Diaphorina citri psyllid: psy1180


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140
DIKNYCLDIKGDFPFAIIGDENRDLAVKLDLLDEENKNNLETAITVRAVYIIGPDRKLKLSIVYPASTGRSVDEILRVLDSLQLFYKNNTVVTPANWKPGDKVMIHPAVKDDELPKLFPKGVDIVDMPSGVSYVRFTNDY
ccHHHHHccccccccCEEEccccHHHHHcccccccccccccccEEEEEEEEEcccccEEEEEECcccccccHHHHHHHHHHHHHHcccccEEccccccccccEEEccccccHHHHHHccccCEEECccccccCEEEcccc
DIKNYCLDIKGDFPFAIIGDENRDLAVKLDLLDEENKNNLETAITVRAVYIIGPDRKLKLSIVYPASTGRSVDEILRVLDSLQLFYKNNTVVTPANWKPGDKVMIHPAVKDDELPKLFPKGVDIVDMPSGVSYVRFTNDY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DIKNYCLDIKGDFPFAIIGDENRDLAVKLDLLDEENKNNLETAITVRAVYIIGPDRKLKLSIVYPASTGRSVDEILRVLDSLQLFYKNNTVVTPANWKPGDKVMIHPAVKDDELPKLFPKGVDIVDMPSGVSYVRFTNDY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peroxiredoxin-6 Involved in redox regulation of the cell. Can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. May play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury.confidentQ9TSX9
Peroxiredoxin-6 Involved in redox regulation of the cell. Can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. May play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury.confidentO08709
Peroxiredoxin-6 Involved in redox regulation of the cell. Can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. May play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury.confidentO35244

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0008379 [MF]thioredoxin peroxidase activityprobableGO:0016209, GO:0016705, GO:0051920, GO:0003824, GO:0003674, GO:0016684, GO:0004601, GO:0016491
GO:0042744 [BP]hydrogen peroxide catabolic processprobableGO:0000302, GO:0044248, GO:0042743, GO:0070887, GO:0044699, GO:0051716, GO:0070301, GO:0009987, GO:0034614, GO:0072593, GO:0006950, GO:0008150, GO:0008152, GO:0042221, GO:0034599, GO:0010035, GO:0009056, GO:0006979, GO:1901700, GO:1901701, GO:0042542, GO:0050896, GO:0044237, GO:0033554, GO:0044763
GO:0004623 [MF]phospholipase A2 activityprobableGO:0016787, GO:0016788, GO:0003824, GO:0003674, GO:0052689, GO:0004620, GO:0016298
GO:0007498 [BP]mesoderm developmentprobableGO:0032502, GO:0048856, GO:0008150, GO:0009888
GO:0009395 [BP]phospholipid catabolic processprobableGO:0044238, GO:0006644, GO:0046434, GO:0009987, GO:1901575, GO:0044237, GO:0016042, GO:0044248, GO:0071704, GO:0006796, GO:0044710, GO:0008150, GO:0008152, GO:0006793, GO:0019637, GO:0044242, GO:0009056, GO:0044255, GO:0006629
GO:0030446 [CC]hyphal cell wallprobableGO:0005618, GO:0044464, GO:0005623, GO:0030312, GO:0005575, GO:0071944, GO:0009277
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0055114 [BP]oxidation-reduction processprobableGO:0044710, GO:0008150, GO:0008152
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0004602 [MF]glutathione peroxidase activityprobableGO:0016209, GO:0003824, GO:0003674, GO:0016684, GO:0004601, GO:0016491
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005576 [CC]extracellular regionprobableGO:0005575

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PRX, chain A
Confidence level:very confident
Coverage over the Query: 11-140
View the alignment between query and template
View the model in PyMOL