652           489999999764


No 120
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=66.93  E-value=3.3  Score=31.93  Aligned_cols=26  Identities=19%  Similarity=0.476  Sum_probs=15.9

Q ss_pred             CCCccCccchhcccCchhHHHhhhhc
Q psy11761         69 PRPYKCDTCEKSFTNSQNLNTHQLIH   94 (198)
Q Consensus        69 ~~~~~C~~C~~~f~~~~~l~~H~~~h   94 (198)
                      .+++.|+.|+........|..-.++|
T Consensus       207 ~k~~PCPKCg~et~eTkdLSmStR~h  232 (314)
T PF06524_consen  207 GKPIPCPKCGYETQETKDLSMSTRSH  232 (314)
T ss_pred             CCCCCCCCCCCcccccccceeeeecc
Confidence            45667777776666655555555544


No 121
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=66.34  E-value=4  Score=24.49  Aligned_cols=29  Identities=21%  Similarity=0.438  Sum_probs=17.1

Q ss_pred             ccCcccchhhcccCCCceecCccccccCC
Q psy11761         27 KCHQCQRLIFLSANAGVHKCEYCHKVFDQ   55 (198)
Q Consensus        27 ~C~~C~~~f~~~~~~~~~~C~~C~~~f~~   55 (198)
                      .|+.||...........|.|+.||..+..
T Consensus        30 ~C~~CG~~~~~~~~~r~~~C~~Cg~~~~r   58 (69)
T PF07282_consen   30 TCPRCGHRNKKRRSGRVFTCPNCGFEMDR   58 (69)
T ss_pred             CccCcccccccccccceEEcCCCCCEECc
Confidence            36666665555444446677777665544


No 122
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=65.77  E-value=3.9  Score=22.14  Aligned_cols=28  Identities=25%  Similarity=0.559  Sum_probs=15.4

Q ss_pred             cccCcccchh-hcccCCCceecCcccccc
Q psy11761         26 YKCHQCQRLI-FLSANAGVHKCEYCHKVF   53 (198)
Q Consensus        26 ~~C~~C~~~f-~~~~~~~~~~C~~C~~~f   53 (198)
                      |.||.|+... ........+.|..||...
T Consensus         1 m~Cp~Cg~~~~~~D~~~g~~vC~~CG~Vl   29 (43)
T PF08271_consen    1 MKCPNCGSKEIVFDPERGELVCPNCGLVL   29 (43)
T ss_dssp             ESBTTTSSSEEEEETTTTEEEETTT-BBE
T ss_pred             CCCcCCcCCceEEcCCCCeEECCCCCCEe
Confidence            4677777643 122333456777777654


No 123
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=64.85  E-value=2.8  Score=33.70  Aligned_cols=78  Identities=22%  Similarity=0.336  Sum_probs=44.0

Q ss_pred             cCccchhcccCchhHHHhhhhcCCCCcccCCcCchhhhcccCCCcccCCCcCcccccccccccccCCCCeeCCc--c--h
Q psy11761         73 KCDTCEKSFTNSQNLNTHQLIHSGIRPFKCTTCDKSFVNQINPTSTHTPTYTKSNLAQHSCMNSHFPKPYQCDR--C--S  148 (198)
Q Consensus        73 ~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~~~~~~~~~~~~~~~~l~~H~~~~~~~~~~~~C~~--C--~  148 (198)
                      .|..|...|-+...|..|++..+.    .|-+|+++-+-      ..+.......|.+|.+.     .-|.|.+  |  |
T Consensus       222 ~C~FC~~~FYdDDEL~~HcR~~HE----~ChICD~v~p~------~~QYFK~Y~~Le~HF~~-----~hy~ct~qtc~~~  286 (493)
T COG5236         222 LCIFCKIYFYDDDELRRHCRLRHE----ACHICDMVGPI------RYQYFKSYEDLEAHFRN-----AHYCCTFQTCRVG  286 (493)
T ss_pred             hhhhccceecChHHHHHHHHhhhh----hhhhhhccCcc------chhhhhCHHHHHHHhhc-----CceEEEEEEEecC
Confidence            577777777777778888776552    34444443211      11112225666666642     3456654  3  2


Q ss_pred             --hhhcChhHHHhhhhhhC
Q psy11761        149 --QFFGDRMNLISHHCHKH  165 (198)
Q Consensus       149 --k~f~~~~~L~~H~~~~~  165 (198)
                        ..|.....|..|+..-|
T Consensus       287 k~~vf~~~~el~~h~~~~h  305 (493)
T COG5236         287 KCYVFPYHTELLEHLTRFH  305 (493)
T ss_pred             cEEEeccHHHHHHHHHHHh
Confidence              35666777888876554


No 124
>KOG0402|consensus
Probab=64.24  E-value=2.9  Score=26.21  Aligned_cols=31  Identities=29%  Similarity=0.670  Sum_probs=26.1

Q ss_pred             ccccCcccchhhcccCCCceecCccccccCC
Q psy11761         25 AYKCHQCQRLIFLSANAGVHKCEYCHKVFDQ   55 (198)
Q Consensus        25 ~~~C~~C~~~f~~~~~~~~~~C~~C~~~f~~   55 (198)
                      -|.|+.||+.--.......|.|..|.+.+.-
T Consensus        36 ky~CsfCGK~~vKR~AvGiW~C~~C~kv~ag   66 (92)
T KOG0402|consen   36 KYTCSFCGKKTVKRKAVGIWKCGSCKKVVAG   66 (92)
T ss_pred             hhhhhhcchhhhhhhceeEEecCCccceecc
Confidence            6899999998777788889999999887644


No 125
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=63.70  E-value=4.2  Score=19.41  Aligned_cols=23  Identities=26%  Similarity=0.431  Sum_probs=11.9

Q ss_pred             cccCcccchhhcccCCCceecCccccc
Q psy11761         26 YKCHQCQRLIFLSANAGVHKCEYCHKV   52 (198)
Q Consensus        26 ~~C~~C~~~f~~~~~~~~~~C~~C~~~   52 (198)
                      ..|+.||.......    --|+.||..
T Consensus         3 ~~Cp~Cg~~~~~~~----~fC~~CG~~   25 (26)
T PF13248_consen    3 MFCPNCGAEIDPDA----KFCPNCGAK   25 (26)
T ss_pred             CCCcccCCcCCccc----ccChhhCCC
Confidence            35777777432222    236666653


No 126
>PRK04023 DNA polymerase II large subunit; Validated
Probab=63.43  E-value=7.2  Score=36.02  Aligned_cols=22  Identities=23%  Similarity=0.644  Sum_probs=14.8

Q ss_pred             ccccCcccchhhcccCCCceecCccccc
Q psy11761         25 AYKCHQCQRLIFLSANAGVHKCEYCHKV   52 (198)
Q Consensus        25 ~~~C~~C~~~f~~~~~~~~~~C~~C~~~   52 (198)
                      ...|+.||...      ..+.|+.||..
T Consensus       626 ~RfCpsCG~~t------~~frCP~CG~~  647 (1121)
T PRK04023        626 RRKCPSCGKET------FYRRCPFCGTH  647 (1121)
T ss_pred             CccCCCCCCcC------CcccCCCCCCC
Confidence            35688888763      23678888775


No 127
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=62.76  E-value=3.9  Score=21.10  Aligned_cols=24  Identities=21%  Similarity=0.411  Sum_probs=11.3

Q ss_pred             ccCcccchhhcccCCCceecCccc
Q psy11761         27 KCHQCQRLIFLSANAGVHKCEYCH   50 (198)
Q Consensus        27 ~C~~C~~~f~~~~~~~~~~C~~C~   50 (198)
                      .|..|++.|..+--+..|.+.+|.
T Consensus         5 ~C~eC~~~f~dSyL~~~F~~~VCD   28 (34)
T PF01286_consen    5 KCDECGKPFMDSYLLNNFDLPVCD   28 (34)
T ss_dssp             E-TTT--EES-SSCCCCTS-S--T
T ss_pred             hHhHhCCHHHHHHHHHhCCccccc
Confidence            577777777776666666655554


No 128
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=62.64  E-value=5.7  Score=22.25  Aligned_cols=24  Identities=21%  Similarity=0.396  Sum_probs=19.1

Q ss_pred             CCeeCCcchhhhcCh-----hHHHhhhhh
Q psy11761        140 KPYQCDRCSQFFGDR-----MNLISHHCH  163 (198)
Q Consensus       140 ~~~~C~~C~k~f~~~-----~~L~~H~~~  163 (198)
                      ....|..|++.+...     +.|.+|+..
T Consensus        17 ~~a~C~~C~~~l~~~~~~gTs~L~rHl~~   45 (50)
T smart00614       17 QRAKCKYCGKKLSRSSKGGTSNLRRHLRR   45 (50)
T ss_pred             eEEEecCCCCEeeeCCCCCcHHHHHHHHh
Confidence            346899999999765     589999884


No 129
>KOG2907|consensus
Probab=60.78  E-value=2.9  Score=27.84  Aligned_cols=29  Identities=17%  Similarity=0.384  Sum_probs=19.7

Q ss_pred             cccCcccchhhcccCCCceecCccccccC
Q psy11761         26 YKCHQCQRLIFLSANAGVHKCEYCHKVFD   54 (198)
Q Consensus        26 ~~C~~C~~~f~~~~~~~~~~C~~C~~~f~   54 (198)
                      .=|+.||......+......|..|...+.
T Consensus         8 ~FC~~CG~ll~~~~~~~~~~C~~Ck~~~~   36 (116)
T KOG2907|consen    8 DFCSDCGSLLEEPSAQSTVLCIRCKIEYP   36 (116)
T ss_pred             chhhhhhhhcccccccCceEeccccccCC
Confidence            34777887776666666666777776554


No 130
>COG1773 Rubredoxin [Energy production and conversion]
Probab=60.56  E-value=4.9  Score=23.20  Aligned_cols=11  Identities=18%  Similarity=0.664  Sum_probs=6.0

Q ss_pred             cccCcccchhh
Q psy11761         26 YKCHQCQRLIF   36 (198)
Q Consensus        26 ~~C~~C~~~f~   36 (198)
                      |.|..||..|.
T Consensus         4 ~~C~~CG~vYd   14 (55)
T COG1773           4 WRCSVCGYVYD   14 (55)
T ss_pred             eEecCCceEec
Confidence            45555555553


No 131
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=60.52  E-value=7.7  Score=21.30  Aligned_cols=27  Identities=22%  Similarity=0.661  Sum_probs=16.6

Q ss_pred             ccccCcccch-hhcccCCCceecCcccc
Q psy11761         25 AYKCHQCQRL-IFLSANAGVHKCEYCHK   51 (198)
Q Consensus        25 ~~~C~~C~~~-f~~~~~~~~~~C~~C~~   51 (198)
                      .+.||.||.. .........|+|..|+.
T Consensus        18 g~~CP~Cg~~~~~~~~~~~~~~C~~C~~   45 (46)
T PF12760_consen   18 GFVCPHCGSTKHYRLKTRGRYRCKACRK   45 (46)
T ss_pred             CCCCCCCCCeeeEEeCCCCeEECCCCCC
Confidence            3679998864 22222345788888764


No 132
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=59.98  E-value=7.4  Score=20.77  Aligned_cols=33  Identities=15%  Similarity=0.421  Sum_probs=16.3

Q ss_pred             cCcccchhhcc--cCCCceecCccccccCChhHHh
Q psy11761         28 CHQCQRLIFLS--ANAGVHKCEYCHKVFDQQSSLL   60 (198)
Q Consensus        28 C~~C~~~f~~~--~~~~~~~C~~C~~~f~~~~~l~   60 (198)
                      ||.|+......  ..+..+.|+.|+..+-...+|.
T Consensus         2 CP~C~~~l~~~~~~~~~id~C~~C~G~W~d~~el~   36 (41)
T PF13453_consen    2 CPRCGTELEPVRLGDVEIDVCPSCGGIWFDAGELE   36 (41)
T ss_pred             cCCCCcccceEEECCEEEEECCCCCeEEccHHHHH
Confidence            55665533221  2223456666666655555543


No 133
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=59.23  E-value=8.4  Score=36.49  Aligned_cols=35  Identities=20%  Similarity=0.601  Sum_probs=21.9

Q ss_pred             cccCcccchhhcccCCCceecCccccccCChhHHhhcccCCCCCCCccCccchhcc
Q psy11761         26 YKCHQCQRLIFLSANAGVHKCEYCHKVFDQQSSLLSHNCPQMKPRPYKCDTCEKSF   81 (198)
Q Consensus        26 ~~C~~C~~~f~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f   81 (198)
                      +.|+.||.....      ..|+.||...               ...|.|+.|+...
T Consensus       668 rkCPkCG~~t~~------~fCP~CGs~t---------------e~vy~CPsCGaev  702 (1337)
T PRK14714        668 RRCPSCGTETYE------NRCPDCGTHT---------------EPVYVCPDCGAEV  702 (1337)
T ss_pred             EECCCCCCcccc------ccCcccCCcC---------------CCceeCccCCCcc
Confidence            678888874321      2677777653               2246777777643


No 134
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=58.50  E-value=2.6  Score=31.72  Aligned_cols=31  Identities=19%  Similarity=0.416  Sum_probs=23.6

Q ss_pred             CCCCeeCCcchhhhcChhHHHhhhhhhCCCC
Q psy11761        138 FPKPYQCDRCSQFFGDRMNLISHHCHKHKQS  168 (198)
Q Consensus       138 ~~~~~~C~~C~k~f~~~~~L~~H~~~~~~~~  168 (198)
                      .+..|.|+.|+|.|....-+.+|+...|.++
T Consensus        74 ~~~K~~C~lc~KlFkg~eFV~KHI~nKH~e~  104 (214)
T PF04959_consen   74 DEDKWRCPLCGKLFKGPEFVRKHIFNKHPEK  104 (214)
T ss_dssp             SSEEEEE-SSS-EESSHHHHHHHHHHH-HHH
T ss_pred             cCCEECCCCCCcccCChHHHHHHHhhcCHHH
Confidence            3567999999999999989999998887654


No 135
>KOG4173|consensus
Probab=58.38  E-value=2.8  Score=31.10  Aligned_cols=65  Identities=25%  Similarity=0.587  Sum_probs=46.1

Q ss_pred             eecCc--cccccCChhHHhhcccCCCCCCCccCccchhcccCchhHHHhhhhc----------CCCCcccCCc--Cchhh
Q psy11761         44 HKCEY--CHKVFDQQSSLLSHNCPQMKPRPYKCDTCEKSFTNSQNLNTHQLIH----------SGIRPFKCTT--CDKSF  109 (198)
Q Consensus        44 ~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h----------~~~k~~~C~~--C~~~f  109 (198)
                      +.|++  |.+.|........|..+.++.   .|..|.+.|.+...|..|+...          .|.-.|.|.+  |+..|
T Consensus        80 ~~cqvagc~~~~d~lD~~E~hY~~~h~~---sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KF  156 (253)
T KOG4173|consen   80 FACQVAGCCQVFDALDDYEHHYHTLHGN---SCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKF  156 (253)
T ss_pred             ccccccchHHHHhhhhhHHHhhhhcccc---hhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhh
Confidence            45655  566777777677776665543   6888999999888888887532          3455688854  88888


Q ss_pred             hc
Q psy11761        110 VN  111 (198)
Q Consensus       110 ~~  111 (198)
                      .+
T Consensus       157 kT  158 (253)
T KOG4173|consen  157 KT  158 (253)
T ss_pred             hh
Confidence            87


No 136
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=58.35  E-value=3.8  Score=28.91  Aligned_cols=36  Identities=17%  Similarity=0.401  Sum_probs=20.2

Q ss_pred             hhhhCCCCc----cccCcccchhhcccCCCceecCccccc
Q psy11761         17 LCIHGNDNA----YKCHQCQRLIFLSANAGVHKCEYCHKV   52 (198)
Q Consensus        17 ~~~h~~~~~----~~C~~C~~~f~~~~~~~~~~C~~C~~~   52 (198)
                      -..++|+.+    |.|..||....-......-.|+.|+..
T Consensus       100 g~Y~sGE~~g~G~l~C~~Cg~~~~~~~~~~l~~Cp~C~~~  139 (146)
T PF07295_consen  100 GVYHSGEVVGPGTLVCENCGHEVELTHPERLPPCPKCGHT  139 (146)
T ss_pred             CCeecCcEecCceEecccCCCEEEecCCCcCCCCCCCCCC
Confidence            355667654    667777765433333334457777553


No 137
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=57.95  E-value=11  Score=30.08  Aligned_cols=26  Identities=23%  Similarity=0.547  Sum_probs=22.2

Q ss_pred             CCCeeCCcchhhhcChhHHHhhhhhh
Q psy11761        139 PKPYQCDRCSQFFGDRMNLISHHCHK  164 (198)
Q Consensus       139 ~~~~~C~~C~k~f~~~~~L~~H~~~~  164 (198)
                      ...|.|+.|...|-...+.-.|-.+|
T Consensus       386 s~rY~Ce~CK~~FC~dCdvfiHe~Lh  411 (421)
T COG5151         386 SGRYQCELCKSTFCSDCDVFIHETLH  411 (421)
T ss_pred             ccceechhhhhhhhhhhHHHHHHHHh
Confidence            46899999999999888888887766


No 138
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=57.22  E-value=3.1  Score=27.20  Aligned_cols=26  Identities=15%  Similarity=0.448  Sum_probs=12.3

Q ss_pred             ccccCcccchhhcccCCCceecCccc
Q psy11761         25 AYKCHQCQRLIFLSANAGVHKCEYCH   50 (198)
Q Consensus        25 ~~~C~~C~~~f~~~~~~~~~~C~~C~   50 (198)
                      |+.|-.||..|...+....--|+.||
T Consensus         2 pH~CtrCG~vf~~g~~~il~GCp~CG   27 (112)
T COG3364           2 PHQCTRCGEVFDDGSEEILSGCPKCG   27 (112)
T ss_pred             CceecccccccccccHHHHccCcccc
Confidence            45555555555543333333455554


No 139
>KOG2186|consensus
Probab=56.68  E-value=4.8  Score=30.90  Aligned_cols=46  Identities=17%  Similarity=0.428  Sum_probs=25.0

Q ss_pred             eecCccccccCChhHHhhcccCCCCCCCccCccchhcccCchhHHHhhh
Q psy11761         44 HKCEYCHKVFDQQSSLLSHNCPQMKPRPYKCDTCEKSFTNSQNLNTHQL   92 (198)
Q Consensus        44 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~   92 (198)
                      |.|..||....... +..|+..-++ ..|.|..|+..|.. .++..|..
T Consensus         4 FtCnvCgEsvKKp~-vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    4 FTCNVCGESVKKPQ-VEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             Eehhhhhhhccccc-hHHHHHhccC-CeeEEeeccccccc-chhhhhhh
Confidence            45666666554433 4446555554 55666666666665 44444543


No 140
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=56.53  E-value=7.1  Score=33.53  Aligned_cols=44  Identities=25%  Similarity=0.675  Sum_probs=26.4

Q ss_pred             ccCcccchhhcccCCCceecCccccccC---ChhHHhhcccCCCCCCCccCccchh
Q psy11761         27 KCHQCQRLIFLSANAGVHKCEYCHKVFD---QQSSLLSHNCPQMKPRPYKCDTCEK   79 (198)
Q Consensus        27 ~C~~C~~~f~~~~~~~~~~C~~C~~~f~---~~~~l~~H~~~h~~~~~~~C~~C~~   79 (198)
                      .|..||.         ...|+.|+....   ....|..|.--+....|..|+.|+.
T Consensus       215 ~C~~Cg~---------~~~C~~C~~~l~~h~~~~~l~Ch~Cg~~~~~~~~Cp~C~s  261 (505)
T TIGR00595       215 LCRSCGY---------ILCCPNCDVSLTYHKKEGKLRCHYCGYQEPIPKTCPQCGS  261 (505)
T ss_pred             EhhhCcC---------ccCCCCCCCceEEecCCCeEEcCCCcCcCCCCCCCCCCCC
Confidence            4667776         345777765432   1234555555555566778888875


No 141
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=56.27  E-value=8.7  Score=21.69  Aligned_cols=26  Identities=15%  Similarity=0.341  Sum_probs=13.2

Q ss_pred             ccCcccchhhcccCCCceecCcccccc
Q psy11761         27 KCHQCQRLIFLSANAGVHKCEYCHKVF   53 (198)
Q Consensus        27 ~C~~C~~~f~~~~~~~~~~C~~C~~~f   53 (198)
                      -||.||..|.. .....+.|..|+..+
T Consensus        22 fCP~Cg~~~m~-~~~~r~~C~~Cgyt~   47 (50)
T PRK00432         22 FCPRCGSGFMA-EHLDRWHCGKCGYTE   47 (50)
T ss_pred             cCcCCCcchhe-ccCCcEECCCcCCEE
Confidence            36666654222 222456666666543


No 142
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=55.94  E-value=7.1  Score=27.04  Aligned_cols=26  Identities=27%  Similarity=0.430  Sum_probs=16.9

Q ss_pred             CCCeeCCcchhhhcChhHHHhhhhhhCCC
Q psy11761        139 PKPYQCDRCSQFFGDRMNLISHHCHKHKQ  167 (198)
Q Consensus       139 ~~~~~C~~C~k~f~~~~~L~~H~~~~~~~  167 (198)
                      +....|-+||+.|..   |.+|+..|||-
T Consensus        70 ~d~i~clecGk~~k~---LkrHL~~~~gl   95 (132)
T PF05443_consen   70 PDYIICLECGKKFKT---LKRHLRTHHGL   95 (132)
T ss_dssp             SS-EE-TBT--EESB---HHHHHHHTT-S
T ss_pred             cCeeEEccCCcccch---HHHHHHHccCC
Confidence            456789999999954   59999999874


No 143
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=55.64  E-value=6.8  Score=19.58  Aligned_cols=24  Identities=21%  Similarity=0.497  Sum_probs=8.6

Q ss_pred             ccCcccchhhcccCCCceecCcccc
Q psy11761         27 KCHQCQRLIFLSANAGVHKCEYCHK   51 (198)
Q Consensus        27 ~C~~C~~~f~~~~~~~~~~C~~C~~   51 (198)
                      +|+.|+..+.- ..-..+.|+.|+.
T Consensus         4 ~Cp~C~se~~y-~D~~~~vCp~C~~   27 (30)
T PF08274_consen    4 KCPLCGSEYTY-EDGELLVCPECGH   27 (30)
T ss_dssp             --TTT-----E-E-SSSEEETTTTE
T ss_pred             CCCCCCCccee-ccCCEEeCCcccc
Confidence            46666655433 2233566666654


No 144
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=55.49  E-value=9.6  Score=25.31  Aligned_cols=33  Identities=12%  Similarity=0.035  Sum_probs=23.8

Q ss_pred             ccCCcCchhhhcccCCCcccCCCcCcccccccccccccCCCCeeCCcchhhhcChhHHH
Q psy11761        100 FKCTTCDKSFVNQINPTSTHTPTYTKSNLAQHSCMNSHFPKPYQCDRCSQFFGDRMNLI  158 (198)
Q Consensus       100 ~~C~~C~~~f~~~~~~~~~~~~~~~~~~l~~H~~~~~~~~~~~~C~~C~k~f~~~~~L~  158 (198)
                      -.|+.|++.|..             .            +..|..|+.||++|. ++.|.
T Consensus        10 ridPetg~KFYD-------------L------------NrdPiVsPytG~s~P-~s~fe   42 (129)
T COG4530          10 RIDPETGKKFYD-------------L------------NRDPIVSPYTGKSYP-RSYFE   42 (129)
T ss_pred             ccCccccchhhc-------------c------------CCCccccCcccccch-HHHHH
Confidence            478888888865             1            357899999999994 33443


No 145
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=54.77  E-value=7.8  Score=32.24  Aligned_cols=30  Identities=13%  Similarity=0.349  Sum_probs=23.3

Q ss_pred             ccCcccchhhcccCCCceecCccccccCChh
Q psy11761         27 KCHQCQRLIFLSANAGVHKCEYCHKVFDQQS   57 (198)
Q Consensus        27 ~C~~C~~~f~~~~~~~~~~C~~C~~~f~~~~   57 (198)
                      .|+.||...++...- .|+|+-|+..+....
T Consensus       352 ~Cp~Cg~~m~S~G~~-g~rC~kCg~~~~~~~  381 (421)
T COG1571         352 VCPRCGGRMKSAGRN-GFRCKKCGTRARETL  381 (421)
T ss_pred             CCCccCCchhhcCCC-CcccccccccCCccc
Confidence            688888888776666 888888888776654


No 146
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=52.89  E-value=9.9  Score=34.17  Aligned_cols=23  Identities=30%  Similarity=0.576  Sum_probs=12.2

Q ss_pred             cccccccccccCCCCeeCCcchhh
Q psy11761        127 NLAQHSCMNSHFPKPYQCDRCSQF  150 (198)
Q Consensus       127 ~l~~H~~~~~~~~~~~~C~~C~k~  150 (198)
                      .|..|..-+. ...|..|+.||..
T Consensus       462 ~L~CH~Cg~~-~~~p~~Cp~Cgs~  484 (730)
T COG1198         462 QLRCHYCGYQ-EPIPQSCPECGSE  484 (730)
T ss_pred             eeEeCCCCCC-CCCCCCCCCCCCC
Confidence            3444444443 3456677777644


No 147
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=51.96  E-value=4.1  Score=27.36  Aligned_cols=24  Identities=17%  Similarity=0.461  Sum_probs=10.5

Q ss_pred             cccCcccchhhcccCCCceecCcccc
Q psy11761         26 YKCHQCQRLIFLSANAGVHKCEYCHK   51 (198)
Q Consensus        26 ~~C~~C~~~f~~~~~~~~~~C~~C~~   51 (198)
                      ..|..||..|......  +.|+.|+.
T Consensus        71 ~~C~~Cg~~~~~~~~~--~~CP~Cgs   94 (113)
T PF01155_consen   71 ARCRDCGHEFEPDEFD--FSCPRCGS   94 (113)
T ss_dssp             EEETTTS-EEECHHCC--HH-SSSSS
T ss_pred             EECCCCCCEEecCCCC--CCCcCCcC
Confidence            4455555555433322  44555554


No 148
>KOG1280|consensus
Probab=51.11  E-value=12  Score=30.20  Aligned_cols=43  Identities=16%  Similarity=0.316  Sum_probs=35.6

Q ss_pred             CCCeeCCcchhhhcChhHHHhhhhhhCCCCCCCcccccccCCC
Q psy11761        139 PKPYQCDRCSQFFGDRMNLISHHCHKHKQSCLPFISRLFGFDD  181 (198)
Q Consensus       139 ~~~~~C~~C~k~f~~~~~L~~H~~~~~~~~~~~~~~~~~~~~~  181 (198)
                      ...|.|+.|+++=-+...|..|....|-+-++-.+|++|+...
T Consensus        77 ~qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~~~~  119 (381)
T KOG1280|consen   77 PQSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCAANP  119 (381)
T ss_pred             cccccCCcccccccchhHHHHHhhhcCcccCcceeeeccccCc
Confidence            4589999999988788899999988887777888888887543


No 149
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=50.80  E-value=13  Score=19.78  Aligned_cols=13  Identities=31%  Similarity=0.641  Sum_probs=7.0

Q ss_pred             ceecCccccccCC
Q psy11761         43 VHKCEYCHKVFDQ   55 (198)
Q Consensus        43 ~~~C~~C~~~f~~   55 (198)
                      ++.|..|+..|-.
T Consensus        12 ~f~C~~C~~~FC~   24 (39)
T smart00154       12 GFKCRHCGNLFCG   24 (39)
T ss_pred             CeECCccCCcccc
Confidence            5555555555533


No 150
>PRK00420 hypothetical protein; Validated
Probab=50.50  E-value=11  Score=25.28  Aligned_cols=30  Identities=23%  Similarity=0.385  Sum_probs=19.8

Q ss_pred             ccccCcccchhhcccCCCceecCccccccCC
Q psy11761         25 AYKCHQCQRLIFLSANAGVHKCEYCHKVFDQ   55 (198)
Q Consensus        25 ~~~C~~C~~~f~~~~~~~~~~C~~C~~~f~~   55 (198)
                      .-.||.||..+..- ..+...|+.||....-
T Consensus        23 ~~~CP~Cg~pLf~l-k~g~~~Cp~Cg~~~~v   52 (112)
T PRK00420         23 SKHCPVCGLPLFEL-KDGEVVCPVHGKVYIV   52 (112)
T ss_pred             cCCCCCCCCcceec-CCCceECCCCCCeeee
Confidence            35688888766552 3336778888885543


No 151
>PRK05580 primosome assembly protein PriA; Validated
Probab=50.09  E-value=10  Score=33.93  Aligned_cols=46  Identities=28%  Similarity=0.691  Sum_probs=28.0

Q ss_pred             cccCcccchhhcccCCCceecCccccccC---ChhHHhhcccCCCCCCCccCccchhc
Q psy11761         26 YKCHQCQRLIFLSANAGVHKCEYCHKVFD---QQSSLLSHNCPQMKPRPYKCDTCEKS   80 (198)
Q Consensus        26 ~~C~~C~~~f~~~~~~~~~~C~~C~~~f~---~~~~l~~H~~~h~~~~~~~C~~C~~~   80 (198)
                      ..|..||.         ...|+.|+..+.   ....|..|.--+....+..|+.|+..
T Consensus       382 ~~C~~Cg~---------~~~C~~C~~~l~~h~~~~~l~Ch~Cg~~~~~~~~Cp~Cg~~  430 (679)
T PRK05580        382 LLCRDCGW---------VAECPHCDASLTLHRFQRRLRCHHCGYQEPIPKACPECGST  430 (679)
T ss_pred             eEhhhCcC---------ccCCCCCCCceeEECCCCeEECCCCcCCCCCCCCCCCCcCC
Confidence            34667776         345777766542   22345556666666667788888654


No 152
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=49.95  E-value=10  Score=22.69  Aligned_cols=28  Identities=25%  Similarity=0.527  Sum_probs=10.5

Q ss_pred             cccCcccchhhcccCCCceecCccccccCC
Q psy11761         26 YKCHQCQRLIFLSANAGVHKCEYCHKVFDQ   55 (198)
Q Consensus        26 ~~C~~C~~~f~~~~~~~~~~C~~C~~~f~~   55 (198)
                      -.|..|++.|..  -...+.|..||..|-.
T Consensus        10 ~~C~~C~~~F~~--~~rrhhCr~CG~~vC~   37 (69)
T PF01363_consen   10 SNCMICGKKFSL--FRRRHHCRNCGRVVCS   37 (69)
T ss_dssp             SB-TTT--B-BS--SS-EEE-TTT--EEEC
T ss_pred             CcCcCcCCcCCC--ceeeEccCCCCCEECC
Confidence            346667766622  2345666666665543


No 153
>KOG4167|consensus
Probab=49.71  E-value=5.2  Score=35.46  Aligned_cols=27  Identities=15%  Similarity=0.306  Sum_probs=24.1

Q ss_pred             CCCeeCCcchhhhcChhHHHhhhhhhC
Q psy11761        139 PKPYQCDRCSQFFGDRMNLISHHCHKH  165 (198)
Q Consensus       139 ~~~~~C~~C~k~f~~~~~L~~H~~~~~  165 (198)
                      ..-|-|..|+|.|-...++..||++|.
T Consensus       790 ~giFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  790 TGIFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             CceeehHHHHHHHHHHhhhhHHHHHHH
Confidence            346899999999999999999999985


No 154
>KOG4124|consensus
Probab=48.39  E-value=8.3  Score=31.15  Aligned_cols=23  Identities=35%  Similarity=0.756  Sum_probs=18.3

Q ss_pred             CCCeeCCcchhhhcChhHHHhhh
Q psy11761        139 PKPYQCDRCSQFFGDRMNLISHH  161 (198)
Q Consensus       139 ~~~~~C~~C~k~f~~~~~L~~H~  161 (198)
                      .|+|.|++|.+.+.....|..|.
T Consensus       396 nk~~r~~i~~~~~k~~~~l~~~~  418 (442)
T KOG4124|consen  396 NKPYRCEVCSKRYKNLNGLKYHR  418 (442)
T ss_pred             cCcccChhhhhhhccCCCCCcee
Confidence            58999999999998776665554


No 155
>PRK12496 hypothetical protein; Provisional
Probab=47.95  E-value=10  Score=27.25  Aligned_cols=13  Identities=23%  Similarity=0.618  Sum_probs=10.7

Q ss_pred             cccCCcCchhhhc
Q psy11761         99 PFKCTTCDKSFVN  111 (198)
Q Consensus        99 ~~~C~~C~~~f~~  111 (198)
                      .+.|..|++.|..
T Consensus       127 ~~~C~gC~~~~~~  139 (164)
T PRK12496        127 RKVCKGCKKKYPE  139 (164)
T ss_pred             eEECCCCCccccC
Confidence            4789999999964


No 156
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=47.86  E-value=10  Score=21.56  Aligned_cols=20  Identities=25%  Similarity=0.698  Sum_probs=6.4

Q ss_pred             CccCccchhcccCchhHHHh
Q psy11761         71 PYKCDTCEKSFTNSQNLNTH   90 (198)
Q Consensus        71 ~~~C~~C~~~f~~~~~l~~H   90 (198)
                      .|.|+.|...|-..-++..|
T Consensus        21 ~y~C~~C~~~FC~dCD~fiH   40 (51)
T PF07975_consen   21 RYRCPKCKNHFCIDCDVFIH   40 (51)
T ss_dssp             EE--TTTT--B-HHHHHTTT
T ss_pred             eEECCCCCCccccCcChhhh
Confidence            34444444444444333333


No 157
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=47.62  E-value=7.3  Score=29.59  Aligned_cols=17  Identities=12%  Similarity=0.335  Sum_probs=13.1

Q ss_pred             CCccccCcccchhhccc
Q psy11761         23 DNAYKCHQCQRLIFLSA   39 (198)
Q Consensus        23 ~~~~~C~~C~~~f~~~~   39 (198)
                      ++-+.||+|+..|....
T Consensus        17 kk~ieCPvC~tkFkkee   33 (267)
T COG1655          17 KKTIECPVCNTKFKKEE   33 (267)
T ss_pred             hceeccCcccchhhhhh
Confidence            35678999999987654


No 158
>PRK14873 primosome assembly protein PriA; Provisional
Probab=47.19  E-value=9.7  Score=33.92  Aligned_cols=44  Identities=16%  Similarity=0.562  Sum_probs=23.5

Q ss_pred             ccCcccchhhcccCCCceecCccccccCC---hhHHhhcccCCCCCCCccCccchhc
Q psy11761         27 KCHQCQRLIFLSANAGVHKCEYCHKVFDQ---QSSLLSHNCPQMKPRPYKCDTCEKS   80 (198)
Q Consensus        27 ~C~~C~~~f~~~~~~~~~~C~~C~~~f~~---~~~l~~H~~~h~~~~~~~C~~C~~~   80 (198)
                      .|..||.         ...|+.|+..+..   ...|..|.--+.. .++.|+.|+..
T Consensus       385 ~C~~Cg~---------~~~C~~C~~~L~~h~~~~~l~Ch~CG~~~-~p~~Cp~Cgs~  431 (665)
T PRK14873        385 ACARCRT---------PARCRHCTGPLGLPSAGGTPRCRWCGRAA-PDWRCPRCGSD  431 (665)
T ss_pred             EhhhCcC---------eeECCCCCCceeEecCCCeeECCCCcCCC-cCccCCCCcCC
Confidence            4777776         4567777654432   1234444444433 46667777653


No 159
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=47.19  E-value=17  Score=29.05  Aligned_cols=14  Identities=29%  Similarity=0.605  Sum_probs=8.0

Q ss_pred             CCCCCCccCccchh
Q psy11761         66 QMKPRPYKCDTCEK   79 (198)
Q Consensus        66 h~~~~~~~C~~C~~   79 (198)
                      ..|.+-..|..|+.
T Consensus       207 ~~G~RyL~CslC~t  220 (309)
T PRK03564        207 TQGLRYLHCNLCES  220 (309)
T ss_pred             CCCceEEEcCCCCC
Confidence            34555666666653


No 160
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=46.71  E-value=12  Score=25.95  Aligned_cols=13  Identities=31%  Similarity=0.685  Sum_probs=7.5

Q ss_pred             ceecCccccccCC
Q psy11761         43 VHKCEYCHKVFDQ   55 (198)
Q Consensus        43 ~~~C~~C~~~f~~   55 (198)
                      .+.|..||..|..
T Consensus        70 ~~~C~~CG~~~~~   82 (135)
T PRK03824         70 VLKCRNCGNEWSL   82 (135)
T ss_pred             EEECCCCCCEEec
Confidence            4566666655543


No 161
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=46.51  E-value=9.8  Score=20.60  Aligned_cols=16  Identities=25%  Similarity=0.414  Sum_probs=13.5

Q ss_pred             eCCcchhhhcChhHHH
Q psy11761        143 QCDRCSQFFGDRMNLI  158 (198)
Q Consensus       143 ~C~~C~k~f~~~~~L~  158 (198)
                      .|..||+.|+.+..+.
T Consensus        10 ~C~~C~rpf~WRKKW~   25 (42)
T PF10013_consen   10 ICPVCGRPFTWRKKWA   25 (42)
T ss_pred             cCcccCCcchHHHHHH
Confidence            7999999999886654


No 162
>KOG2785|consensus
Probab=46.46  E-value=8.3  Score=31.47  Aligned_cols=54  Identities=22%  Similarity=0.339  Sum_probs=42.2

Q ss_pred             CcccCCcCchhhhcccCCCcccCCCcCcccccccccccccC----------------------CCCeeCCcch---hhhc
Q psy11761         98 RPFKCTTCDKSFVNQINPTSTHTPTYTKSNLAQHSCMNSHF----------------------PKPYQCDRCS---QFFG  152 (198)
Q Consensus        98 k~~~C~~C~~~f~~~~~~~~~~~~~~~~~~l~~H~~~~~~~----------------------~~~~~C~~C~---k~f~  152 (198)
                      .|-.|..|++.+.+             ...-..|+..+|+.                      ...+.|-.|+   +.|.
T Consensus       165 ~Pt~CLfC~~~~k~-------------~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~  231 (390)
T KOG2785|consen  165 IPTDCLFCDKKSKS-------------LEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFS  231 (390)
T ss_pred             CCcceeecCCCccc-------------HHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCccc
Confidence            34688999999887             66667788877732                      2458899999   9999


Q ss_pred             ChhHHHhhhhhh
Q psy11761        153 DRMNLISHHCHK  164 (198)
Q Consensus       153 ~~~~L~~H~~~~  164 (198)
                      +....+.||...
T Consensus       232 sleavr~HM~~K  243 (390)
T KOG2785|consen  232 SLEAVRAHMRDK  243 (390)
T ss_pred             ccHHHHHHHhhc
Confidence            999999999643


No 163
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=45.94  E-value=11  Score=19.37  Aligned_cols=25  Identities=20%  Similarity=0.406  Sum_probs=9.4

Q ss_pred             cCcccchhhcc----cCCCceecCccccc
Q psy11761         28 CHQCQRLIFLS----ANAGVHKCEYCHKV   52 (198)
Q Consensus        28 C~~C~~~f~~~----~~~~~~~C~~C~~~   52 (198)
                      |+.||......    .+...+.|+.|+..
T Consensus         3 C~~CG~~l~~~ip~gd~r~R~vC~~Cg~I   31 (34)
T PF14803_consen    3 CPQCGGPLERRIPEGDDRERLVCPACGFI   31 (34)
T ss_dssp             -TTT--B-EEE--TT-SS-EEEETTTTEE
T ss_pred             cccccChhhhhcCCCCCccceECCCCCCE
Confidence            55666544332    22224566666543


No 164
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=45.72  E-value=16  Score=28.04  Aligned_cols=11  Identities=36%  Similarity=1.120  Sum_probs=5.3

Q ss_pred             ccCCcCchhhh
Q psy11761        100 FKCTTCDKSFV  110 (198)
Q Consensus       100 ~~C~~C~~~f~  110 (198)
                      |.|+.|+..|.
T Consensus       156 f~C~~C~h~F~  166 (278)
T PF15135_consen  156 FHCPKCRHNFR  166 (278)
T ss_pred             eecccccccch
Confidence            44545544443


No 165
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=45.68  E-value=8.2  Score=24.27  Aligned_cols=32  Identities=22%  Similarity=0.608  Sum_probs=13.5

Q ss_pred             CccccCcccch------hhcccCCCceecCccccccCC
Q psy11761         24 NAYKCHQCQRL------IFLSANAGVHKCEYCHKVFDQ   55 (198)
Q Consensus        24 ~~~~C~~C~~~------f~~~~~~~~~~C~~C~~~f~~   55 (198)
                      +.|.||.|+..      +..+.....-.|..|+..|..
T Consensus        21 ~~F~CPfC~~~~sV~v~idkk~~~~~~~C~~Cg~~~~~   58 (81)
T PF05129_consen   21 KVFDCPFCNHEKSVSVKIDKKEGIGILSCRVCGESFQT   58 (81)
T ss_dssp             S----TTT--SS-EEEEEETTTTEEEEEESSS--EEEE
T ss_pred             ceEcCCcCCCCCeEEEEEEccCCEEEEEecCCCCeEEE
Confidence            45888888832      222333445678888776644


No 166
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=45.34  E-value=14  Score=20.76  Aligned_cols=25  Identities=20%  Similarity=0.602  Sum_probs=13.6

Q ss_pred             cCcccchhhcccCCCceecCccccc
Q psy11761         28 CHQCQRLIFLSANAGVHKCEYCHKV   52 (198)
Q Consensus        28 C~~C~~~f~~~~~~~~~~C~~C~~~   52 (198)
                      ||.||-...-......|.|.-||..
T Consensus        22 CPrCG~gvfmA~H~dR~~CGkCgyT   46 (51)
T COG1998          22 CPRCGPGVFMADHKDRWACGKCGYT   46 (51)
T ss_pred             CCCCCCcchhhhcCceeEeccccce
Confidence            6667753333344446666666653


No 167
>KOG2482|consensus
Probab=43.16  E-value=17  Score=29.43  Aligned_cols=24  Identities=29%  Similarity=0.564  Sum_probs=21.9

Q ss_pred             CeeCCcchhhhcChhHHHhhhhhh
Q psy11761        141 PYQCDRCSQFFGDRMNLISHHCHK  164 (198)
Q Consensus       141 ~~~C~~C~k~f~~~~~L~~H~~~~  164 (198)
                      .+.|-.|.+.|..+..|+.||+..
T Consensus       195 r~~CLyCekifrdkntLkeHMrkK  218 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRKK  218 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHhc
Confidence            578999999999999999999855


No 168
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=43.09  E-value=13  Score=21.35  Aligned_cols=12  Identities=42%  Similarity=1.010  Sum_probs=9.6

Q ss_pred             ccCCcCchhhhc
Q psy11761        100 FKCTTCDKSFVN  111 (198)
Q Consensus       100 ~~C~~C~~~f~~  111 (198)
                      -.|+.||+.|..
T Consensus         6 ~~C~~Cg~~~~~   17 (54)
T PF14446_consen    6 CKCPVCGKKFKD   17 (54)
T ss_pred             ccChhhCCcccC
Confidence            478999998864


No 169
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=42.85  E-value=20  Score=31.85  Aligned_cols=23  Identities=26%  Similarity=0.428  Sum_probs=13.6

Q ss_pred             ccCcccchhhcccCCCceecCcccccc
Q psy11761         27 KCHQCQRLIFLSANAGVHKCEYCHKVF   53 (198)
Q Consensus        27 ~C~~C~~~f~~~~~~~~~~C~~C~~~f   53 (198)
                      .|+.||........    -|+.||..+
T Consensus         3 ~Cp~Cg~~n~~~ak----FC~~CG~~l   25 (645)
T PRK14559          3 ICPQCQFENPNNNR----FCQKCGTSL   25 (645)
T ss_pred             cCCCCCCcCCCCCc----cccccCCCC
Confidence            57888775433222    377777655


No 170
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=41.57  E-value=14  Score=24.81  Aligned_cols=10  Identities=20%  Similarity=0.800  Sum_probs=4.6

Q ss_pred             cccCcccchh
Q psy11761         26 YKCHQCQRLI   35 (198)
Q Consensus        26 ~~C~~C~~~f   35 (198)
                      ..|..||..|
T Consensus        71 ~~C~~Cg~~~   80 (113)
T PRK12380         71 AWCWDCSQVV   80 (113)
T ss_pred             EEcccCCCEE
Confidence            3444555444


No 171
>KOG2593|consensus
Probab=40.76  E-value=18  Score=30.09  Aligned_cols=40  Identities=15%  Similarity=0.573  Sum_probs=25.2

Q ss_pred             cCCCCcccCCcCchhhhcccCCCcccCCCcCcccccccccccccCCCCeeCCcchhh
Q psy11761         94 HSGIRPFKCTTCDKSFVNQINPTSTHTPTYTKSNLAQHSCMNSHFPKPYQCDRCSQF  150 (198)
Q Consensus        94 h~~~k~~~C~~C~~~f~~~~~~~~~~~~~~~~~~l~~H~~~~~~~~~~~~C~~C~k~  150 (198)
                      .+....|.|+.|.+.|..             ...+..   ..- ....|.|..|+-.
T Consensus       123 ~t~~~~Y~Cp~C~kkyt~-------------Lea~~L---~~~-~~~~F~C~~C~ge  162 (436)
T KOG2593|consen  123 DTNVAGYVCPNCQKKYTS-------------LEALQL---LDN-ETGEFHCENCGGE  162 (436)
T ss_pred             ccccccccCCccccchhh-------------hHHHHh---hcc-cCceEEEecCCCc
Confidence            345667999999999876             333221   111 2467889888743


No 172
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=40.13  E-value=12  Score=25.91  Aligned_cols=27  Identities=15%  Similarity=0.048  Sum_probs=22.1

Q ss_pred             CCeeCCcchhhhcChhHHHhhhhhhCCCCC
Q psy11761        140 KPYQCDRCSQFFGDRMNLISHHCHKHKQSC  169 (198)
Q Consensus       140 ~~~~C~~C~k~f~~~~~L~~H~~~~~~~~~  169 (198)
                      .-..|-.+|+.|   .+|.+|+.+|++.-|
T Consensus        75 D~IicLEDGkkf---KSLKRHL~t~~gmTP  101 (148)
T COG4957          75 DYIICLEDGKKF---KSLKRHLTTHYGLTP  101 (148)
T ss_pred             CeEEEeccCcch---HHHHHHHhcccCCCH
Confidence            457899999999   478999999987544


No 173
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=39.82  E-value=14  Score=24.86  Aligned_cols=10  Identities=30%  Similarity=0.763  Sum_probs=4.7

Q ss_pred             eecCcccccc
Q psy11761         44 HKCEYCHKVF   53 (198)
Q Consensus        44 ~~C~~C~~~f   53 (198)
                      ..|..|+..|
T Consensus        71 ~~C~~Cg~~~   80 (115)
T TIGR00100        71 CECEDCSEEV   80 (115)
T ss_pred             EEcccCCCEE
Confidence            3455555443


No 174
>PF09082 DUF1922:  Domain of unknown function (DUF1922);  InterPro: IPR015166 Members of this family consist of a beta-sheet region followed by an alpha-helix and an unstructured C terminus. The beta-sheet region contains a CXCX...XCXC sequence with Cys residues located in two proximal loops and pointing towards each other. This precise function of this set of bacterial proteins is, as yet, unknown []. ; PDB: 1GH9_A.
Probab=39.58  E-value=12  Score=22.59  Aligned_cols=27  Identities=30%  Similarity=0.896  Sum_probs=17.0

Q ss_pred             ccccCcccchhhcccCCCceecCcccccc
Q psy11761         25 AYKCHQCQRLIFLSANAGVHKCEYCHKVF   53 (198)
Q Consensus        25 ~~~C~~C~~~f~~~~~~~~~~C~~C~~~f   53 (198)
                      .|.| .||+..-.....+..+| .||...
T Consensus         3 ifrC-~Cgr~lya~e~~kTkkC-~CG~~l   29 (68)
T PF09082_consen    3 IFRC-DCGRYLYAKEGAKTKKC-VCGKTL   29 (68)
T ss_dssp             EEEE-TTS--EEEETT-SEEEE-TTTEEE
T ss_pred             EEEe-cCCCEEEecCCcceeEe-cCCCee
Confidence            3667 58877766677777788 787764


No 175
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=38.75  E-value=20  Score=23.76  Aligned_cols=29  Identities=14%  Similarity=0.390  Sum_probs=17.4

Q ss_pred             ccCcccchhhcccCCCceecCccccccCCh
Q psy11761         27 KCHQCQRLIFLSANAGVHKCEYCHKVFDQQ   56 (198)
Q Consensus        27 ~C~~C~~~f~~~~~~~~~~C~~C~~~f~~~   56 (198)
                      .||.|+..+.-... ..|.|++|+..+...
T Consensus         4 ~CP~C~seytY~dg-~~~iCpeC~~EW~~~   32 (109)
T TIGR00686         4 PCPKCNSEYTYHDG-TQLICPSCLYEWNEN   32 (109)
T ss_pred             cCCcCCCcceEecC-CeeECcccccccccc
Confidence            57777766543322 247777777766543


No 176
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=38.42  E-value=21  Score=18.56  Aligned_cols=27  Identities=19%  Similarity=0.552  Sum_probs=16.4

Q ss_pred             CccccCcccchhhcccCCCceecCcccc
Q psy11761         24 NAYKCHQCQRLIFLSANAGVHKCEYCHK   51 (198)
Q Consensus        24 ~~~~C~~C~~~f~~~~~~~~~~C~~C~~   51 (198)
                      ...+|++|+.. .-.....-+-|..||-
T Consensus         7 ~~~~C~~C~~~-~~~~~dG~~yC~~cG~   33 (36)
T PF11781_consen    7 PNEPCPVCGSR-WFYSDDGFYYCDRCGH   33 (36)
T ss_pred             CCCcCCCCCCe-EeEccCCEEEhhhCce
Confidence            34568888876 3334445566766654


No 177
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=38.23  E-value=12  Score=24.41  Aligned_cols=30  Identities=23%  Similarity=0.629  Sum_probs=15.6

Q ss_pred             ccccCcccchhhc------ccCCCceecCccccccC
Q psy11761         25 AYKCHQCQRLIFL------SANAGVHKCEYCHKVFD   54 (198)
Q Consensus        25 ~~~C~~C~~~f~~------~~~~~~~~C~~C~~~f~   54 (198)
                      .|.||.||..-..      ..+.....|..||..|.
T Consensus        22 ~FtCp~Cghe~vs~ctvkk~~~~g~~~Cg~CGls~e   57 (104)
T COG4888          22 TFTCPRCGHEKVSSCTVKKTVNIGTAVCGNCGLSFE   57 (104)
T ss_pred             eEecCccCCeeeeEEEEEecCceeEEEcccCcceEE
Confidence            4677777754222      22223445666666553


No 178
>KOG1842|consensus
Probab=38.21  E-value=20  Score=30.09  Aligned_cols=28  Identities=18%  Similarity=0.236  Sum_probs=24.8

Q ss_pred             CCeeCCcchhhhcChhHHHhhhhhhCCC
Q psy11761        140 KPYQCDRCSQFFGDRMNLISHHCHKHKQ  167 (198)
Q Consensus       140 ~~~~C~~C~k~f~~~~~L~~H~~~~~~~  167 (198)
                      ..|.|++|.+.|.+.+.|..|...-|++
T Consensus        14 egflCPiC~~dl~~~~~L~~H~d~eH~~   41 (505)
T KOG1842|consen   14 EGFLCPICLLDLPNLSALNDHLDVEHFE   41 (505)
T ss_pred             hcccCchHhhhhhhHHHHHHHHhhhccc
Confidence            5799999999999999999999876653


No 179
>KOG0978|consensus
Probab=37.89  E-value=13  Score=33.13  Aligned_cols=12  Identities=33%  Similarity=0.935  Sum_probs=7.3

Q ss_pred             cCccchhcccCc
Q psy11761         73 KCDTCEKSFTNS   84 (198)
Q Consensus        73 ~C~~C~~~f~~~   84 (198)
                      +||.|+.+|...
T Consensus       680 KCP~Cn~aFgan  691 (698)
T KOG0978|consen  680 KCPKCNAAFGAN  691 (698)
T ss_pred             CCCCCCCCCCcc
Confidence            566666666544


No 180
>PRK10220 hypothetical protein; Provisional
Probab=37.57  E-value=24  Score=23.50  Aligned_cols=29  Identities=21%  Similarity=0.582  Sum_probs=17.8

Q ss_pred             ccCcccchhhcccCCCceecCccccccCCh
Q psy11761         27 KCHQCQRLIFLSANAGVHKCEYCHKVFDQQ   56 (198)
Q Consensus        27 ~C~~C~~~f~~~~~~~~~~C~~C~~~f~~~   56 (198)
                      .||.|+..+.-... ..|.|++|+..+...
T Consensus         5 ~CP~C~seytY~d~-~~~vCpeC~hEW~~~   33 (111)
T PRK10220          5 HCPKCNSEYTYEDN-GMYICPECAHEWNDA   33 (111)
T ss_pred             cCCCCCCcceEcCC-CeEECCcccCcCCcc
Confidence            57777766543222 247788887766554


No 181
>KOG2636|consensus
Probab=37.48  E-value=20  Score=30.03  Aligned_cols=25  Identities=20%  Similarity=0.514  Sum_probs=21.8

Q ss_pred             CCCCeeCCcch-hhhcChhHHHhhhh
Q psy11761        138 FPKPYQCDRCS-QFFGDRMNLISHHC  162 (198)
Q Consensus       138 ~~~~~~C~~C~-k~f~~~~~L~~H~~  162 (198)
                      -...|.|++|| +++..+..+.+|..
T Consensus       398 L~~ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  398 LDIEYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             CCcccceeeccCccccCcHHHHHHhH
Confidence            45789999999 99999999999974


No 182
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=37.22  E-value=24  Score=19.64  Aligned_cols=29  Identities=21%  Similarity=0.559  Sum_probs=17.3

Q ss_pred             CCccccCcccchhhcccCCCceecCccccc
Q psy11761         23 DNAYKCHQCQRLIFLSANAGVHKCEYCHKV   52 (198)
Q Consensus        23 ~~~~~C~~C~~~f~~~~~~~~~~C~~C~~~   52 (198)
                      ..|..|..|++.... .....+.|..|+..
T Consensus         9 ~~~~~C~~C~~~i~g-~~~~g~~C~~C~~~   37 (53)
T PF00130_consen    9 SKPTYCDVCGKFIWG-LGKQGYRCSWCGLV   37 (53)
T ss_dssp             SSTEB-TTSSSBECS-SSSCEEEETTTT-E
T ss_pred             CCCCCCcccCcccCC-CCCCeEEECCCCCh
Confidence            346678888877633 44446777777654


No 183
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=36.82  E-value=12  Score=22.96  Aligned_cols=7  Identities=43%  Similarity=1.151  Sum_probs=3.5

Q ss_pred             ccCcccc
Q psy11761         27 KCHQCQR   33 (198)
Q Consensus        27 ~C~~C~~   33 (198)
                      .||.||.
T Consensus         3 ~CP~Cg~    9 (72)
T PRK09678          3 HCPLCQH    9 (72)
T ss_pred             cCCCCCC
Confidence            4555554


No 184
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=36.26  E-value=22  Score=20.11  Aligned_cols=25  Identities=28%  Similarity=0.754  Sum_probs=11.8

Q ss_pred             cCcccchhhcccCCCceecCccccccC
Q psy11761         28 CHQCQRLIFLSANAGVHKCEYCHKVFD   54 (198)
Q Consensus        28 C~~C~~~f~~~~~~~~~~C~~C~~~f~   54 (198)
                      |..|++.|..  ....+.|..||..|-
T Consensus         5 C~~C~~~F~~--~~rk~~Cr~Cg~~~C   29 (57)
T cd00065           5 CMGCGKPFTL--TRRRHHCRNCGRIFC   29 (57)
T ss_pred             CcccCccccC--CccccccCcCcCCcC
Confidence            4555555543  222445555555543


No 185
>PF14599 zinc_ribbon_6:  Zinc-ribbon; PDB: 2K2D_A.
Probab=35.44  E-value=16  Score=21.66  Aligned_cols=26  Identities=23%  Similarity=0.444  Sum_probs=12.0

Q ss_pred             cccCcccchhhcccCCCceecCcccc
Q psy11761         26 YKCHQCQRLIFLSANAGVHKCEYCHK   51 (198)
Q Consensus        26 ~~C~~C~~~f~~~~~~~~~~C~~C~~   51 (198)
                      ..|..|+......-....++|..|+.
T Consensus        31 IlCNDC~~~s~v~fH~lg~KC~~C~S   56 (61)
T PF14599_consen   31 ILCNDCNAKSEVPFHFLGHKCSHCGS   56 (61)
T ss_dssp             EEESSS--EEEEE--TT----TTTS-
T ss_pred             EECCCCCCccceeeeHhhhcCCCCCC
Confidence            34888888766666666778888864


No 186
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=34.39  E-value=26  Score=23.49  Aligned_cols=31  Identities=16%  Similarity=0.434  Sum_probs=19.6

Q ss_pred             CCccccCcccchhhcccCCCceecCccccccCC
Q psy11761         23 DNAYKCHQCQRLIFLSANAGVHKCEYCHKVFDQ   55 (198)
Q Consensus        23 ~~~~~C~~C~~~f~~~~~~~~~~C~~C~~~f~~   55 (198)
                      .....||.|++..+--..  ...|-.|++...-
T Consensus        67 av~V~CP~C~K~TKmLGr--~D~CM~C~~pLTL   97 (114)
T PF11023_consen   67 AVQVECPNCGKQTKMLGR--VDACMHCKEPLTL   97 (114)
T ss_pred             ceeeECCCCCChHhhhch--hhccCcCCCcCcc
Confidence            355778888887644332  3478888775443


No 187
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=34.25  E-value=21  Score=24.02  Aligned_cols=10  Identities=30%  Similarity=0.890  Sum_probs=4.4

Q ss_pred             cccCcccchh
Q psy11761         26 YKCHQCQRLI   35 (198)
Q Consensus        26 ~~C~~C~~~f   35 (198)
                      ..|..||..|
T Consensus        71 ~~C~~Cg~~~   80 (114)
T PRK03681         71 CWCETCQQYV   80 (114)
T ss_pred             EEcccCCCee
Confidence            3444444433


No 188
>PF01485 IBR:  IBR domain;  InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a cysteine-rich (C6HC) zinc finger domain that is present in Triad1, and which is conserved in other proteins encoded by various eukaryotes. The C6HC consensus pattern is:  C-x(4)-C-x(14-30)-C-x(1-4)-C-x(4)-C-x(2)-C-x(4)-H-x(4)-C  The C6HC zinc finger motif is the fourth family member of the zinc-binding RING, LIM, and LAP/PHD fingers. Strikingly, in most of the proteins the C6HC domain is flanked by two RING finger structures IPR001841 from INTERPRO. The novel C6HC motif has been called DRIL (double RING finger linked). The strong conservation of the larger tripartite TRIAD (twoRING fingers and DRIL) structure indicates that the three subdomains are functionally linked and identifies a novel class of proteins []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CT7_A 1WD2_A 2JMO_A 1WIM_A.
Probab=33.73  E-value=29  Score=19.95  Aligned_cols=30  Identities=20%  Similarity=0.429  Sum_probs=14.8

Q ss_pred             ccCc--ccchhhcccCCCc--eecCccccccCCh
Q psy11761         27 KCHQ--CQRLIFLSANAGV--HKCEYCHKVFDQQ   56 (198)
Q Consensus        27 ~C~~--C~~~f~~~~~~~~--~~C~~C~~~f~~~   56 (198)
                      .|+.  |+..+........  ..|+.|+..|=..
T Consensus        20 ~Cp~~~C~~~~~~~~~~~~~~~~C~~C~~~fC~~   53 (64)
T PF01485_consen   20 WCPNPDCEYIIEKDDGCNSPIVTCPSCGTEFCFK   53 (64)
T ss_dssp             --TTSST---ECS-SSTTS--CCTTSCCSEECSS
T ss_pred             CCCCCCCcccEEecCCCCCCeeECCCCCCcCccc
Confidence            6765  7777666555444  6777777766544


No 189
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=33.43  E-value=19  Score=19.15  Aligned_cols=12  Identities=25%  Similarity=0.811  Sum_probs=9.3

Q ss_pred             CeeCCcchhhhc
Q psy11761        141 PYQCDRCSQFFG  152 (198)
Q Consensus       141 ~~~C~~C~k~f~  152 (198)
                      -|.|..|+..+.
T Consensus        28 fy~C~~C~~~w~   39 (40)
T smart00440       28 FYVCTKCGHRWR   39 (40)
T ss_pred             EEEeCCCCCEeC
Confidence            588999987664


No 190
>smart00778 Prim_Zn_Ribbon Zinc-binding domain of primase-helicase. This region represents the zinc binding domain. It is found in the N-terminal region of the bacteriophage P4 alpha protein, which is a multifunctional protein with origin recognition, helicase and primase activities.
Probab=33.08  E-value=36  Score=17.87  Aligned_cols=26  Identities=19%  Similarity=0.369  Sum_probs=14.9

Q ss_pred             cccCcccc--h--hhcccCCCceecCcccc
Q psy11761         26 YKCHQCQR--L--IFLSANAGVHKCEYCHK   51 (198)
Q Consensus        26 ~~C~~C~~--~--f~~~~~~~~~~C~~C~~   51 (198)
                      -+||.|+.  .  |..+.....|.|..|+.
T Consensus         4 ~pCP~CGG~DrFr~~d~~g~G~~~C~~Cg~   33 (37)
T smart00778        4 GPCPNCGGSDRFRFDDKDGRGTWFCSVCGA   33 (37)
T ss_pred             cCCCCCCCccccccccCCCCcCEEeCCCCC
Confidence            35788874  2  33333334677877754


No 191
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=32.91  E-value=31  Score=17.53  Aligned_cols=28  Identities=21%  Similarity=0.567  Sum_probs=13.4

Q ss_pred             cccCcccchhhcccCCCceecCcccccc
Q psy11761         26 YKCHQCQRLIFLSANAGVHKCEYCHKVF   53 (198)
Q Consensus        26 ~~C~~C~~~f~~~~~~~~~~C~~C~~~f   53 (198)
                      ..|..|+..-.-.+....+.|..|+..|
T Consensus         4 ~~C~~C~~~~i~~~~~~~~~C~~Cg~~~   31 (33)
T PF08792_consen    4 KKCSKCGGNGIVNKEDDYEVCIFCGSSF   31 (33)
T ss_pred             eEcCCCCCCeEEEecCCeEEcccCCcEe
Confidence            3455555433222333345666666554


No 192
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=32.85  E-value=14  Score=20.58  Aligned_cols=17  Identities=24%  Similarity=0.374  Sum_probs=13.6

Q ss_pred             eeCCcchhhhcChhHHH
Q psy11761        142 YQCDRCSQFFGDRMNLI  158 (198)
Q Consensus       142 ~~C~~C~k~f~~~~~L~  158 (198)
                      -.|++|++.|+.+..+.
T Consensus        13 KICpvCqRPFsWRkKW~   29 (54)
T COG4338          13 KICPVCQRPFSWRKKWA   29 (54)
T ss_pred             hhhhhhcCchHHHHHHH
Confidence            37999999998876554


No 193
>PF13005 zf-IS66:  zinc-finger binding domain of transposase IS66 ;  InterPro: IPR024474 This entry represents a predicted helix-turn-helix domain from insertion element IS66 transposases [].
Probab=32.81  E-value=29  Score=18.81  Aligned_cols=10  Identities=20%  Similarity=0.571  Sum_probs=5.3

Q ss_pred             ccCcccchhh
Q psy11761         27 KCHQCQRLIF   36 (198)
Q Consensus        27 ~C~~C~~~f~   36 (198)
                      .|+.||..+.
T Consensus         4 ~C~~Cg~~l~   13 (47)
T PF13005_consen    4 ACPDCGGELK   13 (47)
T ss_pred             cCCCCCceee
Confidence            4555665443


No 194
>COG3880 Modulator of heat shock repressor CtsR, McsA [Signal transduction    mechanisms]
Probab=32.79  E-value=8.3  Score=27.75  Aligned_cols=32  Identities=28%  Similarity=0.600  Sum_probs=25.8

Q ss_pred             ccccCcccchhhcccCCCceecCccccccCCh
Q psy11761         25 AYKCHQCQRLIFLSANAGVHKCEYCHKVFDQQ   56 (198)
Q Consensus        25 ~~~C~~C~~~f~~~~~~~~~~C~~C~~~f~~~   56 (198)
                      .-.|+.|++.|..-...+.+-|..|.+.|...
T Consensus        74 ~l~C~~C~~Tfk~f~~~g~fGCaeCY~tf~~~  105 (176)
T COG3880          74 LLGCHNCGMTFKEFIQSGLFGCAECYKTFESQ  105 (176)
T ss_pred             HhcCccccccHHHHHHhcccchHHHHHHHHHH
Confidence            45689999998887777788899998888664


No 195
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=32.37  E-value=20  Score=24.18  Aligned_cols=12  Identities=25%  Similarity=0.855  Sum_probs=9.5

Q ss_pred             ccCCcCchhhhc
Q psy11761        100 FKCTTCDKSFVN  111 (198)
Q Consensus       100 ~~C~~C~~~f~~  111 (198)
                      +.|..||..|..
T Consensus        72 ~~C~~Cg~~~~~   83 (117)
T PRK00564         72 LECKDCSHVFKP   83 (117)
T ss_pred             EEhhhCCCcccc
Confidence            789999977764


No 196
>TIGR00143 hypF [NiFe] hydrogenase maturation protein HypF. A previously described regulatory effect of HypF mutatation is attributable to loss of activity of a regulatory hydrogenase. A zinc finger-like region CXXCX(18)CXXCX(24)CXXCX(18)CXXC region further supported the regulatory hypothesis. However, more recent work (PUBMED:11375153) shows the direct effect is on the activity of expressed hydrogenases with nickel/iron centers, rather than on expression.
Probab=32.10  E-value=16  Score=32.81  Aligned_cols=78  Identities=17%  Similarity=0.422  Sum_probs=51.1

Q ss_pred             cccCcccchhhcccCCC---ce-ecCccccccCChhHHhhcccCCCCCCCccCccchhcccCchhHHHhhhhcCCCCccc
Q psy11761         26 YKCHQCQRLIFLSANAG---VH-KCEYCHKVFDQQSSLLSHNCPQMKPRPYKCDTCEKSFTNSQNLNTHQLIHSGIRPFK  101 (198)
Q Consensus        26 ~~C~~C~~~f~~~~~~~---~~-~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~  101 (198)
                      -.|+.|=+.+....+.+   || .|..||-.|.-...|-.-...-....--.|+.|.+.+.+..+    .+.|.  .+-.
T Consensus        69 a~C~~Cl~E~~dp~~Rry~YpF~nCt~CGPr~~i~~~lpydr~~t~m~~f~~C~~C~~ey~~p~~----rr~h~--~~~~  142 (711)
T TIGR00143        69 ATCSDCLEEMLDKNDRRYLYPFISCTHCGPRFTIIEALPYDRENTSMADFPLCPDCAKEYKDPLD----RRFHA--QPIA  142 (711)
T ss_pred             hhHHHHHHHhcCCCcccccCCcccccCCCCCeEEeecCCCCCCCcCCCCCcCCHHHHHHhcCCcc----ccCCC--CCcc
Confidence            56888888887766655   44 599999988776665544432233344579999877765533    34444  3568


Q ss_pred             CCcCchhh
Q psy11761        102 CTTCDKSF  109 (198)
Q Consensus       102 C~~C~~~f  109 (198)
                      |+.||-..
T Consensus       143 C~~Cgp~l  150 (711)
T TIGR00143       143 CPRCGPQL  150 (711)
T ss_pred             CCCCCcEE
Confidence            99998553


No 197
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=32.08  E-value=27  Score=24.21  Aligned_cols=11  Identities=36%  Similarity=0.920  Sum_probs=6.1

Q ss_pred             cCCcCchhhhc
Q psy11761        101 KCTTCDKSFVN  111 (198)
Q Consensus       101 ~C~~C~~~f~~  111 (198)
                      +||.|..+|.+
T Consensus       123 vCPvCkTSFKs  133 (140)
T PF05290_consen  123 VCPVCKTSFKS  133 (140)
T ss_pred             CCCcccccccc
Confidence            55555555544


No 198
>KOG3408|consensus
Probab=32.03  E-value=34  Score=23.26  Aligned_cols=28  Identities=25%  Similarity=0.427  Sum_probs=24.3

Q ss_pred             cCCCCeeCCcchhhhcChhHHHhhhhhh
Q psy11761        137 HFPKPYQCDRCSQFFGDRMNLISHHCHK  164 (198)
Q Consensus       137 ~~~~~~~C~~C~k~f~~~~~L~~H~~~~  164 (198)
                      +|...|-|-.|.+-|.+...|..|.++.
T Consensus        53 PG~GqfyCi~CaRyFi~~~~l~~H~ktK   80 (129)
T KOG3408|consen   53 PGGGQFYCIECARYFIDAKALKTHFKTK   80 (129)
T ss_pred             CCCceeehhhhhhhhcchHHHHHHHhcc
Confidence            3667899999999999999999998644


No 199
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=31.90  E-value=11  Score=19.90  Aligned_cols=11  Identities=27%  Similarity=0.745  Sum_probs=8.7

Q ss_pred             CeeCCcchhhh
Q psy11761        141 PYQCDRCSQFF  151 (198)
Q Consensus       141 ~~~C~~C~k~f  151 (198)
                      -|.|..|++.|
T Consensus        28 fy~C~~C~~~w   38 (39)
T PF01096_consen   28 FYVCCNCGHRW   38 (39)
T ss_dssp             EEEESSSTEEE
T ss_pred             EEEeCCCCCee
Confidence            57898898765


No 200
>KOG2593|consensus
Probab=31.79  E-value=19  Score=30.02  Aligned_cols=31  Identities=26%  Similarity=0.524  Sum_probs=18.2

Q ss_pred             CCccccCcccchhhcccCC-------CceecCcccccc
Q psy11761         23 DNAYKCHQCQRLIFLSANA-------GVHKCEYCHKVF   53 (198)
Q Consensus        23 ~~~~~C~~C~~~f~~~~~~-------~~~~C~~C~~~f   53 (198)
                      ...|.||.|.+.|..-..+       ..|.|..|+...
T Consensus       126 ~~~Y~Cp~C~kkyt~Lea~~L~~~~~~~F~C~~C~gel  163 (436)
T KOG2593|consen  126 VAGYVCPNCQKKYTSLEALQLLDNETGEFHCENCGGEL  163 (436)
T ss_pred             cccccCCccccchhhhHHHHhhcccCceEEEecCCCch
Confidence            3457777777776543222       256777776543


No 201
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=31.24  E-value=29  Score=17.03  Aligned_cols=22  Identities=27%  Similarity=0.537  Sum_probs=11.2

Q ss_pred             cccCcccchhhcccCCCceecCccc
Q psy11761         26 YKCHQCQRLIFLSANAGVHKCEYCH   50 (198)
Q Consensus        26 ~~C~~C~~~f~~~~~~~~~~C~~C~   50 (198)
                      |+|..|++......   .|.|..|.
T Consensus         1 ~~C~~C~~~~~~~~---~Y~C~~c~   22 (30)
T PF03107_consen    1 FWCDVCRRKIDGFY---FYHCSECC   22 (30)
T ss_pred             CCCCCCCCCcCCCE---eEEeCCCC
Confidence            34566665443322   56666655


No 202
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=31.19  E-value=21  Score=25.27  Aligned_cols=36  Identities=19%  Similarity=0.739  Sum_probs=24.5

Q ss_pred             CCCcccCCcCchhhhcccCCCcccCCCcCcccccccccccccCCCCeeCCcchhh
Q psy11761         96 GIRPFKCTTCDKSFVNQINPTSTHTPTYTKSNLAQHSCMNSHFPKPYQCDRCSQF  150 (198)
Q Consensus        96 ~~k~~~C~~C~~~f~~~~~~~~~~~~~~~~~~l~~H~~~~~~~~~~~~C~~C~k~  150 (198)
                      ..-+|.|. |+..|.+                ..+|..... |+ .|.|..|+-.
T Consensus       114 ~~~~Y~C~-C~q~~l~----------------~RRhn~~~~-g~-~YrC~~C~gk  149 (156)
T COG3091         114 TTYPYRCQ-CQQHYLR----------------IRRHNTVRR-GE-VYRCGKCGGK  149 (156)
T ss_pred             cceeEEee-cCCccch----------------hhhcccccc-cc-eEEeccCCce
Confidence            34579999 9988765                234554444 45 8999999754


No 203
>KOG2785|consensus
Probab=31.06  E-value=33  Score=28.14  Aligned_cols=51  Identities=18%  Similarity=0.338  Sum_probs=42.6

Q ss_pred             ceecCccccccCChhHHhhcccCCCCC-----------------------CCccCccch---hcccCchhHHHhhhh
Q psy11761         43 VHKCEYCHKVFDQQSSLLSHNCPQMKP-----------------------RPYKCDTCE---KSFTNSQNLNTHQLI   93 (198)
Q Consensus        43 ~~~C~~C~~~f~~~~~l~~H~~~h~~~-----------------------~~~~C~~C~---~~f~~~~~l~~H~~~   93 (198)
                      |=-|-.|+..+.....-..||..+|+-                       ..+.|..|+   +.|.+......||..
T Consensus       166 Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  166 PTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             CcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            456889999999998899999998872                       337888888   899999999999874


No 204
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=30.20  E-value=27  Score=24.48  Aligned_cols=31  Identities=26%  Similarity=0.790  Sum_probs=15.4

Q ss_pred             ceecCccccccCChhHHhhcccCCCCCCCccCccchhcc
Q psy11761         43 VHKCEYCHKVFDQQSSLLSHNCPQMKPRPYKCDTCEKSF   81 (198)
Q Consensus        43 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f   81 (198)
                      .|.|..|+..+..      +.+.  ....|.|..|+..+
T Consensus       123 ~~~C~~C~~~~~r------~~~~--~~~~~~C~~C~~~l  153 (157)
T PF10263_consen  123 VYRCPSCGREYKR------HRRS--KRKRYRCGRCGGPL  153 (157)
T ss_pred             EEEcCCCCCEeee------eccc--chhhEECCCCCCEE
Confidence            4566666655422      2222  22336666666544


No 205
>KOG4167|consensus
Probab=29.49  E-value=12  Score=33.25  Aligned_cols=26  Identities=27%  Similarity=0.531  Sum_probs=23.3

Q ss_pred             CccCccchhcccCchhHHHhhhhcCC
Q psy11761         71 PYKCDTCEKSFTNSQNLNTHQLIHSG   96 (198)
Q Consensus        71 ~~~C~~C~~~f~~~~~l~~H~~~h~~   96 (198)
                      -|.|.+|++.|.-..++..||++|.-
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHHH
Confidence            38999999999999999999999863


No 206
>PF08273 Prim_Zn_Ribbon:  Zinc-binding domain of primase-helicase;  InterPro: IPR013237 This entry is represented by bacteriophage T7 Gp4. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry represents a zinc binding domain found in the N-terminal region of the bacteriophage T7 Gp4 and P4 alpha protein. P4 is a multifunctional protein with origin recognition, helicase and primase activities [, , ].; GO: 0003896 DNA primase activity, 0004386 helicase activity, 0008270 zinc ion binding; PDB: 1NUI_B.
Probab=29.38  E-value=31  Score=18.48  Aligned_cols=25  Identities=20%  Similarity=0.367  Sum_probs=11.3

Q ss_pred             cccCcccch-----hhcccCCCceecCccc
Q psy11761         26 YKCHQCQRL-----IFLSANAGVHKCEYCH   50 (198)
Q Consensus        26 ~~C~~C~~~-----f~~~~~~~~~~C~~C~   50 (198)
                      -+||.|+-.     |..+.....|.|..|+
T Consensus         4 ~pCP~CGG~DrFri~~d~~~~G~~~C~~C~   33 (40)
T PF08273_consen    4 GPCPICGGKDRFRIFDDKDGRGTWICRQCG   33 (40)
T ss_dssp             E--TTTT-TTTEEEETT----S-EEETTTT
T ss_pred             CCCCCCcCccccccCcCcccCCCEECCCCC
Confidence            368888842     4444444578888883


No 207
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=28.31  E-value=19  Score=19.44  Aligned_cols=15  Identities=27%  Similarity=0.866  Sum_probs=10.0

Q ss_pred             CCeeCCcchhhhcCh
Q psy11761        140 KPYQCDRCSQFFGDR  154 (198)
Q Consensus       140 ~~~~C~~C~k~f~~~  154 (198)
                      -++.|+.|++.|-..
T Consensus        12 ~~~~C~~C~~~FC~~   26 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLK   26 (43)
T ss_dssp             SHEE-TTTS-EE-TT
T ss_pred             CCeECCCCCcccCcc
Confidence            589999999999654


No 208
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=28.28  E-value=37  Score=17.98  Aligned_cols=14  Identities=21%  Similarity=0.351  Sum_probs=9.1

Q ss_pred             CCCCeeCCcchhhh
Q psy11761        138 FPKPYQCDRCSQFF  151 (198)
Q Consensus       138 ~~~~~~C~~C~k~f  151 (198)
                      +.+.+.|.+|+...
T Consensus        21 ~~~~w~C~~C~~~N   34 (40)
T PF04810_consen   21 GGKTWICNFCGTKN   34 (40)
T ss_dssp             TTTEEEETTT--EE
T ss_pred             CCCEEECcCCCCcC
Confidence            45789999998653


No 210
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=28.24  E-value=31  Score=29.26  Aligned_cols=25  Identities=24%  Similarity=0.485  Sum_probs=19.0

Q ss_pred             CccccCcccchhhcccCCCceecCccccc
Q psy11761         24 NAYKCHQCQRLIFLSANAGVHKCEYCHKV   52 (198)
Q Consensus        24 ~~~~C~~C~~~f~~~~~~~~~~C~~C~~~   52 (198)
                      ..|.|..||......    .++|+.|+..
T Consensus         6 ~~y~C~~Cg~~~~~~----~g~Cp~C~~w   30 (454)
T TIGR00416         6 SKFVCQHCGADSPKW----QGKCPACHAW   30 (454)
T ss_pred             CeEECCcCCCCCccc----cEECcCCCCc
Confidence            369999999865443    4789999774


No 211
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=27.98  E-value=18  Score=28.60  Aligned_cols=10  Identities=20%  Similarity=0.421  Sum_probs=4.7

Q ss_pred             ccCCcCchhh
Q psy11761        100 FKCTTCDKSF  109 (198)
Q Consensus       100 ~~C~~C~~~f  109 (198)
                      -.|++||..-
T Consensus       173 g~CPvCGs~P  182 (290)
T PF04216_consen  173 GYCPVCGSPP  182 (290)
T ss_dssp             SS-TTT---E
T ss_pred             CcCCCCCCcC
Confidence            4899999663


No 212
>PF09297 zf-NADH-PPase:  NADH pyrophosphatase zinc ribbon domain;  InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains.; GO: 0016787 hydrolase activity, 0046872 metal ion binding; PDB: 1VK6_A 2GB5_A.
Probab=27.96  E-value=37  Score=16.86  Aligned_cols=24  Identities=17%  Similarity=0.480  Sum_probs=8.1

Q ss_pred             cCcccchhhcccCCCceecCcccc
Q psy11761         28 CHQCQRLIFLSANAGVHKCEYCHK   51 (198)
Q Consensus        28 C~~C~~~f~~~~~~~~~~C~~C~~   51 (198)
                      |+.||...........-.|+.|+.
T Consensus         6 C~~CG~~t~~~~~g~~r~C~~Cg~   29 (32)
T PF09297_consen    6 CGRCGAPTKPAPGGWARRCPSCGH   29 (32)
T ss_dssp             -TTT--BEEE-SSSS-EEESSSS-
T ss_pred             cCcCCccccCCCCcCEeECCCCcC
Confidence            445554433333333345555543


No 213
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=27.83  E-value=22  Score=20.18  Aligned_cols=12  Identities=17%  Similarity=0.584  Sum_probs=6.7

Q ss_pred             eCCcchhhhcCh
Q psy11761        143 QCDRCSQFFGDR  154 (198)
Q Consensus       143 ~C~~C~k~f~~~  154 (198)
                      .||+|++.|...
T Consensus        22 ~CPlC~r~l~~e   33 (54)
T PF04423_consen   22 CCPLCGRPLDEE   33 (54)
T ss_dssp             E-TTT--EE-HH
T ss_pred             cCCCCCCCCCHH
Confidence            999999999753


No 214
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=27.76  E-value=38  Score=22.07  Aligned_cols=26  Identities=27%  Similarity=0.593  Sum_probs=18.4

Q ss_pred             cCcccchhhcccCCCceecCccccccCC
Q psy11761         28 CHQCQRLIFLSANAGVHKCEYCHKVFDQ   55 (198)
Q Consensus        28 C~~C~~~f~~~~~~~~~~C~~C~~~f~~   55 (198)
                      |+.||..+....  ..+.|+.|+..+..
T Consensus         3 C~~Cg~~l~~~~--~~~~C~~C~~~~~~   28 (104)
T TIGR01384         3 CPKCGSLMTPKN--GVYVCPSCGYEKEK   28 (104)
T ss_pred             CcccCcccccCC--CeEECcCCCCcccc
Confidence            788888775443  36889889876554


No 215
>PF03119 DNA_ligase_ZBD:  NAD-dependent DNA ligase C4 zinc finger domain;  InterPro: IPR004149 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in NAD-dependent DNA ligases. DNA ligases catalyse the crucial step of joining the breaks in duplex DNA during DNA replication, repair and recombination, utilizing either ATP or NAD(+) as a cofactor []. This domain is a small zinc binding motif that is presumably DNA binding. It is found only in NAD-dependent DNA ligases. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003911 DNA ligase (NAD+) activity, 0006260 DNA replication, 0006281 DNA repair; PDB: 1DGS_A 1V9P_B 2OWO_A.
Probab=27.74  E-value=32  Score=16.72  Aligned_cols=19  Identities=16%  Similarity=0.426  Sum_probs=7.7

Q ss_pred             cCcccchhhcccCCCceec
Q psy11761         28 CHQCQRLIFLSANAGVHKC   46 (198)
Q Consensus        28 C~~C~~~f~~~~~~~~~~C   46 (198)
                      ||.||...........+.|
T Consensus         2 CP~C~s~l~~~~~ev~~~C   20 (28)
T PF03119_consen    2 CPVCGSKLVREEGEVDIRC   20 (28)
T ss_dssp             -TTT--BEEE-CCTTCEEE
T ss_pred             cCCCCCEeEcCCCCEeEEC
Confidence            6667665554444444444


No 216
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=27.19  E-value=20  Score=17.57  Aligned_cols=11  Identities=45%  Similarity=1.144  Sum_probs=8.8

Q ss_pred             ccCCcCchhhh
Q psy11761        100 FKCTTCDKSFV  110 (198)
Q Consensus       100 ~~C~~C~~~f~  110 (198)
                      |.|-.|++.|.
T Consensus         1 ~sCiDC~~~F~   11 (28)
T PF08790_consen    1 FSCIDCSKDFD   11 (28)
T ss_dssp             EEETTTTEEEE
T ss_pred             CeeecCCCCcC
Confidence            46888999995


No 217
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=26.87  E-value=26  Score=18.67  Aligned_cols=8  Identities=25%  Similarity=0.708  Sum_probs=3.5

Q ss_pred             ecCccccc
Q psy11761         45 KCEYCHKV   52 (198)
Q Consensus        45 ~C~~C~~~   52 (198)
                      .|+.||+.
T Consensus        34 ~C~~CGE~   41 (46)
T TIGR03831        34 VCPQCGEE   41 (46)
T ss_pred             ccccCCCE
Confidence            34444443


No 218
>PRK11823 DNA repair protein RadA; Provisional
Probab=26.76  E-value=38  Score=28.64  Aligned_cols=26  Identities=23%  Similarity=0.494  Sum_probs=19.3

Q ss_pred             CCccccCcccchhhcccCCCceecCccccc
Q psy11761         23 DNAYKCHQCQRLIFLSANAGVHKCEYCHKV   52 (198)
Q Consensus        23 ~~~~~C~~C~~~f~~~~~~~~~~C~~C~~~   52 (198)
                      ...|.|..||......    .++|+.|+..
T Consensus         5 ~~~y~C~~Cg~~~~~~----~g~Cp~C~~w   30 (446)
T PRK11823          5 KTAYVCQECGAESPKW----LGRCPECGAW   30 (446)
T ss_pred             CCeEECCcCCCCCccc----CeeCcCCCCc
Confidence            3469999999865443    4789999774


No 219
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=26.62  E-value=42  Score=18.08  Aligned_cols=9  Identities=22%  Similarity=0.807  Sum_probs=5.1

Q ss_pred             ccccCcccc
Q psy11761         25 AYKCHQCQR   33 (198)
Q Consensus        25 ~~~C~~C~~   33 (198)
                      |..|+.||.
T Consensus         2 ~~~Cp~Cg~   10 (47)
T PF14690_consen    2 PPRCPHCGS   10 (47)
T ss_pred             CccCCCcCC
Confidence            445666663


No 220
>PF02150 RNA_POL_M_15KD:  RNA polymerases M/15 Kd subunit;  InterPro: IPR001529 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. In archaebacteria, there is generally a single form of RNA polymerase which also consist of an oligomeric assemblage of 10 to 13 polypeptides. It has recently been shown [], [] that small subunits of about 15 kDa, found in polymerase types I and II, are highly conserved. These proteins contain a probable zinc finger in their N-terminal region and a C-terminal zinc ribbon domain (see IPR001222 from INTERPRO).; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 3H0G_I 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I ....
Probab=26.57  E-value=23  Score=18.25  Aligned_cols=9  Identities=22%  Similarity=0.438  Sum_probs=4.3

Q ss_pred             ecCcccccc
Q psy11761         45 KCEYCHKVF   53 (198)
Q Consensus        45 ~C~~C~~~f   53 (198)
                      .|..|+..+
T Consensus        22 ~C~~C~Y~~   30 (35)
T PF02150_consen   22 ACRTCGYEE   30 (35)
T ss_dssp             EESSSS-EE
T ss_pred             CCCCCCCcc
Confidence            466665543


No 221
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=26.46  E-value=36  Score=16.59  Aligned_cols=8  Identities=25%  Similarity=0.895  Sum_probs=2.9

Q ss_pred             ceecCccc
Q psy11761         43 VHKCEYCH   50 (198)
Q Consensus        43 ~~~C~~C~   50 (198)
                      .|.|.+|+
T Consensus        15 ~Y~C~~Cd   22 (30)
T PF07649_consen   15 FYRCSECD   22 (30)
T ss_dssp             EEE-TTT-
T ss_pred             eEECccCC
Confidence            44555553


No 222
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=26.15  E-value=38  Score=27.59  Aligned_cols=25  Identities=16%  Similarity=0.424  Sum_probs=21.0

Q ss_pred             CCCCeeCCcch-hhhcChhHHHhhhh
Q psy11761        138 FPKPYQCDRCS-QFFGDRMNLISHHC  162 (198)
Q Consensus       138 ~~~~~~C~~C~-k~f~~~~~L~~H~~  162 (198)
                      -.+.|.|++|| +.+..+..+.+|..
T Consensus       371 Ld~ef~CEICgNyvy~GR~~FdrHF~  396 (470)
T COG5188         371 LDIEFECEICGNYVYYGRDRFDRHFE  396 (470)
T ss_pred             CCcceeeeecccccccchHHHHhhhh
Confidence            46789999999 88888888888863


No 223
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=25.65  E-value=26  Score=18.75  Aligned_cols=11  Identities=18%  Similarity=0.413  Sum_probs=7.2

Q ss_pred             ccccCcccchh
Q psy11761         25 AYKCHQCQRLI   35 (198)
Q Consensus        25 ~~~C~~C~~~f   35 (198)
                      +-.|++|+..|
T Consensus        29 ~~~CpYCg~~y   39 (40)
T PF10276_consen   29 PVVCPYCGTRY   39 (40)
T ss_dssp             EEEETTTTEEE
T ss_pred             eEECCCCCCEE
Confidence            56677777654


No 224
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=25.23  E-value=44  Score=23.33  Aligned_cols=32  Identities=16%  Similarity=0.475  Sum_probs=19.5

Q ss_pred             ceecCccccccCChhHHhhcccCCCCCCCccCccchhcc
Q psy11761         43 VHKCEYCHKVFDQQSSLLSHNCPQMKPRPYKCDTCEKSF   81 (198)
Q Consensus        43 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f   81 (198)
                      .|.|..|+..+..      +. .+.....|.|..|+..+
T Consensus       112 ~y~C~~C~~~~~~------~r-r~~~~~~y~C~~C~g~l  143 (146)
T smart00731      112 PYRCTGCGQRYLR------VR-RSNNVSRYRCGKCGGKL  143 (146)
T ss_pred             EEECCCCCCCCce------Ec-cccCcceEEcCCCCCEE
Confidence            6788888876532      21 12222568888887665


No 225
>KOG0782|consensus
Probab=25.03  E-value=22  Score=30.94  Aligned_cols=47  Identities=15%  Similarity=0.359  Sum_probs=32.6

Q ss_pred             cceeeeechhhhhhhCCCCccccCcccchhhcccCCC-----ceecCccccccCChh
Q psy11761          6 PNLVLFSQQTLLCIHGNDNAYKCHQCQRLIFLSANAG-----VHKCEYCHKVFDQQS   57 (198)
Q Consensus         6 ~~l~~~~~~~h~~~h~~~~~~~C~~C~~~f~~~~~~~-----~~~C~~C~~~f~~~~   57 (198)
                      +.|+     .|-=+|-.-.-.+|..||+.|.++..+.     ...|.+|.+.|-.+-
T Consensus       239 ~~fv-----rHHWVHrrRqeGkC~~CgKgFQQKf~FhsKEivAisCSWCKqayH~Kv  290 (1004)
T KOG0782|consen  239 SGFV-----RHHWVHRRRQEGKCNTCGKGFQQKFFFHSKEIVAISCSWCKQAYHLKV  290 (1004)
T ss_pred             ccch-----HHhHhhHhhhccccchhhhhhhhheeeccccEEEEEehHHHHHhhcch
Confidence            4566     6766666555668999999987764432     457888888776553


No 226
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=24.89  E-value=30  Score=30.92  Aligned_cols=46  Identities=17%  Similarity=0.517  Sum_probs=31.5

Q ss_pred             cCcccchhhcccCC---------Cce-ecCccccccCChhHHhhcccCCCCCCCccCccchh
Q psy11761         28 CHQCQRLIFLSANA---------GVH-KCEYCHKVFDQQSSLLSHNCPQMKPRPYKCDTCEK   79 (198)
Q Consensus        28 C~~C~~~f~~~~~~---------~~~-~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~   79 (198)
                      |..||-.|.-...+         ..| .|+.|.+.+.....    ++-|.  .|..|+.||=
T Consensus       126 CT~CGPRfTIi~alPYDR~nTsM~~F~lC~~C~~EY~dP~n----RRfHA--Qp~aCp~CGP  181 (750)
T COG0068         126 CTNCGPRFTIIEALPYDRENTSMADFPLCPFCDKEYKDPLN----RRFHA--QPIACPKCGP  181 (750)
T ss_pred             cCCCCcceeeeccCCCCcccCccccCcCCHHHHHHhcCccc----ccccc--ccccCcccCC
Confidence            99999988764433         123 59999888877665    23333  5778999984


No 227
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=24.66  E-value=41  Score=23.24  Aligned_cols=26  Identities=23%  Similarity=0.487  Sum_probs=16.9

Q ss_pred             cccCcccchhhcccCCCceecCcccccc
Q psy11761         26 YKCHQCQRLIFLSANAGVHKCEYCHKVF   53 (198)
Q Consensus        26 ~~C~~C~~~f~~~~~~~~~~C~~C~~~f   53 (198)
                      +.|+.||.....  .-+.--|+.|+..+
T Consensus        29 ~hCp~Cg~PLF~--KdG~v~CPvC~~~~   54 (131)
T COG1645          29 KHCPKCGTPLFR--KDGEVFCPVCGYRE   54 (131)
T ss_pred             hhCcccCCccee--eCCeEECCCCCceE
Confidence            678888876555  23345688888533


No 228
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=24.53  E-value=34  Score=23.34  Aligned_cols=12  Identities=17%  Similarity=0.069  Sum_probs=6.7

Q ss_pred             ceecCccccccCC
Q psy11761         43 VHKCEYCHKVFDQ   55 (198)
Q Consensus        43 ~~~C~~C~~~f~~   55 (198)
                      ...| .|+..|..
T Consensus        70 ~~~C-~Cg~~~~~   81 (124)
T PRK00762         70 EIEC-ECGYEGVV   81 (124)
T ss_pred             eEEe-eCcCcccc
Confidence            3466 66655543


No 229
>COG1779 C4-type Zn-finger protein [General function prediction only]
Probab=24.39  E-value=33  Score=25.50  Aligned_cols=10  Identities=20%  Similarity=0.571  Sum_probs=5.5

Q ss_pred             ccCcccchhh
Q psy11761         27 KCHQCQRLIF   36 (198)
Q Consensus        27 ~C~~C~~~f~   36 (198)
                      .||.||..+.
T Consensus        16 ~CPvCg~~l~   25 (201)
T COG1779          16 DCPVCGGTLK   25 (201)
T ss_pred             cCCcccceee
Confidence            4666665443


No 230
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=24.35  E-value=48  Score=22.82  Aligned_cols=17  Identities=24%  Similarity=0.563  Sum_probs=13.8

Q ss_pred             CCCCeeCCcchhhhcCh
Q psy11761        138 FPKPYQCDRCSQFFGDR  154 (198)
Q Consensus       138 ~~~~~~C~~C~k~f~~~  154 (198)
                      +...|.|..|++.|...
T Consensus        50 ~~qRyrC~~C~~tf~~~   66 (129)
T COG3677          50 GHQRYKCKSCGSTFTVE   66 (129)
T ss_pred             cccccccCCcCcceeee
Confidence            35679999999999754


No 231
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=24.08  E-value=43  Score=27.62  Aligned_cols=23  Identities=26%  Similarity=0.569  Sum_probs=16.7

Q ss_pred             cccCcccchhhcccCCCceecCccccc
Q psy11761         26 YKCHQCQRLIFLSANAGVHKCEYCHKV   52 (198)
Q Consensus        26 ~~C~~C~~~f~~~~~~~~~~C~~C~~~   52 (198)
                      |.|..||......    .++|+.|+..
T Consensus         1 ~~c~~cg~~~~~~----~g~cp~c~~w   23 (372)
T cd01121           1 YVCSECGYVSPKW----LGKCPECGEW   23 (372)
T ss_pred             CCCCCCCCCCCCc----cEECcCCCCc
Confidence            6799999865433    3689999774


No 232
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=23.72  E-value=28  Score=21.52  Aligned_cols=12  Identities=33%  Similarity=0.952  Sum_probs=9.6

Q ss_pred             ccCCcCchhhhc
Q psy11761        100 FKCTTCDKSFVN  111 (198)
Q Consensus       100 ~~C~~C~~~f~~  111 (198)
                      |+|..|+..|.-
T Consensus        13 Y~c~~cg~~~dv   24 (82)
T COG2331          13 YECTECGNRFDV   24 (82)
T ss_pred             EeecccchHHHH
Confidence            789999988753


No 233
>PRK11827 hypothetical protein; Provisional
Probab=23.67  E-value=61  Score=19.10  Aligned_cols=11  Identities=18%  Similarity=0.335  Sum_probs=4.8

Q ss_pred             eecCccccccC
Q psy11761         44 HKCEYCHKVFD   54 (198)
Q Consensus        44 ~~C~~C~~~f~   54 (198)
                      ..|..|+..|.
T Consensus        27 Lic~~~~laYP   37 (60)
T PRK11827         27 LICKLDNLAFP   37 (60)
T ss_pred             EECCccCeecc
Confidence            34444444443


No 234
>PRK12286 rpmF 50S ribosomal protein L32; Reviewed
Probab=23.54  E-value=73  Score=18.50  Aligned_cols=22  Identities=18%  Similarity=0.464  Sum_probs=14.8

Q ss_pred             ccccCcccchhhcccCCCceecCcccc
Q psy11761         25 AYKCHQCQRLIFLSANAGVHKCEYCHK   51 (198)
Q Consensus        25 ~~~C~~C~~~f~~~~~~~~~~C~~C~~   51 (198)
                      ...|+.||..     .+....|..||.
T Consensus        27 l~~C~~CG~~-----~~~H~vC~~CG~   48 (57)
T PRK12286         27 LVECPNCGEP-----KLPHRVCPSCGY   48 (57)
T ss_pred             ceECCCCCCc-----cCCeEECCCCCc
Confidence            4678888874     233567888874


No 235
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=23.19  E-value=47  Score=28.39  Aligned_cols=14  Identities=21%  Similarity=0.726  Sum_probs=9.2

Q ss_pred             ceecCccccccCCh
Q psy11761         43 VHKCEYCHKVFDQQ   56 (198)
Q Consensus        43 ~~~C~~C~~~f~~~   56 (198)
                      .|.|..|+..+...
T Consensus       425 ~~~c~~c~~~yd~~  438 (479)
T PRK05452        425 RMQCSVCQWIYDPA  438 (479)
T ss_pred             eEEECCCCeEECCC
Confidence            57777777666554


No 236
>PF12907 zf-met2:  Zinc-binding
Probab=23.02  E-value=67  Score=17.22  Aligned_cols=27  Identities=30%  Similarity=0.491  Sum_probs=19.5

Q ss_pred             eeCCcchhhhc---ChhHHHhhhhhhCCCC
Q psy11761        142 YQCDRCSQFFG---DRMNLISHHCHKHKQS  168 (198)
Q Consensus       142 ~~C~~C~k~f~---~~~~L~~H~~~~~~~~  168 (198)
                      +.|.+|-..|.   ....|..|....|...
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~enKHpK~   31 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAENKHPKN   31 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHccCCCC
Confidence            57999997774   4567999987555443


No 237
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=23.00  E-value=23  Score=25.24  Aligned_cols=18  Identities=22%  Similarity=0.591  Sum_probs=13.7

Q ss_pred             CCCCccCccchhcccCch
Q psy11761         68 KPRPYKCDTCEKSFTNSQ   85 (198)
Q Consensus        68 ~~~~~~C~~C~~~f~~~~   85 (198)
                      -+.|.-|..||+.|++..
T Consensus        65 ~~~PsYC~~CGkpyPWt~   82 (158)
T PF10083_consen   65 YEAPSYCHNCGKPYPWTE   82 (158)
T ss_pred             CCCChhHHhCCCCCchHH
Confidence            357888999998887753


No 238
>KOG1280|consensus
Probab=22.91  E-value=70  Score=26.03  Aligned_cols=38  Identities=21%  Similarity=0.474  Sum_probs=26.5

Q ss_pred             CCCccCccchhcccCchhHHHhhhhcCCCCc--ccCCcCc
Q psy11761         69 PRPYKCDTCEKSFTNSQNLNTHQLIHSGIRP--FKCTTCD  106 (198)
Q Consensus        69 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~--~~C~~C~  106 (198)
                      +..|.|+.|+..-.+...|..|....+.+-.  ..|++|+
T Consensus        77 ~qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   77 PQSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             cccccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            4468899998887778888888776554433  3556664


No 239
>PRK11032 hypothetical protein; Provisional
Probab=22.89  E-value=40  Score=24.21  Aligned_cols=37  Identities=14%  Similarity=0.324  Sum_probs=18.5

Q ss_pred             hhhhhCCCCc----cccCcccchhhcccCCCceecCccccc
Q psy11761         16 LLCIHGNDNA----YKCHQCQRLIFLSANAGVHKCEYCHKV   52 (198)
Q Consensus        16 h~~~h~~~~~----~~C~~C~~~f~~~~~~~~~~C~~C~~~   52 (198)
                      |-..|+|+..    ..|..||....-...-..-.|+.|+..
T Consensus       111 ~g~Y~sGEvvg~G~LvC~~Cg~~~~~~~p~~i~pCp~C~~~  151 (160)
T PRK11032        111 HGVYHSGEVVGLGNLVCEKCHHHLAFYTPEVLPLCPKCGHD  151 (160)
T ss_pred             cCeeecceeeecceEEecCCCCEEEecCCCcCCCCCCCCCC
Confidence            3345666643    557777754333222223356666543


No 240
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=22.85  E-value=30  Score=22.56  Aligned_cols=12  Identities=17%  Similarity=0.656  Sum_probs=5.8

Q ss_pred             ccccCcccchhh
Q psy11761         25 AYKCHQCQRLIF   36 (198)
Q Consensus        25 ~~~C~~C~~~f~   36 (198)
                      |+.|+.||..|+
T Consensus        79 ~~rC~eCG~~fk   90 (97)
T cd00924          79 PKRCPECGHVFK   90 (97)
T ss_pred             ceeCCCCCcEEE
Confidence            455555554443


No 241
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=22.67  E-value=29  Score=25.38  Aligned_cols=31  Identities=19%  Similarity=0.398  Sum_probs=14.7

Q ss_pred             CCCccccCcccchhhccc-CCCceecCccccc
Q psy11761         22 NDNAYKCHQCQRLIFLSA-NAGVHKCEYCHKV   52 (198)
Q Consensus        22 ~~~~~~C~~C~~~f~~~~-~~~~~~C~~C~~~   52 (198)
                      ....|.|+.|...+.-.. ....|.|+.||..
T Consensus       110 ~~~~y~C~~~~~r~sfdeA~~~~F~Cp~Cg~~  141 (176)
T COG1675         110 ENNYYVCPNCHVKYSFDEAMELGFTCPKCGED  141 (176)
T ss_pred             cCCceeCCCCCCcccHHHHHHhCCCCCCCCch
Confidence            334566666554433211 1123566666654


No 242
>KOG4118|consensus
Probab=22.56  E-value=54  Score=19.62  Aligned_cols=31  Identities=26%  Similarity=0.427  Sum_probs=25.7

Q ss_pred             CeeCCcchhhhcChhHHHhhhhhhCCCCCCC
Q psy11761        141 PYQCDRCSQFFGDRMNLISHHCHKHKQSCLP  171 (198)
Q Consensus       141 ~~~C~~C~k~f~~~~~L~~H~~~~~~~~~~~  171 (198)
                      -|+|.+|--.......+..|....|...|+|
T Consensus        38 ~~kCtVC~~~mpdpktfkqhfe~kHpk~~~P   68 (74)
T KOG4118|consen   38 HHKCTVCMVQMPDPKTFKQHFENKHPKEPLP   68 (74)
T ss_pred             HhhhHhhHhhCCCCchHHHHHhhcCCCCCCC
Confidence            4789999988888889999998888777665


No 243
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=22.42  E-value=61  Score=27.60  Aligned_cols=27  Identities=33%  Similarity=0.641  Sum_probs=23.3

Q ss_pred             CCeeCCcchhhhcChhHHHhhhhhhCC
Q psy11761        140 KPYQCDRCSQFFGDRMNLISHHCHKHK  166 (198)
Q Consensus       140 ~~~~C~~C~k~f~~~~~L~~H~~~~~~  166 (198)
                      +-+.|+.|.+.|.....+..|+..-|-
T Consensus        56 rFWiCp~CskkF~d~~~~~~H~~~eH~   82 (466)
T PF04780_consen   56 RFWICPRCSKKFSDAESCLSHMEQEHP   82 (466)
T ss_pred             eEeeCCcccceeCCHHHHHHHHHHhhh
Confidence            467999999999999999999985553


No 244
>PF14206 Cys_rich_CPCC:  Cysteine-rich CPCC
Probab=22.15  E-value=57  Score=20.34  Aligned_cols=9  Identities=33%  Similarity=0.884  Sum_probs=5.5

Q ss_pred             cccCcccch
Q psy11761         26 YKCHQCQRL   34 (198)
Q Consensus        26 ~~C~~C~~~   34 (198)
                      |+||-||..
T Consensus         2 ~~CPCCg~~   10 (78)
T PF14206_consen    2 YPCPCCGYY   10 (78)
T ss_pred             ccCCCCCcE
Confidence            456666654


No 245
>PRK04351 hypothetical protein; Provisional
Probab=21.93  E-value=54  Score=23.21  Aligned_cols=33  Identities=15%  Similarity=0.633  Sum_probs=22.3

Q ss_pred             ceecCccccccCChhHHhhcccCCCCCCCccCccchhcccC
Q psy11761         43 VHKCEYCHKVFDQQSSLLSHNCPQMKPRPYKCDTCEKSFTN   83 (198)
Q Consensus        43 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~   83 (198)
                      .|.|..|+..+....       . ++...|.|..|+..+..
T Consensus       112 ~Y~C~~Cg~~~~r~R-------r-~n~~~yrCg~C~g~L~~  144 (149)
T PRK04351        112 LYECQSCGQQYLRKR-------R-INTKRYRCGKCRGKLKL  144 (149)
T ss_pred             EEECCCCCCEeeeee-------e-cCCCcEEeCCCCcEeee
Confidence            588988987654321       1 23577999999877654


No 246
>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains). Some bind phorbol esters and diacylglycerol. Some bind RasGTP. Zinc-binding domains.
Probab=21.91  E-value=62  Score=17.20  Aligned_cols=25  Identities=28%  Similarity=0.663  Sum_probs=12.3

Q ss_pred             ccccCcccchhhcccCCCceecCcccc
Q psy11761         25 AYKCHQCQRLIFLSANAGVHKCEYCHK   51 (198)
Q Consensus        25 ~~~C~~C~~~f~~~~~~~~~~C~~C~~   51 (198)
                      +..|..|++.+....  ..++|..|+.
T Consensus        11 ~~~C~~C~~~i~~~~--~~~~C~~C~~   35 (49)
T smart00109       11 PTKCCVCRKSIWGSF--QGLRCSWCKV   35 (49)
T ss_pred             CCCccccccccCcCC--CCcCCCCCCc
Confidence            445666665543322  2455555543


No 247
>PRK08402 replication factor A; Reviewed
Probab=21.84  E-value=52  Score=27.00  Aligned_cols=26  Identities=15%  Similarity=0.363  Sum_probs=18.9

Q ss_pred             cccCcccchhhcccCCCceecCcccc
Q psy11761         26 YKCHQCQRLIFLSANAGVHKCEYCHK   51 (198)
Q Consensus        26 ~~C~~C~~~f~~~~~~~~~~C~~C~~   51 (198)
                      ..||.|++.+........|.|..|+.
T Consensus       213 ~aCp~CnKkv~~~~~~~~~~Ce~~~~  238 (355)
T PRK08402        213 DACPECRRKVDYDPATDTWICPEHGE  238 (355)
T ss_pred             ecCCCCCeEEEEecCCCCEeCCCCCC
Confidence            45888888776545556788888875


No 248
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=21.52  E-value=81  Score=16.80  Aligned_cols=24  Identities=13%  Similarity=0.296  Sum_probs=17.3

Q ss_pred             CeeCCcchhhhcC--hhHHHhhhhhh
Q psy11761        141 PYQCDRCSQFFGD--RMNLISHHCHK  164 (198)
Q Consensus       141 ~~~C~~C~k~f~~--~~~L~~H~~~~  164 (198)
                      ...|+.||-.|..  ...-..|.+.|
T Consensus        13 ~~~C~~CgM~Y~~~~~eD~~~H~~yH   38 (41)
T PF13878_consen   13 ATTCPTCGMLYSPGSPEDEKLHKKYH   38 (41)
T ss_pred             CcCCCCCCCEECCCCHHHHHHHHHHH
Confidence            4689999988875  44566676655


No 249
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=21.04  E-value=48  Score=19.57  Aligned_cols=38  Identities=24%  Similarity=0.652  Sum_probs=20.8

Q ss_pred             cCccchhc-ccCchhHHHhhhhcCCCCcccCCcCchhhh
Q psy11761         73 KCDTCEKS-FTNSQNLNTHQLIHSGIRPFKCTTCDKSFV  110 (198)
Q Consensus        73 ~C~~C~~~-f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~  110 (198)
                      .|.+|++. +-....+..-.....+...|.|+.|.....
T Consensus         4 kCiiCd~v~~iD~rt~~tKrLrN~PIrtymC~eC~~Rva   42 (68)
T COG4896           4 KCIICDRVDEIDNRTFKTKRLRNKPIRTYMCPECEHRVA   42 (68)
T ss_pred             eEEEecceeeecchhHHHHHhhCCCceeEechhhHhhhc
Confidence            45555542 223344444455566667777777765543


No 250
>PF10122 Mu-like_Com:  Mu-like prophage protein Com;  InterPro: IPR019294  Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ]. 
Probab=20.99  E-value=66  Score=18.25  Aligned_cols=27  Identities=22%  Similarity=0.646  Sum_probs=15.6

Q ss_pred             cccCcccchhhcccCCC--ceecCccccc
Q psy11761         26 YKCHQCQRLIFLSANAG--VHKCEYCHKV   52 (198)
Q Consensus        26 ~~C~~C~~~f~~~~~~~--~~~C~~C~~~   52 (198)
                      +.|..|++.........  ..+|+-|+..
T Consensus         5 iRC~~CnklLa~~g~~~~leIKCpRC~ti   33 (51)
T PF10122_consen    5 IRCGHCNKLLAKAGEVIELEIKCPRCKTI   33 (51)
T ss_pred             eeccchhHHHhhhcCccEEEEECCCCCcc
Confidence            56777777655532222  4567777653


No 251
>PRK05978 hypothetical protein; Provisional
Probab=20.91  E-value=58  Score=23.06  Aligned_cols=9  Identities=33%  Similarity=0.936  Sum_probs=4.1

Q ss_pred             ecCcccccc
Q psy11761         45 KCEYCHKVF   53 (198)
Q Consensus        45 ~C~~C~~~f   53 (198)
                      .|+.||..|
T Consensus        54 ~C~~CG~~~   62 (148)
T PRK05978         54 HCAACGEDF   62 (148)
T ss_pred             CccccCCcc
Confidence            344454443


No 252
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=20.78  E-value=55  Score=18.63  Aligned_cols=14  Identities=29%  Similarity=0.634  Sum_probs=7.5

Q ss_pred             hCCCCccccCcccc
Q psy11761         20 HGNDNAYKCHQCQR   33 (198)
Q Consensus        20 h~~~~~~~C~~C~~   33 (198)
                      ..++....|+.||+
T Consensus        41 ~~~~~i~~Cp~CgR   54 (56)
T PF02591_consen   41 RKGDEIVFCPNCGR   54 (56)
T ss_pred             HcCCCeEECcCCCc
Confidence            34445556666654


No 253
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=20.70  E-value=72  Score=21.04  Aligned_cols=11  Identities=27%  Similarity=0.902  Sum_probs=7.2

Q ss_pred             CcccCCcCchh
Q psy11761         98 RPFKCTTCDKS  108 (198)
Q Consensus        98 k~~~C~~C~~~  108 (198)
                      ||-.|+.||..
T Consensus         1 ~p~~CpYCg~~   11 (102)
T PF11672_consen    1 KPIICPYCGGP   11 (102)
T ss_pred             CCcccCCCCCe
Confidence            45678888744


No 254
>KOG3214|consensus
Probab=20.61  E-value=73  Score=20.86  Aligned_cols=18  Identities=17%  Similarity=0.340  Sum_probs=13.9

Q ss_pred             CCCCeeCCcchhhhcChh
Q psy11761        138 FPKPYQCDRCSQFFGDRM  155 (198)
Q Consensus       138 ~~~~~~C~~C~k~f~~~~  155 (198)
                      ......|.+|+.+|.+.-
T Consensus        44 ~iG~~sC~iC~esFqt~i   61 (109)
T KOG3214|consen   44 NIGKASCRICEESFQTTI   61 (109)
T ss_pred             Ccceeeeeehhhhhccch
Confidence            345678999999998753


No 255
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=20.41  E-value=34  Score=25.47  Aligned_cols=24  Identities=25%  Similarity=0.544  Sum_probs=0.0

Q ss_pred             CCCeeCCcch-hhhcChhHHHhhhh
Q psy11761        139 PKPYQCDRCS-QFFGDRMNLISHHC  162 (198)
Q Consensus       139 ~~~~~C~~C~-k~f~~~~~L~~H~~  162 (198)
                      ...|.|++|| .+|..+..+.+|..
T Consensus        99 ~~ey~CEICGN~~Y~GrkaFekHF~  123 (196)
T PF11931_consen   99 GVEYKCEICGNQSYKGRKAFEKHFQ  123 (196)
T ss_dssp             -------------------------
T ss_pred             CCeeeeEeCCCcceecHHHHHHhcC
Confidence            5789999997 56666778888863


No 256
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=20.39  E-value=61  Score=27.94  Aligned_cols=10  Identities=20%  Similarity=0.551  Sum_probs=6.7

Q ss_pred             ceecCccccc
Q psy11761         43 VHKCEYCHKV   52 (198)
Q Consensus        43 ~~~C~~C~~~   52 (198)
                      +..|+.|+..
T Consensus       253 ~~~Cp~C~s~  262 (505)
T TIGR00595       253 PKTCPQCGSE  262 (505)
T ss_pred             CCCCCCCCCC
Confidence            5677777653


No 257
>PF06044 DRP:  Dam-replacing family;  InterPro: IPR010324 Dam-replacing protein (DRP) is a restriction endonuclease that is flanked by pseudo-transposable small repeat elements. The replacement of Dam-methylase by DRP allows phase variation through slippage-like mechanisms in several pathogenic isolates of Neisseria meningitidis [].; PDB: 4ESJ_A.
Probab=20.23  E-value=46  Score=25.64  Aligned_cols=31  Identities=13%  Similarity=0.381  Sum_probs=11.4

Q ss_pred             cccCcccch----hhcccCCCceecCccccccCCh
Q psy11761         26 YKCHQCQRL----IFLSANAGVHKCEYCHKVFDQQ   56 (198)
Q Consensus        26 ~~C~~C~~~----f~~~~~~~~~~C~~C~~~f~~~   56 (198)
                      +-||.||..    |..-....-|.|..|++.|.-+
T Consensus        32 ~yCP~Cg~~~L~~f~NN~PVaDF~C~~C~eeyELK   66 (254)
T PF06044_consen   32 MYCPNCGSKPLSKFENNRPVADFYCPNCNEEYELK   66 (254)
T ss_dssp             ---TTT--SS-EE--------EEE-TTT--EEEEE
T ss_pred             CcCCCCCChhHhhccCCCccceeECCCCchHHhhh
Confidence            458999975    4444444568899998877544


No 258
>TIGR00340 zpr1_rel ZPR1-related zinc finger protein. A model ZPR1_znf (TIGR00310) has been created to describe the domain shared by this protein and ZPR1.
Probab=20.19  E-value=48  Score=23.89  Aligned_cols=12  Identities=25%  Similarity=0.332  Sum_probs=7.3

Q ss_pred             ceecCccccccC
Q psy11761         43 VHKCEYCHKVFD   54 (198)
Q Consensus        43 ~~~C~~C~~~f~   54 (198)
                      .+.|+.||....
T Consensus        28 sf~C~~CGyr~~   39 (163)
T TIGR00340        28 TYICEKCGYRST   39 (163)
T ss_pred             EEECCCCCCchh
Confidence            356777766543


No 259
>TIGR02159 PA_CoA_Oxy4 phenylacetate-CoA oxygenase, PaaJ subunit. Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation. Although the exact function of this enzyme has not been determined, it has been shown to be required for phenylacetic acid degradation and has been proposed to function in a multicomponent oxygenase acting on phenylacetate-CoA.
Probab=20.16  E-value=34  Score=24.15  Aligned_cols=30  Identities=20%  Similarity=0.552  Sum_probs=16.1

Q ss_pred             cccCcccchhhcccC-CC------ceecCccccccCC
Q psy11761         26 YKCHQCQRLIFLSAN-AG------VHKCEYCHKVFDQ   55 (198)
Q Consensus        26 ~~C~~C~~~f~~~~~-~~------~~~C~~C~~~f~~   55 (198)
                      ..||.||..-....+ ++      .|.|..|.+-|..
T Consensus       106 ~~cp~c~s~~t~~~s~fg~t~cka~~~c~~c~epf~~  142 (146)
T TIGR02159       106 VQCPRCGSADTTITSIFGPTACKALYRCRACKEPFEY  142 (146)
T ss_pred             CcCCCCCCCCcEeecCCCChhhHHHhhhhhhCCcHhh
Confidence            567777754333221 11      4667777666643


No 260
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=20.13  E-value=60  Score=16.10  Aligned_cols=7  Identities=43%  Similarity=1.478  Sum_probs=2.7

Q ss_pred             ccCccch
Q psy11761         72 YKCDTCE   78 (198)
Q Consensus        72 ~~C~~C~   78 (198)
                      |.|..|+
T Consensus        28 f~C~~C~   34 (39)
T smart00132       28 FKCSKCG   34 (39)
T ss_pred             CCCcccC
Confidence            3344333


No 261
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=20.04  E-value=46  Score=19.31  Aligned_cols=36  Identities=22%  Similarity=0.539  Sum_probs=17.2

Q ss_pred             cCccchhcccCch-hHHHhhhhcCCCCcccCCcCchh
Q psy11761         73 KCDTCEKSFTNSQ-NLNTHQLIHSGIRPFKCTTCDKS  108 (198)
Q Consensus        73 ~C~~C~~~f~~~~-~l~~H~~~h~~~k~~~C~~C~~~  108 (198)
                      .|..|++...-.. ++..-.....+...|.|+.|...
T Consensus         4 kC~lCdk~~~Id~~~~~aKrLrnrPi~tYmC~eC~~R   40 (56)
T PF09963_consen    4 KCILCDKKEEIDEDTPEAKRLRNRPIHTYMCDECKER   40 (56)
T ss_pred             EEEecCCEEEeccCCHHHHHhhcCCCcceeChhHHHH
Confidence            3555665544321 12222223345566777777644


No 262
>KOG3507|consensus
Probab=20.02  E-value=60  Score=19.01  Aligned_cols=9  Identities=33%  Similarity=0.781  Sum_probs=4.6

Q ss_pred             ceecCcccc
Q psy11761         43 VHKCEYCHK   51 (198)
Q Consensus        43 ~~~C~~C~~   51 (198)
                      +..|.+||.
T Consensus        37 ~irCReCG~   45 (62)
T KOG3507|consen   37 VIRCRECGY   45 (62)
T ss_pred             cEehhhcch
Confidence            445555544


Done!