Diaphorina citri psyllid: psy1176


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230--
NFDKLNVRTNHYTPLPFGKSPLQRTIQEYIRAGYVNLDKPSNPSSHEVVAWIKRILRCEKTGHSGTLDPKTSGCLIVCIDRATRLVKSQQSAGKEYISIFKLHSAVENVAKASKKKMMIKQGLLDKHGKPNENTPASYLAELEAAPNKKPTYMKSNLISSDVTLSTGIIWLKCQAGTYVRTYCVHMGLVLGVGAQMIELRRNRSGIQSEEDGLVTFRQEHMFEHIVSTWVLC
cccccccccccccccccccccccccHHHcccccEEEECcccccccHHHHHHHHHHHccccccccccccccccCEcccEEccccccccHHHccccEEEEEEEEccccccccccccHHHHHHHHHHHcccccccccccccEEEEccccccccEEEEEEEEEEcccccEEEEEEEEcccHHHHHHHHHHHHHcccccEEcccEEEECccccccccHHHHHHHHHHHHHHHHHccc
NFDKLNVRTNHYTPLPFGKSPLQRTIQEYIRAGYVNLDKPSNPSSHEVVAWIKRILRCEKTGHSGTLDPKTSGCLIVCIDRATRLVKSQQSAGKEYISIFKLHSAVENVAKASKKKMMIKQGLLDKHGKPNENTPASYLAELEAAPNKKPTYMKSNLISSDVTLSTGIIWLKCQAGTYVRTYCVHMGLVLGVGAQMIELRRNRSGIQSEEDGLVTFRQEHMFEHIVSTWVLC
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NFDKLNVRTNHYTPLPFGKSPLQRTIQEYIRAGYVNLDKPSNPSSHEVVAWIKRILRCEKTGHSGTLDPKTSGCLIVCIDRATRLVKSQQSAGKEYISIFKLHSAVENVAKASKKKMMIKQGLLDKHGKPNENTPASYLAELEAAPNKKPTYMKSNLISSDVTLSTGIIWLKCQAGTYVRTYCVHMGLVLGVGAQMIELRRNRSGIQSEEDGLVTFRQEHMFEHIVSTWVLC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
H/ACA ribonucleoprotein complex subunit 4 Plays a central role in ribosomal RNA processing. Probable catalytic subunit of H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex, which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Pseudouridine ('psi') residues may serve to stabilize the conformation of rRNAs.confidentQ9LD90
Centromere/microtubule-binding protein cbf5 Involved in ribosome biogenesis; more specifically in 18S rRNA pseudouridylation and in cleavage of pre-rRNA. May function as a pseudouridine synthase.confidentO43102
Centromere/microtubule-binding protein CBF5 Involved in ribosome biogenesis; more specifically in 18S rRNA pseudouridylation and in cleavage of pre-rRNA. May function as a pseudouridine synthase.confidentO43100

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0000003 [BP]reproductionprobableGO:0008150
GO:0006364 [BP]rRNA processingprobableGO:0090304, GO:0034641, GO:0006807, GO:0034660, GO:1901360, GO:0006139, GO:0044260, GO:0042254, GO:0071704, GO:0010467, GO:0071840, GO:0022613, GO:0034470, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0044238, GO:0016072, GO:0044237, GO:0043170, GO:0044085, GO:0006396
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0030686 [CC]90S preribosomeprobableGO:0032991, GO:0044464, GO:0030684, GO:0005623, GO:0030529, GO:0005575, GO:0044424, GO:0005622
GO:0065007 [BP]biological regulationprobableGO:0008150
GO:0005732 [CC]small nucleolar ribonucleoprotein complexprobableGO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0030529
GO:0003720 [MF]telomerase activityprobableGO:0016779, GO:0016772, GO:0034061, GO:0003824, GO:0016740, GO:0003674, GO:0003964
GO:0008283 [BP]cell proliferationprobableGO:0008150, GO:0044699
GO:0009982 [MF]pseudouridine synthase activityprobableGO:0016866, GO:0003674, GO:0016853, GO:0003824
GO:0003723 [MF]RNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0001522 [BP]pseudouridine synthesisprobableGO:0016070, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0043412, GO:0006807, GO:0008150, GO:0008152, GO:0009451, GO:1901360, GO:0046483
GO:0007275 [BP]multicellular organismal developmentprobableGO:0032502, GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0005697 [CC]telomerase holoenzyme complexprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0009506 [CC]plasmodesmaprobableGO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0048856 [BP]anatomical structure developmentprobableGO:0032502, GO:0008150
GO:0015030 [CC]Cajal bodyprobableGO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3U28, chain A
Confidence level:very confident
Coverage over the Query: 1-222
View the alignment between query and template
View the model in PyMOL