Query         psy1181
Match_columns 82
No_of_seqs    110 out of 417
Neff          4.6 
Searched_HMMs 46136
Date          Fri Aug 16 19:35:17 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy1181.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/1181hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3456|consensus              100.0   2E-39 4.3E-44  220.8   2.3   78    1-78     41-118 (120)
  2 PF10276 zf-CHCC:  Zinc-finger   99.8   8E-21 1.7E-25  109.0   4.1   39   37-75      1-40  (40)
  3 COG4391 Uncharacterized protei  99.7 1.3E-17 2.8E-22  103.5   5.3   46   32-77     16-61  (62)
  4 PLN02294 cytochrome c oxidase   98.9 2.8E-09   6E-14   77.4   5.3   51   27-77    101-154 (174)
  5 PF01215 COX5B:  Cytochrome c o  98.6 3.6E-08 7.7E-13   69.1   3.8   52   26-78     72-126 (136)
  6 cd00924 Cyt_c_Oxidase_Vb Cytoc  98.5 1.6E-07 3.5E-12   62.4   4.3   50   28-79     42-94  (97)
  7 PTZ00043 cytochrome c oxidase   98.4 2.4E-07 5.3E-12   70.5   4.4   52   27-78    141-195 (268)
  8 KOG3352|consensus               98.3 5.3E-07 1.1E-11   64.5   3.8   51   27-79     95-148 (153)
  9 PF09538 FYDLN_acid:  Protein o  96.2  0.0017 3.7E-08   43.8   0.9   21   56-77     19-39  (108)
 10 TIGR02300 FYDLN_acid conserved  93.5   0.031 6.8E-07   39.2   0.9   21   56-77     19-39  (129)
 11 PRK00398 rpoP DNA-directed RNA  93.5   0.083 1.8E-06   29.9   2.5   17   63-79     20-36  (46)
 12 PF13465 zf-H2C2_2:  Zinc-finge  90.0    0.19 4.1E-06   25.4   1.2   14   62-75     12-25  (26)
 13 PF00096 zf-C2H2:  Zinc finger,  89.4    0.15 3.2E-06   24.4   0.5   12   66-77      2-13  (23)
 14 COG4530 Uncharacterized protei  88.6    0.17 3.8E-06   35.3   0.6   21   55-76     18-38  (129)
 15 PF13913 zf-C2HC_2:  zinc-finge  88.2    0.23   5E-06   25.2   0.7   13   65-77      3-15  (25)
 16 smart00659 RPOLCX RNA polymera  86.4    0.75 1.6E-05   26.4   2.3   21   57-77     12-32  (44)
 17 PF13894 zf-C2H2_4:  C2H2-type   85.5    0.38 8.2E-06   22.2   0.7   13   66-78      2-14  (24)
 18 PF13878 zf-C2H2_3:  zinc-finge  85.4    0.74 1.6E-05   25.9   1.9   23   56-78      3-27  (41)
 19 PF08792 A2L_zn_ribbon:  A2L zi  85.0     1.3 2.8E-05   24.0   2.7   23   51-75     10-32  (33)
 20 COG1996 RPC10 DNA-directed RNA  83.8       1 2.2E-05   26.8   2.1   18   61-78     21-38  (49)
 21 TIGR02098 MJ0042_CXXC MJ0042 f  83.4     1.2 2.5E-05   23.9   2.1   13   63-75     24-36  (38)
 22 PF14255 Cys_rich_CPXG:  Cystei  81.5    0.78 1.7E-05   27.4   1.0   12   65-76      1-12  (52)
 23 PF03604 DNA_RNApol_7kD:  DNA d  80.7     1.1 2.3E-05   24.3   1.3   19   59-77     12-30  (32)
 24 PF02892 zf-BED:  BED zinc fing  79.6    0.82 1.8E-05   25.1   0.6   17   61-77     13-29  (45)
 25 PF05605 zf-Di19:  Drought indu  77.4    0.94   2E-05   26.2   0.4   10   65-74      3-12  (54)
 26 COG1579 Zn-ribbon protein, pos  75.7    0.85 1.9E-05   34.6  -0.1   19   61-79    218-236 (239)
 27 smart00614 ZnF_BED BED zinc fi  75.2     4.2 9.2E-05   23.1   2.8   16   63-78     17-32  (50)
 28 PF13719 zinc_ribbon_5:  zinc-r  74.9     2.1 4.5E-05   23.3   1.4   16   64-79      2-17  (37)
 29 PF08271 TF_Zn_Ribbon:  TFIIB z  74.6     5.1 0.00011   22.1   3.0   24   51-75      7-30  (43)
 30 PF02748 PyrI_C:  Aspartate car  73.5       4 8.7E-05   24.1   2.5   23   55-77     25-48  (52)
 31 PF05129 Elf1:  Transcription e  72.4     3.1 6.8E-05   26.5   1.9   36   38-77     20-59  (81)
 32 PF13408 Zn_ribbon_recom:  Reco  71.7     2.9 6.4E-05   23.5   1.6   15   63-77      4-18  (58)
 33 PF14369 zf-RING_3:  zinc-finge  71.7     3.9 8.4E-05   22.3   2.0   14   63-76     20-33  (35)
 34 KOG1088|consensus               70.7     3.2   7E-05   29.0   1.8   18   62-79     96-113 (124)
 35 PHA02768 hypothetical protein;  69.9     1.2 2.6E-05   27.0  -0.4   13   66-78      7-19  (55)
 36 PF08685 GON:  GON domain;  Int  68.1     6.9 0.00015   29.2   3.2   33   40-74     30-76  (201)
 37 PF01430 HSP33:  Hsp33 protein;  67.9     3.2 6.9E-05   31.2   1.5   14   64-77    266-279 (280)
 38 PF03966 Trm112p:  Trm112p-like  67.1     5.1 0.00011   24.1   2.0   18   62-79     51-68  (68)
 39 smart00647 IBR In Between Ring  66.0     9.3  0.0002   21.5   2.9   36   37-76     15-52  (64)
 40 TIGR02605 CxxC_CxxC_SSSS putat  65.7     4.8  0.0001   22.7   1.6   18   55-72     17-34  (52)
 41 PF14353 CpXC:  CpXC protein     65.6     4.2   9E-05   26.9   1.5   15   64-78     38-52  (128)
 42 TIGR03365 Bsubt_queE 7-cyano-7  64.9     6.3 0.00014   28.8   2.5   34   42-76     12-45  (238)
 43 PF13240 zinc_ribbon_2:  zinc-r  64.2     2.6 5.6E-05   21.0   0.2   12   62-73     11-22  (23)
 44 PF14447 Prok-RING_4:  Prokaryo  64.2     3.2   7E-05   25.2   0.7   28   51-78     26-53  (55)
 45 PF06957 COPI_C:  Coatomer (COP  63.0     4.9 0.00011   32.8   1.8   15   62-76    378-392 (422)
 46 COG1281 Disulfide bond chapero  62.9     4.7  0.0001   31.5   1.6   16   63-78    265-280 (286)
 47 PF02591 DUF164:  Putative zinc  62.8     4.8  0.0001   23.4   1.3   41   30-73     14-55  (56)
 48 PF13717 zinc_ribbon_4:  zinc-r  61.8     5.8 0.00013   21.6   1.4   16   64-79      2-17  (36)
 49 PF09237 GAGA:  GAGA factor;  I  60.8     3.6 7.9E-05   25.0   0.5   19   58-76     18-36  (54)
 50 cd00498 Hsp33 Heat shock prote  60.3     5.3 0.00012   30.1   1.4   13   64-76    262-274 (275)
 51 PF04423 Rad50_zn_hook:  Rad50   60.2     5.5 0.00012   22.9   1.2   12   65-76     21-32  (54)
 52 PF12660 zf-TFIIIC:  Putative z  59.5     4.1 8.9E-05   26.6   0.6   43   36-78     27-69  (99)
 53 PF13248 zf-ribbon_3:  zinc-rib  58.0     3.7   8E-05   20.7   0.2   12   62-73     14-25  (26)
 54 PRK00114 hslO Hsp33-like chape  58.0     6.5 0.00014   30.0   1.6   15   64-78    268-282 (293)
 55 PF14446 Prok-RING_1:  Prokaryo  57.8     7.9 0.00017   23.4   1.6   16   61-76     18-33  (54)
 56 PF15616 TerY-C:  TerY-C metal   57.5     6.8 0.00015   27.4   1.5   21   57-77     98-118 (131)
 57 KOG2462|consensus               57.3     5.8 0.00013   31.1   1.2   21   58-78    155-175 (279)
 58 PF09723 Zn-ribbon_8:  Zinc rib  57.1     9.4  0.0002   21.2   1.8   18   55-72     17-34  (42)
 59 smart00531 TFIIE Transcription  55.9      11 0.00023   25.8   2.3   45   34-79     93-138 (147)
 60 smart00355 ZnF_C2H2 zinc finge  54.6     4.8  0.0001   18.3   0.2   12   66-77      2-13  (26)
 61 TIGR00240 ATCase_reg aspartate  54.0      14  0.0003   26.5   2.6   40   38-77    101-145 (150)
 62 smart00834 CxxC_CXXC_SSSS Puta  53.7      13 0.00029   19.5   2.0   13   62-74     24-36  (41)
 63 PF12756 zf-C2H2_2:  C2H2 type   52.8     9.2  0.0002   22.9   1.4   15   63-77     49-63  (100)
 64 TIGR03829 YokU_near_AblA uncha  52.5      15 0.00032   24.2   2.4   37   41-77      3-48  (89)
 65 PF13912 zf-C2H2_6:  C2H2-type   50.9     9.3  0.0002   18.5   1.0   13   65-77      2-14  (27)
 66 COG1645 Uncharacterized Zn-fin  50.0      18  0.0004   25.3   2.7   28   42-77     30-57  (131)
 67 PF01428 zf-AN1:  AN1-like Zinc  48.8     9.5  0.0002   21.2   0.9   16   63-78     12-27  (43)
 68 PF14803 Nudix_N_2:  Nudix N-te  48.4      21 0.00045   19.4   2.2   25   51-75      7-33  (34)
 69 PF12171 zf-C2H2_jaz:  Zinc-fin  47.6     9.5 0.00021   18.8   0.7   12   66-77      3-14  (27)
 70 PHA00616 hypothetical protein   47.4     3.9 8.4E-05   23.8  -0.9   13   66-78      3-15  (44)
 71 PRK13376 pyrB bifunctional asp  47.1      46   0.001   28.0   5.0   36   41-77    479-520 (525)
 72 KOG1074|consensus               46.8     6.4 0.00014   35.3  -0.0   36   38-79    612-648 (958)
 73 COG1781 PyrI Aspartate carbamo  46.5      18 0.00038   26.2   2.2   41   38-78    104-149 (153)
 74 PRK11827 hypothetical protein;  45.6      34 0.00074   20.9   3.1   34   40-79      8-41  (60)
 75 TIGR01206 lysW lysine biosynth  45.4      26 0.00056   20.9   2.5   14   63-76     21-34  (54)
 76 PRK01402 hslO Hsp33-like chape  45.3      14  0.0003   29.0   1.7   15   64-78    308-322 (328)
 77 PF10571 UPF0547:  Uncharacteri  45.2     9.3  0.0002   19.6   0.4   13   63-75     13-25  (26)
 78 PRK00893 aspartate carbamoyltr  45.0      21 0.00046   25.5   2.4   41   38-78    103-148 (152)
 79 PF01485 IBR:  IBR domain;  Int  44.8      12 0.00027   21.0   1.0   12   64-75     40-51  (64)
 80 PF06226 DUF1007:  Protein of u  44.4      15 0.00032   26.6   1.6   15   46-60     13-27  (212)
 81 PF14690 zf-ISL3:  zinc-finger   43.8      13 0.00029   20.2   1.0   14   64-77      2-15  (47)
 82 PRK03824 hypA hydrogenase nick  43.6      15 0.00033   25.1   1.4   27   53-79     96-123 (135)
 83 COG1655 Uncharacterized protei  43.1     9.4  0.0002   29.7   0.4   17   62-78     17-33  (267)
 84 PHA03296 envelope glycoprotein  42.5      26 0.00057   31.0   3.0   25   51-76    681-705 (814)
 85 PF04475 DUF555:  Protein of un  42.5      15 0.00032   24.9   1.2   19   55-74     39-57  (102)
 86 cd03528 Rieske_RO_ferredoxin R  42.3      48   0.001   20.2   3.5   18   62-79     55-72  (98)
 87 PF02489 Herpes_glycop_H:  Herp  42.2      15 0.00032   30.8   1.4   33   41-76    538-573 (657)
 88 PF01844 HNH:  HNH endonuclease  42.0      11 0.00023   20.2   0.4   11   67-77      1-11  (47)
 89 KOG1729|consensus               41.9     9.9 0.00021   29.6   0.3   31   50-82    156-187 (288)
 90 PF08274 PhnA_Zn_Ribbon:  PhnA   41.2      12 0.00025   20.0   0.5   15   65-79      3-17  (30)
 91 COG2835 Uncharacterized conser  40.6      47   0.001   20.5   3.1   34   40-79      8-41  (60)
 92 COG4888 Uncharacterized Zn rib  40.6      34 0.00074   23.3   2.7   36   38-77     20-59  (104)
 93 PF00653 BIR:  Inhibitor of Apo  40.5      35 0.00075   20.3   2.6   15   61-75     33-47  (70)
 94 PRK03922 hypothetical protein;  40.4      17 0.00037   25.0   1.3   21   54-75     40-60  (113)
 95 PF03119 DNA_ligase_ZBD:  NAD-d  40.2      19 0.00042   18.6   1.2   14   66-79      1-14  (28)
 96 PRK14892 putative transcriptio  40.0      52  0.0011   21.8   3.5   36   38-77     19-55  (99)
 97 PF10013 DUF2256:  Uncharacteri  39.7      13 0.00028   21.6   0.5   12   64-75      8-19  (42)
 98 COG0602 NrdG Organic radical a  38.4      26 0.00056   25.5   2.1   32   44-76     14-45  (212)
 99 TIGR02159 PA_CoA_Oxy4 phenylac  38.1      14  0.0003   25.9   0.6   13   64-76    105-117 (146)
100 COG1885 Uncharacterized protei  37.7      19 0.00041   24.8   1.2   23   52-75     38-60  (115)
101 smart00154 ZnF_AN1 AN1-like Zi  37.4      18 0.00039   19.9   0.9   16   64-79     12-27  (39)
102 smart00451 ZnF_U1 U1-like zinc  37.0      18  0.0004   18.2   0.8   14   63-76      2-15  (35)
103 cd00729 rubredoxin_SM Rubredox  35.8      20 0.00044   19.2   0.9   10   63-72     17-26  (34)
104 COG2093 DNA-directed RNA polym  35.8      21 0.00045   22.4   1.0   13   61-73     15-27  (64)
105 PF10601 zf-LITAF-like:  LITAF-  35.6      26 0.00057   21.1   1.5   14   61-74      4-17  (73)
106 COG4049 Uncharacterized protei  34.8      15 0.00033   22.9   0.3   14   64-77     17-30  (65)
107 PF11793 FANCL_C:  FANCL C-term  34.6      25 0.00055   21.4   1.3   14   64-77     55-68  (70)
108 COG1656 Uncharacterized conser  34.3      17 0.00038   26.4   0.6   22   53-76    121-142 (165)
109 COG5189 SFP1 Putative transcri  33.9      20 0.00043   29.3   0.9   19   61-79    395-413 (423)
110 KOG1391|consensus               33.6      14  0.0003   29.7   0.0   37   18-54    317-353 (396)
111 cd04487 RecJ_OBF2_like RecJ_OB  33.5      52  0.0011   20.1   2.6   30   35-69      2-32  (73)
112 PF05191 ADK_lid:  Adenylate ki  33.4      25 0.00054   19.2   1.0   13   65-77      2-14  (36)
113 cd03469 Rieske_RO_Alpha_N Ries  32.9      80  0.0017   19.8   3.5   29   50-78     46-74  (118)
114 cd00022 BIR Baculoviral inhibi  32.7      36 0.00078   19.8   1.7   15   62-76     32-46  (69)
115 PHA00732 hypothetical protein   32.1      21 0.00045   22.5   0.6   13   66-78     29-41  (79)
116 PF03884 DUF329:  Domain of unk  31.7      32  0.0007   20.8   1.4   14   64-77      2-15  (57)
117 KOG1522|consensus               31.7      30 0.00065   27.2   1.5   71    8-78     16-103 (285)
118 cd03529 Rieske_NirD Assimilato  31.0      97  0.0021   19.4   3.7   18   62-79     61-78  (103)
119 smart00729 Elp3 Elongator prot  31.0      33 0.00072   22.3   1.5   21   54-74      2-22  (216)
120 COG1571 Predicted DNA-binding   30.7      19 0.00042   29.6   0.4   14   66-79    352-365 (421)
121 cd00085 HNHc HNH nucleases; HN  30.4      22 0.00047   18.9   0.5   10   65-74     12-21  (57)
122 smart00064 FYVE Protein presen  30.4      33 0.00072   20.0   1.3   14   64-77     10-23  (68)
123 PF12760 Zn_Tnp_IS1595:  Transp  30.3      25 0.00053   19.6   0.7    8   65-72     19-26  (46)
124 PF13005 zf-IS66:  zinc-finger   30.3      34 0.00074   18.6   1.3   15   64-78      2-16  (47)
125 cd03531 Rieske_RO_Alpha_KSH Th  30.3      42  0.0009   21.8   1.9   17   62-78     57-73  (115)
126 COG5034 TNG2 Chromatin remodel  30.3      32 0.00069   26.9   1.5   31   38-72    232-269 (271)
127 TIGR02378 nirD_assim_sml nitri  30.2      41 0.00089   21.1   1.8   16   64-79     64-79  (105)
128 PRK09965 3-phenylpropionate di  30.0 1.5E+02  0.0032   18.7   4.7   20   60-79     55-74  (106)
129 cd03542 Rieske_RO_Alpha_HBDO R  29.9      50  0.0011   21.9   2.2   28   51-78     47-74  (123)
130 PF14569 zf-UDP:  Zinc-binding   29.5      17 0.00038   23.7  -0.1   17   61-77     48-64  (80)
131 smart00746 TRASH metallochaper  29.5      25 0.00055   16.3   0.6    9   67-75      1-9   (39)
132 PF04606 Ogr_Delta:  Ogr/Delta-  29.4      24 0.00052   19.9   0.5   10   66-75      1-10  (47)
133 PF06676 DUF1178:  Protein of u  29.0      30 0.00066   24.5   1.1   17   61-77     29-45  (148)
134 PF07503 zf-HYPF:  HypF finger;  29.0      25 0.00053   19.2   0.5   14   63-76     20-33  (35)
135 cd03474 Rieske_T4moC Toluene-4  28.9      90  0.0019   19.5   3.2   19   62-80     56-74  (108)
136 cd03028 GRX_PICOT_like Glutare  28.9      35 0.00077   21.0   1.3   22   51-72      7-28  (90)
137 cd03478 Rieske_AIFL_N AIFL (ap  28.8 1.4E+02   0.003   18.2   4.0   18   62-79     54-71  (95)
138 cd00350 rubredoxin_like Rubred  28.2      35 0.00076   17.9   1.0   10   63-72     16-25  (33)
139 KOG1280|consensus               27.7      26 0.00056   28.6   0.6   25   49-73     49-88  (381)
140 PF13824 zf-Mss51:  Zinc-finger  27.5      27 0.00058   21.2   0.5   15   62-76     12-26  (55)
141 PRK00432 30S ribosomal protein  27.5      38 0.00082   19.7   1.2   12   63-74     36-47  (50)
142 PHA03294 envelope glycoprotein  27.4      46   0.001   29.6   2.2   33   41-76    701-733 (835)
143 smart00238 BIR Baculoviral inh  27.2      52  0.0011   19.2   1.8   15   62-76     34-48  (71)
144 cd03541 Rieske_RO_Alpha_CMO Ri  27.2      48  0.0011   21.9   1.8   17   62-78     58-74  (118)
145 PF07282 OrfB_Zn_ribbon:  Putat  26.8      51  0.0011   19.2   1.7   23   51-75     35-57  (69)
146 PHA00733 hypothetical protein   26.5      34 0.00074   23.1   1.0   15   62-76     71-85  (128)
147 TIGR00510 lipA lipoate synthas  26.5      53  0.0011   25.4   2.1   49   26-75     36-85  (302)
148 smart00734 ZnF_Rad18 Rad18-lik  26.2      29 0.00064   17.5   0.5   11   65-75      2-12  (26)
149 KOG3623|consensus               26.0      16 0.00035   32.7  -0.8   16   64-79    281-296 (1007)
150 PF10080 DUF2318:  Predicted me  26.0      40 0.00086   22.4   1.2   21   56-78     46-66  (102)
151 cd03467 Rieske Rieske domain;   25.8 1.6E+02  0.0035   17.8   4.0   40   39-79     34-73  (98)
152 PRK06366 acetyl-CoA acetyltran  25.8      23 0.00049   27.7  -0.0   37   18-54    309-345 (388)
153 PRK03681 hypA hydrogenase nick  25.8      43 0.00094   22.2   1.3   30   37-73     67-96  (114)
154 TIGR03655 anti_R_Lar restricti  25.6      30 0.00065   19.8   0.5   10   66-75      3-12  (53)
155 TIGR02646 conserved hypothetic  25.6      31 0.00066   23.5   0.6   14   64-77     24-37  (144)
156 PRK06245 cofG FO synthase subu  25.4      40 0.00086   25.5   1.2   21   52-72     11-31  (336)
157 PRK00420 hypothetical protein;  25.1      47   0.001   22.6   1.4   18   61-78     37-54  (112)
158 smart00507 HNHc HNH nucleases.  24.9      29 0.00063   18.0   0.3   11   65-75     11-21  (52)
159 PF03470 zf-XS:  XS zinc finger  24.8      30 0.00065   20.0   0.4    7   67-73      1-7   (43)
160 TIGR03831 YgiT_finger YgiT-typ  24.7      66  0.0014   16.9   1.8   13   65-77     33-45  (46)
161 cd03532 Rieske_RO_Alpha_VanA_D  24.7      96  0.0021   19.9   2.8   17   62-78     60-76  (116)
162 PF04959 ARS2:  Arsenite-resist  24.2      52  0.0011   24.6   1.6   15   62-76     75-89  (214)
163 PF09889 DUF2116:  Uncharacteri  24.1      34 0.00074   20.8   0.5   11   65-75      4-14  (59)
164 PRK10824 glutaredoxin-4; Provi  24.1      48   0.001   22.2   1.3   23   51-73     14-36  (115)
165 PF13451 zf-trcl:  Probable zin  24.0      60  0.0013   19.1   1.6   18   62-79      2-19  (49)
166 PF14952 zf-tcix:  Putative tre  23.6      36 0.00077   19.9   0.5   11   63-73     10-20  (44)
167 PF10058 DUF2296:  Predicted in  23.5      38 0.00082   20.0   0.7    9   64-72     44-52  (54)
168 PF03811 Zn_Tnp_IS1:  InsA N-te  23.4      60  0.0013   17.7   1.4   16   64-79      5-21  (36)
169 PF14122 YokU:  YokU-like prote  22.9      87  0.0019   20.7   2.3   36   42-77      4-48  (87)
170 PF01363 FYVE:  FYVE zinc finge  22.9      19 0.00042   21.1  -0.7   12   65-76     10-21  (69)
171 KOG3993|consensus               22.5      22 0.00048   29.8  -0.6   17   61-77    353-369 (500)
172 PF14239 RRXRR:  RRXRR protein   22.5      39 0.00086   24.7   0.7   40    5-44    107-159 (176)
173 PF14616 DUF4451:  Domain of un  22.4 1.1E+02  0.0024   20.6   2.9   16   64-79     25-42  (124)
174 COG1592 Rubrerythrin [Energy p  22.3      39 0.00084   24.4   0.6   17   56-73    142-158 (166)
175 PF13821 DUF4187:  Domain of un  21.8      33 0.00071   20.4   0.1   14   64-77     27-40  (55)
176 cd03530 Rieske_NirD_small_Baci  21.5 1.9E+02  0.0042   17.6   3.7   18   62-79     56-73  (98)
177 PF01927 Mut7-C:  Mut7-C RNAse   21.4      66  0.0014   21.9   1.6   51   24-76     74-136 (147)
178 PRK02048 4-hydroxy-3-methylbut  21.4      51  0.0011   28.5   1.2   17   58-74    512-528 (611)
179 PTZ00255 60S ribosomal protein  21.3      18 0.00039   23.9  -1.2   10   63-72     35-44  (90)
180 cd01449 TST_Repeat_2 Thiosulfa  21.3      84  0.0018   19.4   2.0   32   26-57     68-108 (118)
181 PRK08116 hypothetical protein;  21.3      44 0.00095   24.9   0.8   15   61-75     13-27  (268)
182 PF09180 ProRS-C_1:  Prolyl-tRN  20.9      42 0.00091   20.3   0.5   12   62-73     46-57  (68)
183 PRK00423 tfb transcription ini  20.3      57  0.0012   24.9   1.2   16   60-75     26-41  (310)

No 1  
>KOG3456|consensus
Probab=100.00  E-value=2e-39  Score=220.79  Aligned_cols=78  Identities=58%  Similarity=1.044  Sum_probs=75.8

Q ss_pred             CCCcccCCcCcccccccccChhHHHhhhhcCCCeeecCceEeeCCCCCCCCCCeEEEEcCCCCeeecCCCCceeeecC
Q psy1181           1 KFEKDDYRPVRFVDKEKHVNTQFAIDLIAEVPPKPCKERVVWCDGGSGPTGHPKVYINLDKPGNHSCGYCGLRFFKED   78 (82)
Q Consensus         1 ~~~~~~~~~~rf~~~~~~~n~~~a~~li~e~P~i~v~~r~v~C~Gg~~~lgHP~Vyi~L~~~~~~~CpYCG~~y~~~~   78 (82)
                      +||++|||++||++.+|.+|++|||+||+|+||+++++|+|.||||++|||||+||||||+++++.|+|||++|++++
T Consensus        41 ~~D~~Dyr~~rf~~~kk~vn~n~~m~LI~e~Pp~e~d~RVV~CdGg~~aLGHPkvyInLDk~~~~~CgYCGlrf~~dH  118 (120)
T KOG3456|consen   41 VTDQSDYRGNRFVKWKKDVNENSAMELISEVPPIEVDGRVVACDGGTPALGHPKVYINLDKPGPHICGYCGLRFVQDH  118 (120)
T ss_pred             ccchHHHhHHHHHhhhhhcCccchhhhhhcCChhhccceEEEecCCCCCCCCCeEEEEcCCCCCcccccchhhhhhhh
Confidence            599999999999999999999999999999999999999999999999999999999999999999999999999843


No 2  
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=99.82  E-value=8e-21  Score=109.01  Aligned_cols=39  Identities=54%  Similarity=1.147  Sum_probs=34.8

Q ss_pred             cCceEeeCCCCCCCCCCeEEEEcCCC-CeeecCCCCceee
Q psy1181          37 KERVVWCDGGSGPTGHPKVYINLDKP-GNHSCGYCGLRFF   75 (82)
Q Consensus        37 ~~r~v~C~Gg~~~lgHP~Vyi~L~~~-~~~~CpYCG~~y~   75 (82)
                      ++++|+|||+++++|||+|||+|+++ +.+.|||||++|+
T Consensus         1 ~~~~v~CdG~~~~lgHPrVyl~l~~~~~~~~CpYCg~~yv   40 (40)
T PF10276_consen    1 DGRRVSCDGGGGALGHPRVYLNLDDEPGPVVCPYCGTRYV   40 (40)
T ss_dssp             -SSEEEEEESSTTSCCCCEEEE-TTTTCEEEETTTTEEEE
T ss_pred             CCcEEEeCCCCCCCCCCeEEEecCCCCCeEECCCCCCEEC
Confidence            47899999999999999999999996 7799999999996


No 3  
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=99.71  E-value=1.3e-17  Score=103.53  Aligned_cols=46  Identities=24%  Similarity=0.637  Sum_probs=42.9

Q ss_pred             CCeeecCceEeeCCCCCCCCCCeEEEEcCCCCeeecCCCCceeeec
Q psy1181          32 PPKPCKERVVWCDGGSGPTGHPKVYINLDKPGNHSCGYCGLRFFKE   77 (82)
Q Consensus        32 P~i~v~~r~v~C~Gg~~~lgHP~Vyi~L~~~~~~~CpYCG~~y~~~   77 (82)
                      -.|.+.+..++|+|.+++.+||||||+|.+++++.|||||++|++.
T Consensus        16 ~~I~~~~~~l~C~g~~~p~~HPrV~L~mg~~gev~CPYC~t~y~l~   61 (62)
T COG4391          16 ETIEIGDLPLMCPGPEPPNDHPRVFLDMGDEGEVVCPYCSTRYRLN   61 (62)
T ss_pred             eEEEeCCeeEEcCCCCCCCCCCEEEEEcCCCCcEecCccccEEEec
Confidence            3478899999999999999999999999999999999999999986


No 4  
>PLN02294 cytochrome c oxidase subunit Vb
Probab=98.89  E-value=2.8e-09  Score=77.39  Aligned_cols=51  Identities=31%  Similarity=0.500  Sum_probs=44.8

Q ss_pred             hhhcCCCe---eecCceEeeCCCCCCCCCCeEEEEcCCCCeeecCCCCceeeec
Q psy1181          27 LIAEVPPK---PCKERVVWCDGGSGPTGHPKVYINLDKPGNHSCGYCGLRFFKE   77 (82)
Q Consensus        27 li~e~P~i---~v~~r~v~C~Gg~~~lgHP~Vyi~L~~~~~~~CpYCG~~y~~~   77 (82)
                      -+.+-|++   ..+.|+|+|.|+.+...|-.+|++|.+..+.+||.||..|+++
T Consensus       101 GTke~P~lVpS~~d~RiVGCtg~~~eDsh~v~Wf~L~kGkp~RCpeCG~~fkL~  154 (174)
T PLN02294        101 GTKEAPAVVKSYYDKRIVGCPGGEGEDEHDVVWFWLEKGKSFECPVCTQYFELE  154 (174)
T ss_pred             CCccCCcEeccCCCceEEeeCCCCCCCCceeEEEEecCCCceeCCCCCCEEEEE
Confidence            45666665   3479999999987888999999999999999999999999998


No 5  
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=98.62  E-value=3.6e-08  Score=69.11  Aligned_cols=52  Identities=27%  Similarity=0.344  Sum_probs=40.6

Q ss_pred             hhhhcCCCe---eecCceEeeCCCCCCCCCCeEEEEcCCCCeeecCCCCceeeecC
Q psy1181          26 DLIAEVPPK---PCKERVVWCDGGSGPTGHPKVYINLDKPGNHSCGYCGLRFFKED   78 (82)
Q Consensus        26 ~li~e~P~i---~v~~r~v~C~Gg~~~lgHP~Vyi~L~~~~~~~CpYCG~~y~~~~   78 (82)
                      .-+.+-|++   ..+.|+|+|.|.. ...|..+|++|.+..+.+||.||..|+++.
T Consensus        72 ~GT~e~P~lVpS~~~~RiVGC~g~~-~~sH~v~W~~l~~g~~~RCpeCG~~fkL~~  126 (136)
T PF01215_consen   72 FGTKEDPILVPSYFDERIVGCTGEP-DDSHDVIWFWLHKGKPQRCPECGQVFKLKY  126 (136)
T ss_dssp             --SSSS-CEEEESSSCEEEEESSST-T-SSS-EEEEEETTSEEEETTTEEEEEEEE
T ss_pred             CCCccCCeEccCCCCceEEeeccCC-CCcceeEEEEEeCCCccCCCCCCeEEEEEE
Confidence            346677775   3379999999875 568999999999999999999999999976


No 6  
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=98.50  E-value=1.6e-07  Score=62.43  Aligned_cols=50  Identities=26%  Similarity=0.399  Sum_probs=41.5

Q ss_pred             hhcCCCe---eecCceEeeCCCCCCCCCCeEEEEcCCCCeeecCCCCceeeecCC
Q psy1181          28 IAEVPPK---PCKERVVWCDGGSGPTGHPKVYINLDKPGNHSCGYCGLRFFKEDS   79 (82)
Q Consensus        28 i~e~P~i---~v~~r~v~C~Gg~~~lgHP~Vyi~L~~~~~~~CpYCG~~y~~~~~   79 (82)
                      +.+-|++   ..+.|+|+|.|..+  .|-.+|++|.+..+.+|+.||..|+++..
T Consensus        42 T~e~P~lVpS~~~~RiVGC~g~~~--~h~v~W~~l~~g~~~rC~eCG~~fkL~~v   94 (97)
T cd00924          42 TKEDPNLVPSAFDKRIVGCICEPD--SHDVIWMWLEKGKPKRCPECGHVFKLVDV   94 (97)
T ss_pred             CccCCeEecCCCCCeEEeeeCCCC--CceEEEEEEeCCCceeCCCCCcEEEEEEC
Confidence            4455554   23799999998754  99999999999999999999999999753


No 7  
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=98.44  E-value=2.4e-07  Score=70.54  Aligned_cols=52  Identities=29%  Similarity=0.406  Sum_probs=43.8

Q ss_pred             hhhcCCCe---eecCceEeeCCCCCCCCCCeEEEEcCCCCeeecCCCCceeeecC
Q psy1181          27 LIAEVPPK---PCKERVVWCDGGSGPTGHPKVYINLDKPGNHSCGYCGLRFFKED   78 (82)
Q Consensus        27 li~e~P~i---~v~~r~v~C~Gg~~~lgHP~Vyi~L~~~~~~~CpYCG~~y~~~~   78 (82)
                      -+.|-|++   ..+.|+|+|.|+.+...|-.+|+.+.+....+|+.||..|++..
T Consensus       141 GTkEdPiLVpSy~deRyVGCTGg~~EDeH~VvWFwLrEGkpqRCpECGqVFKLVr  195 (268)
T PTZ00043        141 GTIENPVLVPSVGTERVVGCTGGTGEHEHVPLWFRCREGFLYRCGECDQIFMLVR  195 (268)
T ss_pred             CCccCCeEeccCCCceEEeccCCCccCCceeEEEEecCCCCccCCCCCcEEEEEE
Confidence            34556664   23699999999887889999999999999999999999999854


No 8  
>KOG3352|consensus
Probab=98.33  E-value=5.3e-07  Score=64.47  Aligned_cols=51  Identities=27%  Similarity=0.407  Sum_probs=42.9

Q ss_pred             hhhcCCCe---eecCceEeeCCCCCCCCCCeEEEEcCCCCeeecCCCCceeeecCC
Q psy1181          27 LIAEVPPK---PCKERVVWCDGGSGPTGHPKVYINLDKPGNHSCGYCGLRFFKEDS   79 (82)
Q Consensus        27 li~e~P~i---~v~~r~v~C~Gg~~~lgHP~Vyi~L~~~~~~~CpYCG~~y~~~~~   79 (82)
                      -+.+.|.+   ..+-|+|+|  +.+...|+.+|+.|.|.+..+||.||.-|+++..
T Consensus        95 GTkedP~lV~S~~d~RiVGC--~c~eD~~~V~Wmwl~Kge~~rc~eCG~~fkL~~v  148 (153)
T KOG3352|consen   95 GTKEDPNLVPSYYDKRIVGC--GCEEDSHAVVWMWLEKGETQRCPECGHYFKLVPV  148 (153)
T ss_pred             CcccCCccccccCCceEEee--cccCCCcceEEEEEEcCCcccCCcccceEEeeec
Confidence            35566765   347999999  5568899999999999999999999999999864


No 9  
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=96.24  E-value=0.0017  Score=43.77  Aligned_cols=21  Identities=33%  Similarity=0.686  Sum_probs=19.0

Q ss_pred             EEEcCCCCeeecCCCCceeeec
Q psy1181          56 YINLDKPGNHSCGYCGLRFFKE   77 (82)
Q Consensus        56 yi~L~~~~~~~CpYCG~~y~~~   77 (82)
                      |+.|++ .+++|||||+.|...
T Consensus        19 FYDLnk-~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   19 FYDLNK-DPIVCPKCGTEFPPE   39 (108)
T ss_pred             hccCCC-CCccCCCCCCccCcc
Confidence            999998 789999999999776


No 10 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=93.54  E-value=0.031  Score=39.19  Aligned_cols=21  Identities=24%  Similarity=0.463  Sum_probs=18.4

Q ss_pred             EEEcCCCCeeecCCCCceeeec
Q psy1181          56 YINLDKPGNHSCGYCGLRFFKE   77 (82)
Q Consensus        56 yi~L~~~~~~~CpYCG~~y~~~   77 (82)
                      |.+|++ .++.|||||..|...
T Consensus        19 FYDLnk-~p~vcP~cg~~~~~~   39 (129)
T TIGR02300        19 FYDLNR-RPAVSPYTGEQFPPE   39 (129)
T ss_pred             ccccCC-CCccCCCcCCccCcc
Confidence            899987 699999999998654


No 11 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=93.53  E-value=0.083  Score=29.88  Aligned_cols=17  Identities=29%  Similarity=0.804  Sum_probs=13.8

Q ss_pred             CeeecCCCCceeeecCC
Q psy1181          63 GNHSCGYCGLRFFKEDS   79 (82)
Q Consensus        63 ~~~~CpYCG~~y~~~~~   79 (82)
                      +...|||||..+..++.
T Consensus        20 ~~~~Cp~CG~~~~~~~~   36 (46)
T PRK00398         20 TGVRCPYCGYRILFKER   36 (46)
T ss_pred             CceECCCCCCeEEEccC
Confidence            37899999999887653


No 12 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=90.01  E-value=0.19  Score=25.41  Aligned_cols=14  Identities=36%  Similarity=0.788  Sum_probs=11.9

Q ss_pred             CCeeecCCCCceee
Q psy1181          62 PGNHSCGYCGLRFF   75 (82)
Q Consensus        62 ~~~~~CpYCG~~y~   75 (82)
                      +.+..|++|+..|.
T Consensus        12 ~k~~~C~~C~k~F~   25 (26)
T PF13465_consen   12 EKPYKCPYCGKSFS   25 (26)
T ss_dssp             SSSEEESSSSEEES
T ss_pred             CCCCCCCCCcCeeC
Confidence            45689999999996


No 13 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=89.40  E-value=0.15  Score=24.35  Aligned_cols=12  Identities=33%  Similarity=0.850  Sum_probs=10.4

Q ss_pred             ecCCCCceeeec
Q psy1181          66 SCGYCGLRFFKE   77 (82)
Q Consensus        66 ~CpYCG~~y~~~   77 (82)
                      .|++||+.|...
T Consensus         2 ~C~~C~~~f~~~   13 (23)
T PF00096_consen    2 KCPICGKSFSSK   13 (23)
T ss_dssp             EETTTTEEESSH
T ss_pred             CCCCCCCccCCH
Confidence            699999999764


No 14 
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=88.58  E-value=0.17  Score=35.26  Aligned_cols=21  Identities=14%  Similarity=0.381  Sum_probs=17.2

Q ss_pred             EEEEcCCCCeeecCCCCceeee
Q psy1181          55 VYINLDKPGNHSCGYCGLRFFK   76 (82)
Q Consensus        55 Vyi~L~~~~~~~CpYCG~~y~~   76 (82)
                      -|.+|+. .++.|||||..|.+
T Consensus        18 KFYDLNr-dPiVsPytG~s~P~   38 (129)
T COG4530          18 KFYDLNR-DPIVSPYTGKSYPR   38 (129)
T ss_pred             hhhccCC-CccccCcccccchH
Confidence            4788875 48999999999965


No 15 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=88.20  E-value=0.23  Score=25.23  Aligned_cols=13  Identities=31%  Similarity=0.825  Sum_probs=10.8

Q ss_pred             eecCCCCceeeec
Q psy1181          65 HSCGYCGLRFFKE   77 (82)
Q Consensus        65 ~~CpYCG~~y~~~   77 (82)
                      ..||+||+.|..+
T Consensus         3 ~~C~~CgR~F~~~   15 (25)
T PF13913_consen    3 VPCPICGRKFNPD   15 (25)
T ss_pred             CcCCCCCCEECHH
Confidence            5799999999654


No 16 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=86.43  E-value=0.75  Score=26.37  Aligned_cols=21  Identities=19%  Similarity=0.466  Sum_probs=15.3

Q ss_pred             EEcCCCCeeecCCCCceeeec
Q psy1181          57 INLDKPGNHSCGYCGLRFFKE   77 (82)
Q Consensus        57 i~L~~~~~~~CpYCG~~y~~~   77 (82)
                      ++++..+.+.||+||-+-..+
T Consensus        12 ~~~~~~~~irC~~CG~rIlyK   32 (44)
T smart00659       12 NEIKSKDVVRCRECGYRILYK   32 (44)
T ss_pred             eecCCCCceECCCCCceEEEE
Confidence            345566789999999876544


No 17 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=85.54  E-value=0.38  Score=22.25  Aligned_cols=13  Identities=31%  Similarity=0.789  Sum_probs=8.7

Q ss_pred             ecCCCCceeeecC
Q psy1181          66 SCGYCGLRFFKED   78 (82)
Q Consensus        66 ~CpYCG~~y~~~~   78 (82)
                      .|++||..|....
T Consensus         2 ~C~~C~~~~~~~~   14 (24)
T PF13894_consen    2 QCPICGKSFRSKS   14 (24)
T ss_dssp             E-SSTS-EESSHH
T ss_pred             CCcCCCCcCCcHH
Confidence            6999999997643


No 18 
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=85.35  E-value=0.74  Score=25.86  Aligned_cols=23  Identities=22%  Similarity=0.651  Sum_probs=17.8

Q ss_pred             EEEcCCC--CeeecCCCCceeeecC
Q psy1181          56 YINLDKP--GNHSCGYCGLRFFKED   78 (82)
Q Consensus        56 yi~L~~~--~~~~CpYCG~~y~~~~   78 (82)
                      .|+++..  +..+|+-||..|....
T Consensus         3 ~Ld~gq~~~~~~~C~~CgM~Y~~~~   27 (41)
T PF13878_consen    3 ILDLGQKSFGATTCPTCGMLYSPGS   27 (41)
T ss_pred             EEeCCCCccCCcCCCCCCCEECCCC
Confidence            5777765  4789999999997643


No 19 
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=85.03  E-value=1.3  Score=24.02  Aligned_cols=23  Identities=22%  Similarity=0.478  Sum_probs=18.9

Q ss_pred             CCCeEEEEcCCCCeeecCCCCceee
Q psy1181          51 GHPKVYINLDKPGNHSCGYCGLRFF   75 (82)
Q Consensus        51 gHP~Vyi~L~~~~~~~CpYCG~~y~   75 (82)
                      +|+.|+..  +.+.-.|+-||..|.
T Consensus        10 ~~~~i~~~--~~~~~~C~~Cg~~~~   32 (33)
T PF08792_consen   10 GGNGIVNK--EDDYEVCIFCGSSFP   32 (33)
T ss_pred             CCCeEEEe--cCCeEEcccCCcEee
Confidence            78888873  567899999999986


No 20 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=83.83  E-value=1  Score=26.83  Aligned_cols=18  Identities=28%  Similarity=0.776  Sum_probs=13.7

Q ss_pred             CCCeeecCCCCceeeecC
Q psy1181          61 KPGNHSCGYCGLRFFKED   78 (82)
Q Consensus        61 ~~~~~~CpYCG~~y~~~~   78 (82)
                      ....++|||||-+-..+.
T Consensus        21 ~~~~irCp~Cg~rIl~K~   38 (49)
T COG1996          21 ETRGIRCPYCGSRILVKE   38 (49)
T ss_pred             ccCceeCCCCCcEEEEec
Confidence            456789999998866554


No 21 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=83.35  E-value=1.2  Score=23.86  Aligned_cols=13  Identities=38%  Similarity=1.129  Sum_probs=11.0

Q ss_pred             CeeecCCCCceee
Q psy1181          63 GNHSCGYCGLRFF   75 (82)
Q Consensus        63 ~~~~CpYCG~~y~   75 (82)
                      ..+.||.||..|.
T Consensus        24 ~~v~C~~C~~~~~   36 (38)
T TIGR02098        24 GKVRCGKCGHVWY   36 (38)
T ss_pred             CEEECCCCCCEEE
Confidence            4689999999885


No 22 
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=81.55  E-value=0.78  Score=27.37  Aligned_cols=12  Identities=33%  Similarity=0.697  Sum_probs=9.4

Q ss_pred             eecCCCCceeee
Q psy1181          65 HSCGYCGLRFFK   76 (82)
Q Consensus        65 ~~CpYCG~~y~~   76 (82)
                      ..|||||..+..
T Consensus         1 i~CPyCge~~~~   12 (52)
T PF14255_consen    1 IQCPYCGEPIEI   12 (52)
T ss_pred             CCCCCCCCeeEE
Confidence            369999988754


No 23 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=80.71  E-value=1.1  Score=24.35  Aligned_cols=19  Identities=26%  Similarity=0.515  Sum_probs=13.2

Q ss_pred             cCCCCeeecCCCCceeeec
Q psy1181          59 LDKPGNHSCGYCGLRFFKE   77 (82)
Q Consensus        59 L~~~~~~~CpYCG~~y~~~   77 (82)
                      |.....+.|++||-+-..+
T Consensus        12 ~~~~~~irC~~CG~RIlyK   30 (32)
T PF03604_consen   12 LKPGDPIRCPECGHRILYK   30 (32)
T ss_dssp             BSTSSTSSBSSSS-SEEBE
T ss_pred             cCCCCcEECCcCCCeEEEe
Confidence            5556778999999875543


No 24 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=79.63  E-value=0.82  Score=25.06  Aligned_cols=17  Identities=24%  Similarity=0.528  Sum_probs=10.5

Q ss_pred             CCCeeecCCCCceeeec
Q psy1181          61 KPGNHSCGYCGLRFFKE   77 (82)
Q Consensus        61 ~~~~~~CpYCG~~y~~~   77 (82)
                      ....+.|.||+..|...
T Consensus        13 ~~~~a~C~~C~~~~~~~   29 (45)
T PF02892_consen   13 DKKKAKCKYCGKVIKYS   29 (45)
T ss_dssp             CSS-EEETTTTEE----
T ss_pred             CcCeEEeCCCCeEEeeC
Confidence            35789999999999875


No 25 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=77.40  E-value=0.94  Score=26.17  Aligned_cols=10  Identities=50%  Similarity=1.368  Sum_probs=8.0

Q ss_pred             eecCCCCcee
Q psy1181          65 HSCGYCGLRF   74 (82)
Q Consensus        65 ~~CpYCG~~y   74 (82)
                      -+|||||.-|
T Consensus         3 f~CP~C~~~~   12 (54)
T PF05605_consen    3 FTCPYCGKGF   12 (54)
T ss_pred             cCCCCCCCcc
Confidence            5799999944


No 26 
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]
Probab=75.71  E-value=0.85  Score=34.65  Aligned_cols=19  Identities=32%  Similarity=0.665  Sum_probs=14.3

Q ss_pred             CCCeeecCCCCceeeecCC
Q psy1181          61 KPGNHSCGYCGLRFFKEDS   79 (82)
Q Consensus        61 ~~~~~~CpYCG~~y~~~~~   79 (82)
                      ++..+.|||||+.-+++.+
T Consensus       218 ~d~iv~CP~CgRILy~~e~  236 (239)
T COG1579         218 KDEIVFCPYCGRILYYDES  236 (239)
T ss_pred             CCCCccCCccchHHHhhhc
Confidence            3467899999997766554


No 27 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=75.16  E-value=4.2  Score=23.06  Aligned_cols=16  Identities=25%  Similarity=0.794  Sum_probs=13.1

Q ss_pred             CeeecCCCCceeeecC
Q psy1181          63 GNHSCGYCGLRFFKED   78 (82)
Q Consensus        63 ~~~~CpYCG~~y~~~~   78 (82)
                      ..+.|.||++.|....
T Consensus        17 ~~a~C~~C~~~l~~~~   32 (50)
T smart00614       17 QRAKCKYCGKKLSRSS   32 (50)
T ss_pred             eEEEecCCCCEeeeCC
Confidence            3589999999997653


No 28 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=74.93  E-value=2.1  Score=23.34  Aligned_cols=16  Identities=31%  Similarity=0.536  Sum_probs=12.4

Q ss_pred             eeecCCCCceeeecCC
Q psy1181          64 NHSCGYCGLRFFKEDS   79 (82)
Q Consensus        64 ~~~CpYCG~~y~~~~~   79 (82)
                      ..+||-|++.|...+.
T Consensus         2 ~i~CP~C~~~f~v~~~   17 (37)
T PF13719_consen    2 IITCPNCQTRFRVPDD   17 (37)
T ss_pred             EEECCCCCceEEcCHH
Confidence            4689999999987653


No 29 
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=74.58  E-value=5.1  Score=22.13  Aligned_cols=24  Identities=25%  Similarity=0.599  Sum_probs=15.0

Q ss_pred             CCCeEEEEcCCCCeeecCCCCceee
Q psy1181          51 GHPKVYINLDKPGNHSCGYCGLRFF   75 (82)
Q Consensus        51 gHP~Vyi~L~~~~~~~CpYCG~~y~   75 (82)
                      |...+..+ ...|...|+.||..-.
T Consensus         7 g~~~~~~D-~~~g~~vC~~CG~Vl~   30 (43)
T PF08271_consen    7 GSKEIVFD-PERGELVCPNCGLVLE   30 (43)
T ss_dssp             SSSEEEEE-TTTTEEEETTT-BBEE
T ss_pred             cCCceEEc-CCCCeEECCCCCCEee
Confidence            33444444 3468899999998754


No 30 
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=73.55  E-value=4  Score=24.13  Aligned_cols=23  Identities=26%  Similarity=0.571  Sum_probs=14.1

Q ss_pred             EEEEcCC-CCeeecCCCCceeeec
Q psy1181          55 VYINLDK-PGNHSCGYCGLRFFKE   77 (82)
Q Consensus        55 Vyi~L~~-~~~~~CpYCG~~y~~~   77 (82)
                      .|.-+++ +..-+|-||++.|..+
T Consensus        25 ~F~v~~~~~~~~rC~YCe~~~~~~   48 (52)
T PF02748_consen   25 RFYVIDKEPIKLRCHYCERIITED   48 (52)
T ss_dssp             EEEEEETTTCEEEETTT--EEEHH
T ss_pred             eEEEEeCCCCEEEeeCCCCEeccc
Confidence            3433443 5678999999998754


No 31 
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=72.37  E-value=3.1  Score=26.49  Aligned_cols=36  Identities=31%  Similarity=0.503  Sum_probs=19.8

Q ss_pred             CceEeeCCCCCCCC-CCeEEEEcCCC---CeeecCCCCceeeec
Q psy1181          38 ERVVWCDGGSGPTG-HPKVYINLDKP---GNHSCGYCGLRFFKE   77 (82)
Q Consensus        38 ~r~v~C~Gg~~~lg-HP~Vyi~L~~~---~~~~CpYCG~~y~~~   77 (82)
                      ...+.|+==    + .--|-+.|++.   +...|..||..|...
T Consensus        20 ~~~F~CPfC----~~~~sV~v~idkk~~~~~~~C~~Cg~~~~~~   59 (81)
T PF05129_consen   20 PKVFDCPFC----NHEKSVSVKIDKKEGIGILSCRVCGESFQTK   59 (81)
T ss_dssp             SS----TTT------SS-EEEEEETTTTEEEEEESSS--EEEEE
T ss_pred             CceEcCCcC----CCCCeEEEEEEccCCEEEEEecCCCCeEEEc
Confidence            356777432    4 34578888875   568999999999764


No 32 
>PF13408 Zn_ribbon_recom:  Recombinase zinc beta ribbon domain
Probab=71.69  E-value=2.9  Score=23.45  Aligned_cols=15  Identities=33%  Similarity=0.857  Sum_probs=12.6

Q ss_pred             CeeecCCCCceeeec
Q psy1181          63 GNHSCGYCGLRFFKE   77 (82)
Q Consensus        63 ~~~~CpYCG~~y~~~   77 (82)
                      |...|++||..+...
T Consensus         4 g~l~C~~CG~~m~~~   18 (58)
T PF13408_consen    4 GLLRCGHCGSKMTRR   18 (58)
T ss_pred             CcEEcccCCcEeEEE
Confidence            678999999998764


No 33 
>PF14369 zf-RING_3:  zinc-finger
Probab=71.68  E-value=3.9  Score=22.30  Aligned_cols=14  Identities=21%  Similarity=0.543  Sum_probs=11.0

Q ss_pred             CeeecCCCCceeee
Q psy1181          63 GNHSCGYCGLRFFK   76 (82)
Q Consensus        63 ~~~~CpYCG~~y~~   76 (82)
                      ....||+|+..|+.
T Consensus        20 ~~~~CP~C~~gFvE   33 (35)
T PF14369_consen   20 SDVACPRCHGGFVE   33 (35)
T ss_pred             CCcCCcCCCCcEeE
Confidence            34579999999975


No 34 
>KOG1088|consensus
Probab=70.69  E-value=3.2  Score=28.99  Aligned_cols=18  Identities=28%  Similarity=0.364  Sum_probs=15.3

Q ss_pred             CCeeecCCCCceeeecCC
Q psy1181          62 PGNHSCGYCGLRFFKEDS   79 (82)
Q Consensus        62 ~~~~~CpYCG~~y~~~~~   79 (82)
                      +|...||.||+.|.-..|
T Consensus        96 EG~l~CpetG~vfpI~~G  113 (124)
T KOG1088|consen   96 EGELVCPETGRVFPISDG  113 (124)
T ss_pred             cceEecCCCCcEeecccC
Confidence            588999999999976654


No 35 
>PHA02768 hypothetical protein; Provisional
Probab=69.95  E-value=1.2  Score=27.02  Aligned_cols=13  Identities=31%  Similarity=0.833  Sum_probs=11.3

Q ss_pred             ecCCCCceeeecC
Q psy1181          66 SCGYCGLRFFKED   78 (82)
Q Consensus        66 ~CpYCG~~y~~~~   78 (82)
                      .|+.||++|....
T Consensus         7 ~C~~CGK~Fs~~~   19 (55)
T PHA02768          7 ECPICGEIYIKRK   19 (55)
T ss_pred             CcchhCCeeccHH
Confidence            7999999998765


No 36 
>PF08685 GON:  GON domain;  InterPro: IPR012314 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. The ADAMTSs (a disintegrin and metalloproteinase domain with thrombospondin type-1 modules) are a family of zinc dependent metalloproteinases that play important roles in a variety of normal and pathological conditions. These enzymes show a complex domain organisation including signal sequence, propeptide, metalloproteinase domain (see PDOC50215 from PROSITEDOC), disintegrin-like domain (see PDOC00351 from PROSITEDOC), central TS-1 motif (see PDOC50092 from PROSITEDOC), cysteine-rich region, and a variable number of TS-like repeats at the C-terminal region. The GON domain is an approximately 200-residue module, whose presence is the hallmark of a subfamily of structurally and evolutionarily related ADAMTSs, called GON- ADAMTSs. The GON domain is characterised by the presence of several conserved cysteine residues and is likely to be globular [], []. Some proteins known to contain a GON domain are listed below:  Mammalian ADAMTS-9 Mammalian ADAMTS-20  Caenorhabditis elegans gon-1, a protease required for gonadal morphogenesis   Proteins containing the GON domain belong to MEROPS peptidase subfamily M12B (adamalysin, clan MA).; GO: 0004222 metalloendopeptidase activity, 0008270 zinc ion binding
Probab=68.08  E-value=6.9  Score=29.19  Aligned_cols=33  Identities=30%  Similarity=0.663  Sum_probs=24.7

Q ss_pred             eEeeCCCCCCCCCCeEEEEcCCC--------------CeeecCCCCcee
Q psy1181          40 VVWCDGGSGPTGHPKVYINLDKP--------------GNHSCGYCGLRF   74 (82)
Q Consensus        40 ~v~C~Gg~~~lgHP~Vyi~L~~~--------------~~~~CpYCG~~y   74 (82)
                      .|.|-|  ++.+.|+.||+|.+.              .+..|||=|.+.
T Consensus        30 ~IYCh~--M~s~~PkEYltL~~G~~eNyae~y~~Rl~~~~~Cp~ng~~~   76 (201)
T PF08685_consen   30 KIYCHG--MASSTPKEYLTLPSGPQENYAEVYGKRLQNPSECPYNGSRR   76 (201)
T ss_pred             EEEcCC--CCCCCCceeEEcCCCCccchheecchhccCCCcCCCCCCCC
Confidence            589964  789999999999832              134699777664


No 37 
>PF01430 HSP33:  Hsp33 protein;  InterPro: IPR000397 Hsp33 is a molecular chaperone, distinguished from all other known chaperones by its mode of functional regulation. Its activity is redox regulated. Hsp33 is a cytoplasmically localized protein with highly reactive cysteines that respond quickly to changes in the redox environment. Oxidizing conditions like H2O2 cause disulphide bonds to form in Hsp33, a process that leads to the activation of its chaperone function [].; GO: 0051082 unfolded protein binding, 0006457 protein folding, 0005737 cytoplasm; PDB: 1VZY_B 1VQ0_A 1I7F_A 3M7M_X 1XJH_A 1HW7_A.
Probab=67.91  E-value=3.2  Score=31.24  Aligned_cols=14  Identities=21%  Similarity=0.795  Sum_probs=9.1

Q ss_pred             eeecCCCCceeeec
Q psy1181          64 NHSCGYCGLRFFKE   77 (82)
Q Consensus        64 ~~~CpYCG~~y~~~   77 (82)
                      +++|.|||++|..+
T Consensus       266 ev~C~fC~~~Y~f~  279 (280)
T PF01430_consen  266 EVTCEFCGKKYRFT  279 (280)
T ss_dssp             EEE-TTT--EEEEE
T ss_pred             EEEeeCCCCEEEeC
Confidence            57999999999864


No 38 
>PF03966 Trm112p:  Trm112p-like protein;  InterPro: IPR005651 This family of short proteins have no known function. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The entry contains 2 families:  Trm112, which is required for tRNA methylation in Saccharomyces cerevisiae (Baker's yeast) and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W []. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast []. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices []. UPF0434, which are proteins that are functionally uncharacterised.  ; PDB: 3Q87_A 2KPI_A 2K5R_A 2HF1_A 2JS4_A 2J6A_A 2JR6_A 2PK7_A 2JNY_A.
Probab=67.06  E-value=5.1  Score=24.13  Aligned_cols=18  Identities=28%  Similarity=0.584  Sum_probs=15.0

Q ss_pred             CCeeecCCCCceeeecCC
Q psy1181          62 PGNHSCGYCGLRFFKEDS   79 (82)
Q Consensus        62 ~~~~~CpYCG~~y~~~~~   79 (82)
                      +|.-.||-||+.|.-++|
T Consensus        51 eg~L~Cp~c~r~YPI~dG   68 (68)
T PF03966_consen   51 EGELICPECGREYPIRDG   68 (68)
T ss_dssp             TTEEEETTTTEEEEEETT
T ss_pred             CCEEEcCCCCCEEeCCCC
Confidence            588999999999976654


No 39 
>smart00647 IBR In Between Ring fingers. the domains occurs between pairs og RING fingers
Probab=66.04  E-value=9.3  Score=21.55  Aligned_cols=36  Identities=19%  Similarity=0.480  Sum_probs=21.2

Q ss_pred             cCceEeeCCCCCCCCCCeEEEEc--CCCCeeecCCCCceeee
Q psy1181          37 KERVVWCDGGSGPTGHPKVYINL--DKPGNHSCGYCGLRFFK   76 (82)
Q Consensus        37 ~~r~v~C~Gg~~~lgHP~Vyi~L--~~~~~~~CpYCG~~y~~   76 (82)
                      +.....|++.+=    ..+.+..  .....+.|+.||..|=.
T Consensus        15 ~~~~~~CP~~~C----~~~~~~~~~~~~~~v~C~~C~~~fC~   52 (64)
T smart00647       15 NPDLKWCPAPDC----SAAIIVTEEEGCNRVTCPKCGFSFCF   52 (64)
T ss_pred             CCCccCCCCCCC----cceEEecCCCCCCeeECCCCCCeECC
Confidence            345678985421    1112222  14567999999999854


No 40 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=65.67  E-value=4.8  Score=22.66  Aligned_cols=18  Identities=22%  Similarity=0.416  Sum_probs=12.7

Q ss_pred             EEEEcCCCCeeecCCCCc
Q psy1181          55 VYINLDKPGNHSCGYCGL   72 (82)
Q Consensus        55 Vyi~L~~~~~~~CpYCG~   72 (82)
                      ++..++.+....||.||.
T Consensus        17 ~~~~~~~~~~~~CP~Cg~   34 (52)
T TIGR02605        17 VLQKMSDDPLATCPECGG   34 (52)
T ss_pred             EEEecCCCCCCCCCCCCC
Confidence            344555556678999997


No 41 
>PF14353 CpXC:  CpXC protein
Probab=65.63  E-value=4.2  Score=26.88  Aligned_cols=15  Identities=33%  Similarity=0.704  Sum_probs=12.2

Q ss_pred             eeecCCCCceeeecC
Q psy1181          64 NHSCGYCGLRFFKED   78 (82)
Q Consensus        64 ~~~CpYCG~~y~~~~   78 (82)
                      ..+||.||..|....
T Consensus        38 ~~~CP~Cg~~~~~~~   52 (128)
T PF14353_consen   38 SFTCPSCGHKFRLEY   52 (128)
T ss_pred             EEECCCCCCceecCC
Confidence            479999999997653


No 42 
>TIGR03365 Bsubt_queE 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE. This uncharacterized enzyme, designated QueE, participates in the biosynthesis, from GTP, of 7-cyano-7-deazaguanosine, also called preQ0 because in many species it is a precursor of queuosine. In most Archaea, it is instead the precursor of a different tRNA modified base, archaeosine.
Probab=64.88  E-value=6.3  Score=28.85  Aligned_cols=34  Identities=15%  Similarity=0.331  Sum_probs=26.8

Q ss_pred             eeCCCCCCCCCCeEEEEcCCCCeeecCCCCceeee
Q psy1181          42 WCDGGSGPTGHPKVYINLDKPGNHSCGYCGLRFFK   76 (82)
Q Consensus        42 ~C~Gg~~~lgHP~Vyi~L~~~~~~~CpYCG~~y~~   76 (82)
                      +-.|-|.-.|-|.|||.+. .-..+|+||.+.+..
T Consensus        12 SiQGEG~~~G~~~~FvR~~-gCNlrC~~Cdt~~~~   45 (238)
T TIGR03365        12 TIQGEGMVIGQKTMFVRTG-GCDYRCSWCDSLFTW   45 (238)
T ss_pred             ccccCccccCCeEEEEEeC-CcCCcCcCCCCcccc
Confidence            5566655679999999987 457899999988743


No 43 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=64.24  E-value=2.6  Score=21.04  Aligned_cols=12  Identities=25%  Similarity=0.592  Sum_probs=8.7

Q ss_pred             CCeeecCCCCce
Q psy1181          62 PGNHSCGYCGLR   73 (82)
Q Consensus        62 ~~~~~CpYCG~~   73 (82)
                      ++..-|++||..
T Consensus        11 ~~~~fC~~CG~~   22 (23)
T PF13240_consen   11 DDAKFCPNCGTP   22 (23)
T ss_pred             CcCcchhhhCCc
Confidence            345679999875


No 44 
>PF14447 Prok-RING_4:  Prokaryotic RING finger family 4
Probab=64.21  E-value=3.2  Score=25.24  Aligned_cols=28  Identities=25%  Similarity=0.451  Sum_probs=18.8

Q ss_pred             CCCeEEEEcCCCCeeecCCCCceeeecC
Q psy1181          51 GHPKVYINLDKPGNHSCGYCGLRFFKED   78 (82)
Q Consensus        51 gHP~Vyi~L~~~~~~~CpYCG~~y~~~~   78 (82)
                      ||=.=.-..+.+...-||.||++|...+
T Consensus        26 gH~I~~~~f~~~rYngCPfC~~~~~~~~   53 (55)
T PF14447_consen   26 GHLICDNCFPGERYNGCPFCGTPFEFDD   53 (55)
T ss_pred             cceeeccccChhhccCCCCCCCcccCCC
Confidence            6644444444456688999999997653


No 45 
>PF06957 COPI_C:  Coatomer (COPI) alpha subunit C-terminus;  InterPro: IPR010714 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment. This traffic is bidirectional, to ensure that proteins required to form vesicles are recycled. Vesicles have specific coat proteins (such as clathrin or coatomer) that are important for cargo selection and direction of transfer []. While clathrin mediates endocytic protein transport, and transport from ER to Golgi, coatomers primarily mediate intra-Golgi transport, as well as the reverse Golgi to ER transport of dilysine-tagged proteins []. For example, the coatomer COP1 (coat protein complex 1) is responsible for reverse transport of recycled proteins from Golgi and pre-Golgi compartments back to the ER, while COPII buds vesicles from the ER to the Golgi []. Coatomers reversibly associate with Golgi (non-clathrin-coated) vesicles to mediate protein transport and for budding from Golgi membranes []. Activated small guanine triphosphatases (GTPases) attract coat proteins to specific membrane export sites, thereby linking coatomers to export cargos. As coat proteins polymerise, vesicles are formed and budded from membrane-bound organelles. Coatomer complexes also influence Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors. In mammals, coatomer complexes can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins. Coatomer complexes are hetero-oligomers composed of at least an alpha, beta, beta', gamma, delta, epsilon and zeta subunits.  This entry represents the C terminus (approximately 500 residues) of the eukaryotic coatomer alpha subunit [, ]. This domain is found along with the IPR006692 from INTERPRO domain. More information about these proteins can be found at Protein of the Month: Clathrin [].; GO: 0005198 structural molecule activity, 0005515 protein binding, 0006886 intracellular protein transport, 0016192 vesicle-mediated transport, 0030126 COPI vesicle coat; PDB: 3MKR_B 3MV2_E 3MKQ_B 3MV3_A.
Probab=63.02  E-value=4.9  Score=32.83  Aligned_cols=15  Identities=27%  Similarity=0.877  Sum_probs=9.0

Q ss_pred             CCeeecCCCCceeee
Q psy1181          62 PGNHSCGYCGLRFFK   76 (82)
Q Consensus        62 ~~~~~CpYCG~~y~~   76 (82)
                      ...+.|||||.+|.-
T Consensus       378 ~~~v~CP~cgA~y~~  392 (422)
T PF06957_consen  378 SPSVKCPYCGAKYHP  392 (422)
T ss_dssp             S-EEE-TTT--EEEG
T ss_pred             CCCeeCCCCCCccCh
Confidence            356899999999974


No 46 
>COG1281 Disulfide bond chaperones of the HSP33 family [Posttranslational modification, protein turnover, chaperones]
Probab=62.94  E-value=4.7  Score=31.48  Aligned_cols=16  Identities=19%  Similarity=0.841  Sum_probs=13.5

Q ss_pred             CeeecCCCCceeeecC
Q psy1181          63 GNHSCGYCGLRFFKED   78 (82)
Q Consensus        63 ~~~~CpYCG~~y~~~~   78 (82)
                      -++.|.+||++|..+.
T Consensus       265 iev~C~FC~~~Y~f~~  280 (286)
T COG1281         265 IEVTCEFCGTKYLFDE  280 (286)
T ss_pred             eEEEeeccCCEEecCH
Confidence            3589999999998764


No 47 
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=62.79  E-value=4.8  Score=23.36  Aligned_cols=41  Identities=20%  Similarity=0.213  Sum_probs=26.9

Q ss_pred             cCCCeeecCceEeeCCCCCCCCCCeEEEEcCCC-CeeecCCCCce
Q psy1181          30 EVPPKPCKERVVWCDGGSGPTGHPKVYINLDKP-GNHSCGYCGLR   73 (82)
Q Consensus        30 e~P~i~v~~r~v~C~Gg~~~lgHP~Vyi~L~~~-~~~~CpYCG~~   73 (82)
                      ..++..+.+.  .|.|-.. .--|.++..|... +...||+||+.
T Consensus        14 g~~va~v~~~--~C~gC~~-~l~~~~~~~i~~~~~i~~Cp~CgRi   55 (56)
T PF02591_consen   14 GVAVARVEGG--TCSGCHM-ELPPQELNEIRKGDEIVFCPNCGRI   55 (56)
T ss_pred             CcEEEEeeCC--ccCCCCE-EcCHHHHHHHHcCCCeEECcCCCcc
Confidence            4455566665  7876532 2456667777554 67999999974


No 48 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=61.79  E-value=5.8  Score=21.56  Aligned_cols=16  Identities=19%  Similarity=0.495  Sum_probs=11.9

Q ss_pred             eeecCCCCceeeecCC
Q psy1181          64 NHSCGYCGLRFFKEDS   79 (82)
Q Consensus        64 ~~~CpYCG~~y~~~~~   79 (82)
                      .++||-|+++|..++.
T Consensus         2 ~i~Cp~C~~~y~i~d~   17 (36)
T PF13717_consen    2 IITCPNCQAKYEIDDE   17 (36)
T ss_pred             EEECCCCCCEEeCCHH
Confidence            4678888888877653


No 49 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=60.75  E-value=3.6  Score=25.03  Aligned_cols=19  Identities=16%  Similarity=0.377  Sum_probs=10.1

Q ss_pred             EcCCCCeeecCCCCceeee
Q psy1181          58 NLDKPGNHSCGYCGLRFFK   76 (82)
Q Consensus        58 ~L~~~~~~~CpYCG~~y~~   76 (82)
                      .+....+.+||.|+..+.+
T Consensus        18 ~~~S~~PatCP~C~a~~~~   36 (54)
T PF09237_consen   18 KSQSEQPATCPICGAVIRQ   36 (54)
T ss_dssp             CCTTS--EE-TTT--EESS
T ss_pred             hhccCCCCCCCcchhhccc
Confidence            3445678999999998764


No 50 
>cd00498 Hsp33 Heat shock protein 33 (Hsp33):  Cytosolic protein that acts as a molecular chaperone under oxidative conditions.  In normal (reducing) cytosolic conditions, four conserved Cys residues are coordinated by a Zn ion.  Under oxidative stress (such as heat shock), the Cys are reversibly oxidized to disulfide bonds, which causes the chaperone activity to be turned on.  Hsp33 is homodimeric in its functional form.
Probab=60.32  E-value=5.3  Score=30.13  Aligned_cols=13  Identities=23%  Similarity=0.920  Sum_probs=11.5

Q ss_pred             eeecCCCCceeee
Q psy1181          64 NHSCGYCGLRFFK   76 (82)
Q Consensus        64 ~~~CpYCG~~y~~   76 (82)
                      +++|.|||+.|..
T Consensus       262 ev~C~FC~~~Y~f  274 (275)
T cd00498         262 EVTCEFCGEKYHF  274 (275)
T ss_pred             EEEEeCCCCEEec
Confidence            5899999999975


No 51 
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=60.24  E-value=5.5  Score=22.94  Aligned_cols=12  Identities=25%  Similarity=0.620  Sum_probs=6.3

Q ss_pred             eecCCCCceeee
Q psy1181          65 HSCGYCGLRFFK   76 (82)
Q Consensus        65 ~~CpYCG~~y~~   76 (82)
                      ..||-||+-|-.
T Consensus        21 ~~CPlC~r~l~~   32 (54)
T PF04423_consen   21 GCCPLCGRPLDE   32 (54)
T ss_dssp             EE-TTT--EE-H
T ss_pred             CcCCCCCCCCCH
Confidence            399999998853


No 52 
>PF12660 zf-TFIIIC:  Putative zinc-finger of transcription factor IIIC complex;  InterPro: IPR024764 This zinc-finger domain is at the very C terminus of a number of different TFIIIC subunit proteins. This domain might be involved in protein-DNA and/or protein-protein interactions [].; PDB: 2J04_C.
Probab=59.47  E-value=4.1  Score=26.63  Aligned_cols=43  Identities=19%  Similarity=0.409  Sum_probs=18.7

Q ss_pred             ecCceEeeCCCCCCCCCCeEEEEcCCCCeeecCCCCceeeecC
Q psy1181          36 CKERVVWCDGGSGPTGHPKVYINLDKPGNHSCGYCGLRFFKED   78 (82)
Q Consensus        36 v~~r~v~C~Gg~~~lgHP~Vyi~L~~~~~~~CpYCG~~y~~~~   78 (82)
                      -+.+.+.|..|.--.-=-.-|+.|...+...|+.||+++....
T Consensus        27 ~~~~~~~C~~GH~w~RC~lT~l~i~~~~~r~C~~C~~~~l~~~   69 (99)
T PF12660_consen   27 DDLDEAQCENGHVWPRCALTFLPIQTPGVRVCPVCGRRALDPE   69 (99)
T ss_dssp             --SSEEE-TTS-EEEB-SSS-SBS-SS-EEE-TTT--EEE-GG
T ss_pred             CCcCEeECCCCCEEeeeeeeeeeeccCCeeEcCCCCCEEecCc
Confidence            3445677865432000122367788888889999998886543


No 53 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=58.04  E-value=3.7  Score=20.70  Aligned_cols=12  Identities=33%  Similarity=0.924  Sum_probs=8.6

Q ss_pred             CCeeecCCCCce
Q psy1181          62 PGNHSCGYCGLR   73 (82)
Q Consensus        62 ~~~~~CpYCG~~   73 (82)
                      .+...||+||..
T Consensus        14 ~~~~fC~~CG~~   25 (26)
T PF13248_consen   14 PDAKFCPNCGAK   25 (26)
T ss_pred             cccccChhhCCC
Confidence            356678888875


No 54 
>PRK00114 hslO Hsp33-like chaperonin; Reviewed
Probab=57.96  E-value=6.5  Score=29.98  Aligned_cols=15  Identities=20%  Similarity=0.915  Sum_probs=12.8

Q ss_pred             eeecCCCCceeeecC
Q psy1181          64 NHSCGYCGLRFFKED   78 (82)
Q Consensus        64 ~~~CpYCG~~y~~~~   78 (82)
                      +++|.||++.|....
T Consensus       268 ev~C~FC~~~Y~f~~  282 (293)
T PRK00114        268 EMVCQFCGNKYLFDE  282 (293)
T ss_pred             EEEEeCCCCEEEeCH
Confidence            589999999998753


No 55 
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=57.82  E-value=7.9  Score=23.39  Aligned_cols=16  Identities=19%  Similarity=0.488  Sum_probs=12.8

Q ss_pred             CCCeeecCCCCceeee
Q psy1181          61 KPGNHSCGYCGLRFFK   76 (82)
Q Consensus        61 ~~~~~~CpYCG~~y~~   76 (82)
                      ++..+.||-||+.|-+
T Consensus        18 ~dDiVvCp~CgapyHR   33 (54)
T PF14446_consen   18 GDDIVVCPECGAPYHR   33 (54)
T ss_pred             CCCEEECCCCCCcccH
Confidence            4568999999998854


No 56 
>PF15616 TerY-C:  TerY-C metal binding domain
Probab=57.54  E-value=6.8  Score=27.36  Aligned_cols=21  Identities=24%  Similarity=0.469  Sum_probs=15.2

Q ss_pred             EEcCCCCeeecCCCCceeeec
Q psy1181          57 INLDKPGNHSCGYCGLRFFKE   77 (82)
Q Consensus        57 i~L~~~~~~~CpYCG~~y~~~   77 (82)
                      +=++.++.++||+||..=...
T Consensus        98 ~Ci~g~~~~~CPwCg~~g~~~  118 (131)
T PF15616_consen   98 FCIDGEGEVTCPWCGNEGSFG  118 (131)
T ss_pred             EEeCCCCCEECCCCCCeeeec
Confidence            345667789999999875443


No 57 
>KOG2462|consensus
Probab=57.31  E-value=5.8  Score=31.05  Aligned_cols=21  Identities=33%  Similarity=0.708  Sum_probs=13.9

Q ss_pred             EcCCCCeeecCCCCceeeecC
Q psy1181          58 NLDKPGNHSCGYCGLRFFKED   78 (82)
Q Consensus        58 ~L~~~~~~~CpYCG~~y~~~~   78 (82)
                      .|+......|+|||++|+.-+
T Consensus       155 ~~~s~ka~~C~~C~K~YvSmp  175 (279)
T KOG2462|consen  155 SLDSKKAFSCKYCGKVYVSMP  175 (279)
T ss_pred             cccccccccCCCCCceeeehH
Confidence            344445567888888887543


No 58 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=57.12  E-value=9.4  Score=21.15  Aligned_cols=18  Identities=22%  Similarity=0.501  Sum_probs=13.9

Q ss_pred             EEEEcCCCCeeecCCCCc
Q psy1181          55 VYINLDKPGNHSCGYCGL   72 (82)
Q Consensus        55 Vyi~L~~~~~~~CpYCG~   72 (82)
                      +...+..+....||-||.
T Consensus        17 ~~~~~~~~~~~~CP~Cg~   34 (42)
T PF09723_consen   17 VLQSISEDDPVPCPECGS   34 (42)
T ss_pred             EEEEcCCCCCCcCCCCCC
Confidence            455666667789999998


No 59 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=55.88  E-value=11  Score=25.85  Aligned_cols=45  Identities=18%  Similarity=0.265  Sum_probs=25.6

Q ss_pred             eeecCceEeeCCCCCCCCCCeEEEEc-CCCCeeecCCCCceeeecCC
Q psy1181          34 KPCKERVVWCDGGSGPTGHPKVYINL-DKPGNHSCGYCGLRFFKEDS   79 (82)
Q Consensus        34 i~v~~r~v~C~Gg~~~lgHP~Vyi~L-~~~~~~~CpYCG~~y~~~~~   79 (82)
                      .+.+.....|+.-+.-.. -...+.+ +.++...||+||......+.
T Consensus        93 ~e~~~~~Y~Cp~C~~~y~-~~ea~~~~d~~~~f~Cp~Cg~~l~~~dn  138 (147)
T smart00531       93 DETNNAYYKCPNCQSKYT-FLEANQLLDMDGTFTCPRCGEELEEDDN  138 (147)
T ss_pred             cccCCcEEECcCCCCEee-HHHHHHhcCCCCcEECCCCCCEEEEcCc
Confidence            345666788975432111 0011122 34566999999998876653


No 60 
>smart00355 ZnF_C2H2 zinc finger.
Probab=54.62  E-value=4.8  Score=18.28  Aligned_cols=12  Identities=33%  Similarity=0.722  Sum_probs=9.8

Q ss_pred             ecCCCCceeeec
Q psy1181          66 SCGYCGLRFFKE   77 (82)
Q Consensus        66 ~CpYCG~~y~~~   77 (82)
                      .|+.|+..|...
T Consensus         2 ~C~~C~~~f~~~   13 (26)
T smart00355        2 RCPECGKVFKSK   13 (26)
T ss_pred             CCCCCcchhCCH
Confidence            599999998654


No 61 
>TIGR00240 ATCase_reg aspartate carbamoyltransferase, regulatory subunit. The presence of this regulatory subunit allows feedback inhibition by CTP on aspartate carbamoyltransferase, the first step in the synthesis of CTP from aspartate. In many species, this regulatory subunit is not present. In Thermotoga maritima, the catalytic and regulatory subunits are encoded by a fused gene and the regulatory region has enough sequence differences to score below the trusted cutoff.
Probab=54.04  E-value=14  Score=26.45  Aligned_cols=40  Identities=15%  Similarity=0.214  Sum_probs=25.3

Q ss_pred             CceEeeCCCCC---CCCCCeEEEEcCCC--CeeecCCCCceeeec
Q psy1181          38 ERVVWCDGGSG---PTGHPKVYINLDKP--GNHSCGYCGLRFFKE   77 (82)
Q Consensus        38 ~r~v~C~Gg~~---~lgHP~Vyi~L~~~--~~~~CpYCG~~y~~~   77 (82)
                      ..++.|+.+.=   .-.=+..|.-++++  ..-+|-||++.|..+
T Consensus       101 ~gi~kC~Np~CIT~~E~v~~~F~v~~~~~~~~lrC~YCe~~~~~~  145 (150)
T TIGR00240       101 EGVLKCPNPNCISNAEPVSSKFYVRSEEPDIALRCYYCEKEIEHN  145 (150)
T ss_pred             eeeEECCCCCCccCCCCCCcEEEEecCCCceEEEEECCCCEEecc
Confidence            34688876532   11234556555655  368999999999754


No 62 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=53.66  E-value=13  Score=19.54  Aligned_cols=13  Identities=23%  Similarity=0.414  Sum_probs=9.9

Q ss_pred             CCeeecCCCCcee
Q psy1181          62 PGNHSCGYCGLRF   74 (82)
Q Consensus        62 ~~~~~CpYCG~~y   74 (82)
                      .....||.||...
T Consensus        24 ~~~~~CP~Cg~~~   36 (41)
T smart00834       24 DPLATCPECGGDV   36 (41)
T ss_pred             CCCCCCCCCCCcc
Confidence            4567899999854


No 63 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=52.77  E-value=9.2  Score=22.88  Aligned_cols=15  Identities=27%  Similarity=0.698  Sum_probs=11.0

Q ss_pred             CeeecCCCCceeeec
Q psy1181          63 GNHSCGYCGLRFFKE   77 (82)
Q Consensus        63 ~~~~CpYCG~~y~~~   77 (82)
                      ....|.+|+..|...
T Consensus        49 ~~~~C~~C~~~f~s~   63 (100)
T PF12756_consen   49 ESFRCPYCNKTFRSR   63 (100)
T ss_dssp             SSEEBSSSS-EESSH
T ss_pred             CCCCCCccCCCCcCH
Confidence            358999999999643


No 64 
>TIGR03829 YokU_near_AblA uncharacterized protein, YokU family. Members of this protein family occur in various species of the genus Bacillus, always next to the gene (kamA or ablA) for lysine 2,3-aminomutase. Members have a pair of CXXC motifs, and share homology to the amino-terminal region of a family of putative transcription factors for which the C-terminal is modeled by pfam01381, a helix-turn-helix domain model. This family, however, is shorter and lacks the helix-turn-helix region. The function of this protein family is unknown, but a regulatory role in compatible solute biosynthesis is suggested by local genome context.
Probab=52.54  E-value=15  Score=24.22  Aligned_cols=37  Identities=24%  Similarity=0.638  Sum_probs=26.3

Q ss_pred             EeeCCCCCCCCCCeEEEEcCCC---------CeeecCCCCceeeec
Q psy1181          41 VWCDGGSGPTGHPKVYINLDKP---------GNHSCGYCGLRFFKE   77 (82)
Q Consensus        41 v~C~Gg~~~lgHP~Vyi~L~~~---------~~~~CpYCG~~y~~~   77 (82)
                      ..|.|+....|-=.+++++.+.         -...|+-||-.|..+
T Consensus         3 ~~C~~~~~~~~~tTv~~el~~G~~~IvIknVPa~~C~~CGe~y~~d   48 (89)
T TIGR03829         3 RWCEEEKAIARTTTVYWELPDGTKAIEIKETPSISCSHCGMEYQDD   48 (89)
T ss_pred             cccCCCceecceEEEEEEecCCceEEEEecCCcccccCCCcEeecH
Confidence            3687766556777888888542         125799999999764


No 65 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=50.85  E-value=9.3  Score=18.47  Aligned_cols=13  Identities=31%  Similarity=0.675  Sum_probs=10.6

Q ss_pred             eecCCCCceeeec
Q psy1181          65 HSCGYCGLRFFKE   77 (82)
Q Consensus        65 ~~CpYCG~~y~~~   77 (82)
                      ..|..|+..|...
T Consensus         2 ~~C~~C~~~F~~~   14 (27)
T PF13912_consen    2 FECDECGKTFSSL   14 (27)
T ss_dssp             EEETTTTEEESSH
T ss_pred             CCCCccCCccCCh
Confidence            4799999999653


No 66 
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=50.02  E-value=18  Score=25.35  Aligned_cols=28  Identities=29%  Similarity=0.564  Sum_probs=20.0

Q ss_pred             eeCCCCCCCCCCeEEEEcCCCCeeecCCCCceeeec
Q psy1181          42 WCDGGSGPTGHPKVYINLDKPGNHSCGYCGLRFFKE   77 (82)
Q Consensus        42 ~C~Gg~~~lgHP~Vyi~L~~~~~~~CpYCG~~y~~~   77 (82)
                      .|+--+.||     | .  ++|.+.||-||.+++..
T Consensus        30 hCp~Cg~PL-----F-~--KdG~v~CPvC~~~~~~v   57 (131)
T COG1645          30 HCPKCGTPL-----F-R--KDGEVFCPVCGYREVVV   57 (131)
T ss_pred             hCcccCCcc-----e-e--eCCeEECCCCCceEEEe
Confidence            576555566     2 2  89999999999776543


No 67 
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=48.80  E-value=9.5  Score=21.16  Aligned_cols=16  Identities=25%  Similarity=0.509  Sum_probs=10.3

Q ss_pred             CeeecCCCCceeeecC
Q psy1181          63 GNHSCGYCGLRFFKED   78 (82)
Q Consensus        63 ~~~~CpYCG~~y~~~~   78 (82)
                      -+..|++|+..|=.++
T Consensus        12 ~~~~C~~C~~~FC~~H   27 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLKH   27 (43)
T ss_dssp             SHEE-TTTS-EE-TTT
T ss_pred             CCeECCCCCcccCccc
Confidence            3678999999997655


No 68 
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=48.40  E-value=21  Score=19.43  Aligned_cols=25  Identities=20%  Similarity=0.385  Sum_probs=13.6

Q ss_pred             CCCeEEEEcC--CCCeeecCCCCceee
Q psy1181          51 GHPKVYINLD--KPGNHSCGYCGLRFF   75 (82)
Q Consensus        51 gHP~Vyi~L~--~~~~~~CpYCG~~y~   75 (82)
                      |+|..+.-++  ......|+=||....
T Consensus         7 G~~l~~~ip~gd~r~R~vC~~Cg~IhY   33 (34)
T PF14803_consen    7 GGPLERRIPEGDDRERLVCPACGFIHY   33 (34)
T ss_dssp             --B-EEE--TT-SS-EEEETTTTEEE-
T ss_pred             cChhhhhcCCCCCccceECCCCCCEEe
Confidence            7777777773  345689999997653


No 69 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=47.58  E-value=9.5  Score=18.83  Aligned_cols=12  Identities=33%  Similarity=0.642  Sum_probs=10.1

Q ss_pred             ecCCCCceeeec
Q psy1181          66 SCGYCGLRFFKE   77 (82)
Q Consensus        66 ~CpYCG~~y~~~   77 (82)
                      .|.+|++.|...
T Consensus         3 ~C~~C~k~f~~~   14 (27)
T PF12171_consen    3 YCDACDKYFSSE   14 (27)
T ss_dssp             BBTTTTBBBSSH
T ss_pred             CcccCCCCcCCH
Confidence            699999999754


No 70 
>PHA00616 hypothetical protein
Probab=47.43  E-value=3.9  Score=23.75  Aligned_cols=13  Identities=38%  Similarity=0.654  Sum_probs=10.9

Q ss_pred             ecCCCCceeeecC
Q psy1181          66 SCGYCGLRFFKED   78 (82)
Q Consensus        66 ~CpYCG~~y~~~~   78 (82)
                      .|+-||..|..+.
T Consensus         3 qC~~CG~~F~~~s   15 (44)
T PHA00616          3 QCLRCGGIFRKKK   15 (44)
T ss_pred             ccchhhHHHhhHH
Confidence            6999999998654


No 71 
>PRK13376 pyrB bifunctional aspartate carbamoyltransferase catalytic subunit/aspartate carbamoyltransferase regulatory subunit; Provisional
Probab=47.09  E-value=46  Score=27.95  Aligned_cols=36  Identities=22%  Similarity=0.474  Sum_probs=23.6

Q ss_pred             EeeCCCCCCC----C--CCeEEEEcCCCCeeecCCCCceeeec
Q psy1181          41 VWCDGGSGPT----G--HPKVYINLDKPGNHSCGYCGLRFFKE   77 (82)
Q Consensus        41 v~C~Gg~~~l----g--HP~Vyi~L~~~~~~~CpYCG~~y~~~   77 (82)
                      +.|..+.=-.    +  =+..|.-. ..+.-+|.||++.|..+
T Consensus       479 ~~C~Np~CIt~~~~~e~~~~~F~~~-~~~~~~C~YCe~~~~~~  520 (525)
T PRK13376        479 LRCKNENCITNPAHGENVSASFVRN-EKGRFVCEYCETPHTFE  520 (525)
T ss_pred             EEeCCCCCcCCCCCCCcCCceEEEc-cCCEEEeeCCCCEeccc
Confidence            8997653211    1  24456555 45589999999999754


No 72 
>KOG1074|consensus
Probab=46.76  E-value=6.4  Score=35.26  Aligned_cols=36  Identities=25%  Similarity=0.455  Sum_probs=24.7

Q ss_pred             CceEeeCCCCCCC-CCCeEEEEcCCCCeeecCCCCceeeecCC
Q psy1181          38 ERVVWCDGGSGPT-GHPKVYINLDKPGNHSCGYCGLRFFKEDS   79 (82)
Q Consensus        38 ~r~v~C~Gg~~~l-gHP~Vyi~L~~~~~~~CpYCG~~y~~~~~   79 (82)
                      -|+++|..   +| .|   |=+-..+.+.+|+.||+.|.-++-
T Consensus       612 ~rVlSC~s---aLqmH---yrtHtGERPFkCKiCgRAFtTkGN  648 (958)
T KOG1074|consen  612 LRVLSCPS---ALQMH---YRTHTGERPFKCKICGRAFTTKGN  648 (958)
T ss_pred             eecccchh---hhhhh---hhcccCcCccccccccchhccccc
Confidence            46777753   44 44   444444567899999999988873


No 73 
>COG1781 PyrI Aspartate carbamoyltransferase, regulatory subunit [Nucleotide transport and metabolism]
Probab=46.48  E-value=18  Score=26.15  Aligned_cols=41  Identities=27%  Similarity=0.524  Sum_probs=24.6

Q ss_pred             CceEeeCCCCCCC--C---CCeEEEEcCCCCeeecCCCCceeeecC
Q psy1181          38 ERVVWCDGGSGPT--G---HPKVYINLDKPGNHSCGYCGLRFFKED   78 (82)
Q Consensus        38 ~r~v~C~Gg~~~l--g---HP~Vyi~L~~~~~~~CpYCG~~y~~~~   78 (82)
                      ..++.|+..+=..  .   -++-++.=+++...+|.||++.|..+.
T Consensus       104 ~gvlkCpN~nCITn~e~pv~s~F~~~~~~~~~lrC~YCe~~~~~~~  149 (153)
T COG1781         104 EGVLRCPNPNCITNAEEPVESKFYVVSKEPLALRCKYCEKTFSEDE  149 (153)
T ss_pred             ccEEEcCCCCcccCCCccCCccEEEEecCCcEEEEEecCcEechhh
Confidence            4568998764222  1   122333333455689999999987553


No 74 
>PRK11827 hypothetical protein; Provisional
Probab=45.65  E-value=34  Score=20.90  Aligned_cols=34  Identities=24%  Similarity=0.374  Sum_probs=23.3

Q ss_pred             eEeeCCCCCCCCCCeEEEEcCCCCeeecCCCCceeeecCC
Q psy1181          40 VVWCDGGSGPTGHPKVYINLDKPGNHSCGYCGLRFFKEDS   79 (82)
Q Consensus        40 ~v~C~Gg~~~lgHP~Vyi~L~~~~~~~CpYCG~~y~~~~~   79 (82)
                      +++|+.-.++|    .| + .....-.|.-||+.|.-+++
T Consensus         8 ILaCP~ckg~L----~~-~-~~~~~Lic~~~~laYPI~dg   41 (60)
T PRK11827          8 IIACPVCNGKL----WY-N-QEKQELICKLDNLAFPLRDG   41 (60)
T ss_pred             heECCCCCCcC----eE-c-CCCCeEECCccCeeccccCC
Confidence            57898765555    33 2 12456789999999976654


No 75 
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=45.44  E-value=26  Score=20.90  Aligned_cols=14  Identities=21%  Similarity=0.358  Sum_probs=11.3

Q ss_pred             CeeecCCCCceeee
Q psy1181          63 GNHSCGYCGLRFFK   76 (82)
Q Consensus        63 ~~~~CpYCG~~y~~   76 (82)
                      ..+.||-||..|..
T Consensus        21 eiV~Cp~CGaeleV   34 (54)
T TIGR01206        21 ELVICDECGAELEV   34 (54)
T ss_pred             CEEeCCCCCCEEEE
Confidence            46899999998854


No 76 
>PRK01402 hslO Hsp33-like chaperonin; Reviewed
Probab=45.28  E-value=14  Score=28.99  Aligned_cols=15  Identities=13%  Similarity=0.545  Sum_probs=12.8

Q ss_pred             eeecCCCCceeeecC
Q psy1181          64 NHSCGYCGLRFFKED   78 (82)
Q Consensus        64 ~~~CpYCG~~y~~~~   78 (82)
                      +++|.+||++|..+.
T Consensus       308 ev~CeFC~~~Y~f~~  322 (328)
T PRK01402        308 SVTCEFCSRVYRFDP  322 (328)
T ss_pred             EEEeeCCCCEEEeCH
Confidence            589999999998753


No 77 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=45.21  E-value=9.3  Score=19.63  Aligned_cols=13  Identities=31%  Similarity=0.680  Sum_probs=9.9

Q ss_pred             CeeecCCCCceee
Q psy1181          63 GNHSCGYCGLRFF   75 (82)
Q Consensus        63 ~~~~CpYCG~~y~   75 (82)
                      ....||.||-.|.
T Consensus        13 ~~~~Cp~CG~~F~   25 (26)
T PF10571_consen   13 SAKFCPHCGYDFE   25 (26)
T ss_pred             hcCcCCCCCCCCc
Confidence            3468999998874


No 78 
>PRK00893 aspartate carbamoyltransferase regulatory subunit; Reviewed
Probab=45.02  E-value=21  Score=25.53  Aligned_cols=41  Identities=22%  Similarity=0.336  Sum_probs=25.1

Q ss_pred             CceEeeCCCCCC----CCCCeEEEEcCCC-CeeecCCCCceeeecC
Q psy1181          38 ERVVWCDGGSGP----TGHPKVYINLDKP-GNHSCGYCGLRFFKED   78 (82)
Q Consensus        38 ~r~v~C~Gg~~~----lgHP~Vyi~L~~~-~~~~CpYCG~~y~~~~   78 (82)
                      ..++.|+.+.=-    -.=+..|.-+++. ..-+|-||++.|..+.
T Consensus       103 ~gi~kC~Np~CITn~~E~v~~~F~v~~~~~~~~rC~YCe~~~~~~~  148 (152)
T PRK00893        103 EGVLKCPNPNCITNTNEPVESRFYVVDKEPIKLRCKYCEKEFSEDI  148 (152)
T ss_pred             cceEECCCCCCcCCCCcCcCcEEEEEeCCCCEEEeeCCCCEechhh
Confidence            446889765311    1123345445543 5689999999997654


No 79 
>PF01485 IBR:  IBR domain;  InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a cysteine-rich (C6HC) zinc finger domain that is present in Triad1, and which is conserved in other proteins encoded by various eukaryotes. The C6HC consensus pattern is:  C-x(4)-C-x(14-30)-C-x(1-4)-C-x(4)-C-x(2)-C-x(4)-H-x(4)-C  The C6HC zinc finger motif is the fourth family member of the zinc-binding RING, LIM, and LAP/PHD fingers. Strikingly, in most of the proteins the C6HC domain is flanked by two RING finger structures IPR001841 from INTERPRO. The novel C6HC motif has been called DRIL (double RING finger linked). The strong conservation of the larger tripartite TRIAD (twoRING fingers and DRIL) structure indicates that the three subdomains are functionally linked and identifies a novel class of proteins []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CT7_A 1WD2_A 2JMO_A 1WIM_A.
Probab=44.80  E-value=12  Score=20.96  Aligned_cols=12  Identities=33%  Similarity=0.780  Sum_probs=9.6

Q ss_pred             eeecCCCCceee
Q psy1181          64 NHSCGYCGLRFF   75 (82)
Q Consensus        64 ~~~CpYCG~~y~   75 (82)
                      .+.|+.|+..|=
T Consensus        40 ~~~C~~C~~~fC   51 (64)
T PF01485_consen   40 IVTCPSCGTEFC   51 (64)
T ss_dssp             -CCTTSCCSEEC
T ss_pred             eeECCCCCCcCc
Confidence            389999999883


No 80 
>PF06226 DUF1007:  Protein of unknown function (DUF1007);  InterPro: IPR010412 This is a family of conserved bacterial proteins with unknown function.
Probab=44.41  E-value=15  Score=26.65  Aligned_cols=15  Identities=33%  Similarity=0.556  Sum_probs=12.1

Q ss_pred             CCCCCCCCeEEEEcC
Q psy1181          46 GSGPTGHPKVYINLD   60 (82)
Q Consensus        46 g~~~lgHP~Vyi~L~   60 (82)
                      ...+..||.|||++.
T Consensus        13 ~~~a~AHPHvfId~~   27 (212)
T PF06226_consen   13 PSPAFAHPHVFIDAR   27 (212)
T ss_pred             ccccccCCcEEEEEE
Confidence            345789999999975


No 81 
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=43.81  E-value=13  Score=20.19  Aligned_cols=14  Identities=21%  Similarity=0.451  Sum_probs=9.8

Q ss_pred             eeecCCCCceeeec
Q psy1181          64 NHSCGYCGLRFFKE   77 (82)
Q Consensus        64 ~~~CpYCG~~y~~~   77 (82)
                      +..||+||..=...
T Consensus         2 ~~~Cp~Cg~~~~~~   15 (47)
T PF14690_consen    2 PPRCPHCGSPSVHR   15 (47)
T ss_pred             CccCCCcCCCceEC
Confidence            46899999664443


No 82 
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=43.60  E-value=15  Score=25.12  Aligned_cols=27  Identities=22%  Similarity=0.249  Sum_probs=15.0

Q ss_pred             CeEEEEcCCCCeeecCCCCce-eeecCC
Q psy1181          53 PKVYINLDKPGNHSCGYCGLR-FFKEDS   79 (82)
Q Consensus        53 P~Vyi~L~~~~~~~CpYCG~~-y~~~~~   79 (82)
                      |.-|++.-......||+||.. +....|
T Consensus        96 ~~~~~~~~~~~~~~CP~Cgs~~~~i~~G  123 (135)
T PRK03824         96 AIHFIPEVVHAFLKCPKCGSRDFEIVKG  123 (135)
T ss_pred             cccccccccccCcCCcCCCCCCcEEecC
Confidence            334444333344679999975 444443


No 83 
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=43.11  E-value=9.4  Score=29.68  Aligned_cols=17  Identities=29%  Similarity=0.630  Sum_probs=14.1

Q ss_pred             CCeeecCCCCceeeecC
Q psy1181          62 PGNHSCGYCGLRFFKED   78 (82)
Q Consensus        62 ~~~~~CpYCG~~y~~~~   78 (82)
                      .+.+.||.|++.|+.+.
T Consensus        17 kk~ieCPvC~tkFkkee   33 (267)
T COG1655          17 KKTIECPVCNTKFKKEE   33 (267)
T ss_pred             hceeccCcccchhhhhh
Confidence            35789999999998764


No 84 
>PHA03296 envelope glycoprotein H; Provisional
Probab=42.55  E-value=26  Score=31.01  Aligned_cols=25  Identities=20%  Similarity=0.365  Sum_probs=17.8

Q ss_pred             CCCeEEEEcCCCCeeecCCCCceeee
Q psy1181          51 GHPKVYINLDKPGNHSCGYCGLRFFK   76 (82)
Q Consensus        51 gHP~Vyi~L~~~~~~~CpYCG~~y~~   76 (82)
                      -=|.+++|+.. ....|+|||..|.+
T Consensus       681 kIp~v~LN~t~-~~k~C~yCGSVfLR  705 (814)
T PHA03296        681 KIEDGHLNLHG-AAIACILCGHAILQ  705 (814)
T ss_pred             cccceeecCCC-CCCcCCcCCEEEEE
Confidence            34567777764 35789999998854


No 85 
>PF04475 DUF555:  Protein of unknown function (DUF555);  InterPro: IPR007564 This is a family of uncharacterised, hypothetical archaeal proteins.
Probab=42.54  E-value=15  Score=24.94  Aligned_cols=19  Identities=26%  Similarity=0.786  Sum_probs=14.1

Q ss_pred             EEEEcCCCCeeecCCCCcee
Q psy1181          55 VYINLDKPGNHSCGYCGLRF   74 (82)
Q Consensus        55 Vyi~L~~~~~~~CpYCG~~y   74 (82)
                      -|..++ -|...||+||.-+
T Consensus        39 ~~VeIe-vG~~~cP~Cge~~   57 (102)
T PF04475_consen   39 DYVEIE-VGDTICPKCGEEL   57 (102)
T ss_pred             CeEEEe-cCcccCCCCCCcc
Confidence            366665 4778999999765


No 86 
>cd03528 Rieske_RO_ferredoxin Rieske non-heme iron oxygenase (RO) family, Rieske ferredoxin component; composed of the Rieske ferredoxin component of some three-component RO systems including biphenyl dioxygenase (BPDO) and carbazole 1,9a-dioxygenase (CARDO). The RO family comprise a large class of aromatic ring-hydroxylating dioxygenases found predominantly in microorganisms. These enzymes enable microorganisms to tolerate and even exclusively utilize aromatic compounds for growth. ROs consist of two or three components: reductase, oxygenase, and ferredoxin (in some cases) components. The ferredoxin component contains either a plant-type or Rieske-type [2Fe-2S] cluster. The Rieske ferredoxin component in this family carries an electron from the RO reductase component to the terminal RO oxygenase component. BPDO degrades biphenyls and polychlorinated biphenyls. BPDO ferredoxin (BphF) has structural features consistent with a minimal and perhaps archetypical Rieske protein in that the in
Probab=42.34  E-value=48  Score=20.20  Aligned_cols=18  Identities=28%  Similarity=0.325  Sum_probs=15.2

Q ss_pred             CCeeecCCCCceeeecCC
Q psy1181          62 PGNHSCGYCGLRFFKEDS   79 (82)
Q Consensus        62 ~~~~~CpYCG~~y~~~~~   79 (82)
                      .+...|||-|.+|-++.|
T Consensus        55 ~~~i~Cp~Hg~~fd~~~G   72 (98)
T cd03528          55 GGVIECPLHGGRFDLRTG   72 (98)
T ss_pred             CCEEEeCCcCCEEECCCC
Confidence            468999999999998554


No 87 
>PF02489 Herpes_glycop_H:  Herpesvirus glycoprotein H;  InterPro: IPR003493 Herpesviruses are enveloped by a lipid bilayer that contains at least a dozen glycoproteins. The virion surface glycoproteins mediate recognition of susceptible cells and promote fusion of the viral envelope with the cell membrane, leading to virus entry. No single glycoprotein associated with the virion membrane has been identified as the fusogen []. Glycoprotein L (gL) forms a non-covalently linked heterodimer with glycoprotein H (gH). This heterodimer is essential for virus-cell and cell-cell fusion since the association of gH and gL is necessary for correct localisation of gH to the virion or cell surface. gH anchoring the heterodimer to the plasma membrane through its transmembrane domain. gL lacks a transmembrane domain and is secreted from cells when expressed in the absence of gH []. This entry represents Herpesvirus glycoprotein H (gH), which is a virion associated envelope glycoprotein []. Heterodimer formation between gH and gL has been demonstrated in both virions and infected cells []. Heterodimer formation between gL and gH is important for the proper folding of gH and its insertion into the membrane because the anti-gH conformation-dependent monoclonal antibodies (mAbs) 53S and LP11 bind gH only when gL is present [, ].; PDB: 3PHF_S 3M1C_A 2LQY_A 2XQY_A.
Probab=42.15  E-value=15  Score=30.78  Aligned_cols=33  Identities=30%  Similarity=0.760  Sum_probs=13.8

Q ss_pred             EeeCCCCCC---CCCCeEEEEcCCCCeeecCCCCceeee
Q psy1181          41 VWCDGGSGP---TGHPKVYINLDKPGNHSCGYCGLRFFK   76 (82)
Q Consensus        41 v~C~Gg~~~---lgHP~Vyi~L~~~~~~~CpYCG~~y~~   76 (82)
                      -.|....+.   .-=|++| |+.  -...|+|||..|..
T Consensus       538 ~~C~~~~~~~~~~~i~~~~-Nit--~~~~C~~Cgsv~l~  573 (657)
T PF02489_consen  538 STCSSSTGIIETRRIPVVY-NIT--PSKDCPFCGSVFLR  573 (657)
T ss_dssp             T-S-CCEE-SEEEE--EE---SS--S-SS-STTT-EEEE
T ss_pred             CCCcCCCCCCCccccCCCc-CCC--CCCCCCCCCcEEEE
Confidence            357654321   2335555 655  35689999998853


No 88 
>PF01844 HNH:  HNH endonuclease;  InterPro: IPR002711 HNH endonuclease is found in bacteria and viruses [, , ]. This family includes pyocins, colicins and anaredoxins.; GO: 0003676 nucleic acid binding, 0004519 endonuclease activity; PDB: 2QGP_C.
Probab=41.98  E-value=11  Score=20.21  Aligned_cols=11  Identities=36%  Similarity=0.812  Sum_probs=4.7

Q ss_pred             cCCCCceeeec
Q psy1181          67 CGYCGLRFFKE   77 (82)
Q Consensus        67 CpYCG~~y~~~   77 (82)
                      |+|||..+...
T Consensus         1 C~~C~~~~~~~   11 (47)
T PF01844_consen    1 CQYCGKPGSDN   11 (47)
T ss_dssp             -TTT--B--GG
T ss_pred             CCCCCCcCccC
Confidence            89999998554


No 89 
>KOG1729|consensus
Probab=41.86  E-value=9.9  Score=29.58  Aligned_cols=31  Identities=23%  Similarity=0.555  Sum_probs=24.3

Q ss_pred             CCCCeEEEEcCCCCeeecCCCCc-eeeecCCCCC
Q psy1181          50 TGHPKVYINLDKPGNHSCGYCGL-RFFKEDSHHH   82 (82)
Q Consensus        50 lgHP~Vyi~L~~~~~~~CpYCG~-~y~~~~~~~h   82 (82)
                      ..|..+||.  .+....|.+|+. .|.+-.-.||
T Consensus       156 ~~~~~~W~P--D~ea~~C~~C~~~~Ftl~~RRHH  187 (288)
T KOG1729|consen  156 NNSAAVWLP--DSEATECMVCGCTEFTLSERRHH  187 (288)
T ss_pred             CCcCCcccC--cccceecccCCCccccHHHHHHH
Confidence            478888987  456789999999 8887765554


No 90 
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=41.22  E-value=12  Score=19.99  Aligned_cols=15  Identities=33%  Similarity=0.773  Sum_probs=4.8

Q ss_pred             eecCCCCceeeecCC
Q psy1181          65 HSCGYCGLRFFKEDS   79 (82)
Q Consensus        65 ~~CpYCG~~y~~~~~   79 (82)
                      -.||.||..|.+.++
T Consensus         3 p~Cp~C~se~~y~D~   17 (30)
T PF08274_consen    3 PKCPLCGSEYTYEDG   17 (30)
T ss_dssp             ---TTT-----EE-S
T ss_pred             CCCCCCCCcceeccC
Confidence            369999999988654


No 91 
>COG2835 Uncharacterized conserved protein [Function unknown]
Probab=40.59  E-value=47  Score=20.51  Aligned_cols=34  Identities=26%  Similarity=0.498  Sum_probs=23.0

Q ss_pred             eEeeCCCCCCCCCCeEEEEcCCCCeeecCCCCceeeecCC
Q psy1181          40 VVWCDGGSGPTGHPKVYINLDKPGNHSCGYCGLRFFKEDS   79 (82)
Q Consensus        40 ~v~C~Gg~~~lgHP~Vyi~L~~~~~~~CpYCG~~y~~~~~   79 (82)
                      +++|+-..|    |.+|..  ..+.-.|+-|++.|.-++|
T Consensus         8 iLaCP~~kg----~L~~~~--~~~~L~c~~~~~aYpI~dG   41 (60)
T COG2835           8 ILACPVCKG----PLVYDE--EKQELICPRCKLAYPIRDG   41 (60)
T ss_pred             eeeccCcCC----cceEec--cCCEEEecccCceeecccC
Confidence            678865543    433332  2457899999999987765


No 92 
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=40.56  E-value=34  Score=23.28  Aligned_cols=36  Identities=39%  Similarity=0.692  Sum_probs=23.6

Q ss_pred             CceEeeCCCCCCCCCCeEEEE-cCCC---CeeecCCCCceeeec
Q psy1181          38 ERVVWCDGGSGPTGHPKVYIN-LDKP---GNHSCGYCGLRFFKE   77 (82)
Q Consensus        38 ~r~v~C~Gg~~~lgHP~Vyi~-L~~~---~~~~CpYCG~~y~~~   77 (82)
                      .+.+-|+-    -||-+|-+. +++.   +.+.|+-||++|..+
T Consensus        20 ~k~FtCp~----Cghe~vs~ctvkk~~~~g~~~Cg~CGls~e~e   59 (104)
T COG4888          20 PKTFTCPR----CGHEKVSSCTVKKTVNIGTAVCGNCGLSFECE   59 (104)
T ss_pred             CceEecCc----cCCeeeeEEEEEecCceeEEEcccCcceEEEe
Confidence            45667743    267776633 2332   568999999999754


No 93 
>PF00653 BIR:  Inhibitor of Apoptosis domain;  InterPro: IPR001370 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively. In many cases they are synthesised as part of a larger precursor protein, either as a prepropeptide or as an N-terminal domain associated with an inactive peptidase or zymogen. This domain prevents access of the substrate to the active site. Removal of the N-terminal inhibitor domain either by interaction with a second peptidase or by autocatalytic cleavage activates the zymogen. Other inhibitors interact direct with proteinases using a simple noncovalent lock and key mechanism; while yet others use a conformational change-based trapping mechanism that depends on their structural and thermodynamic properties.   The baculovirus inhibitor of apoptosis protein repeat (BIR) is a domain of tandem repeats separated by a variable length linker that seems to confer cell death-preventing activity [, ]. The BIR domains characterise the Inhibitor of Apoptosis (IAP) family of proteins (MEROPS proteinase inhibitor family I32, clan IV) that suppress apoptosis by interacting with and inhibiting the enzymatic activity of both initiator and effector caspases (MEROPS peptidase family C14, IPR002398 from INTERPRO). Several distinct mammalian IAPs including XIAP, c-IAP1, c-IAP2, and ML-IAP, have been identified, and they all exhibit antiapoptotic activity in cell culture. The functional unit in each IAP protein is the baculoviral IAP repeat (BIR), which contains approximately 80 amino acids folded around a zinc atom. Most mammalian IAPs have more than one BIR domain, with the different BIR domains performing distinct functions. For example, in XIAP, the third BIR domain (BIR3) potently inhibits the catalytic activity of caspase-9, whereas the linker sequences immediately preceding the second BIR domain (BIR2) selectively targets caspase-3 or -7.  The first-recognised members of family MEROPS inhibitor family I32 were viral proteins that inhibited the apoptosis of infected cells: Cp-IAP from Cydia pomonella granulosis virus (CpGV) [] and Op-IAP from Orgyia pseudotsugata multicapsid polyhedrosis virus(OpMNPV) []. The discovery of homologous proteins in mammals followed soon after with the recognition that mutations in the gene for neuronal apoptosis inhibitory protein (NIAP) underlie spinal muscular atrophy []. The inhibitors in family I32 all possess one or more 80-residue domains known as BIR (baculovirus inhibitor repeat) domains and have accordingly been termed 'BIR-containing' or 'BIRC' proteins as well as IAP proteins.  The mechanism of inhibition of caspases by the IAP proteins is complex, and reactive site residues cannot yet be identified with any confidence. Despite the conservation of the BIR or IAP (inhibitor of apoptosis) domains throughout the family it seems clear that other parts of the molecules also make essential contributions to inhibitory activity.  Homologs of most components in the mammalian apoptotic pathway have been identified in fruit flies. The Drosophila Apaf-1, known as Dapaf-1, HAC-1 or Dark, shares significant sequence similarity with its mammalian counterpart, and is critically important for the activation of the Drosophila initiator caspase Dronc. Dronc, in turn, cleaves and activates the effector caspase DrICE. The Drosophila IAP, DIAP1, binds to and in-activates both DrICE and Dronc through its BIR1 and BIR2 domains. During apoptosis, the anti-death function of DIAP1 is countered by at least four pro-apoptotic proteins, Reaper, Hid, Grim, and sickle, through direct physical interactions. These four proteins represent the functional homologs of the mammalian protein Smac, and they all share a conserved IAP-binding motif at their N termini. The three proteins Reaper, Hid, and Grim are collectively referred to as the RHG proteins [, ].  Both XIAP and DIAP1 contain a RING domain at their C termini, and can act as an E3 ubiquitin ligase. Indeed, both XIAP and DIAP1 have been shown to promote self-ubiquitination and degradation as well as to negatively regulate the target caspases. Nonetheless, important differences exist between XIAP and DIAP1. The primary function of XIAP is thought to inhibit the catalytic activities of caspases; to what extent the ubiquitinating activity of XIAP contributes to its function remains unclear. For DIAP1, however, the ubiquitinating activity appears to be essential for its function.  Recently a Drosophila p53 protein has been identified that mediates apoptosis via a novel pathway involving the activation of the Reaper gene and subsequent inhibition of the inhibitors of apoptosis (IAPs). CIAP1, a major mammalian homologue of Drosophila IAPs, is irreversibly inhibited (cleaved) during p53-dependent apoptosis and this cleavage is mediated by a serine protease. Serine protease inhibitors that block CIAP1 cleavage inhibit p53-dependent apoptosis. Furthermore, activation of the p53 protein increases the transcription of the HTRA2 gene, which encodes a serine protease that interacts with CIAP1 and potentiates apoptosis. Therefore mammalian p53 protein activates apoptosis through a novel pathway functionally similar to that in Drosophila, which involves HTRA2 and subsequent inhibition of CIAP1 by cleavage [].; GO: 0005622 intracellular; PDB: 3HL5_B 3UW5_A 3CM7_A 1G3F_A 1G73_C 3G76_G 3CM2_C 2VSL_A 2OPZ_B 3CLX_A ....
Probab=40.52  E-value=35  Score=20.26  Aligned_cols=15  Identities=33%  Similarity=0.684  Sum_probs=12.4

Q ss_pred             CCCeeecCCCCceee
Q psy1181          61 KPGNHSCGYCGLRFF   75 (82)
Q Consensus        61 ~~~~~~CpYCG~~y~   75 (82)
                      .+..+.|-|||....
T Consensus        33 ~~d~v~C~~C~~~l~   47 (70)
T PF00653_consen   33 TGDRVRCFYCGLELD   47 (70)
T ss_dssp             STTEEEETTTTEEEE
T ss_pred             CCCEEEEeccCCEEe
Confidence            367899999999874


No 94 
>PRK03922 hypothetical protein; Provisional
Probab=40.39  E-value=17  Score=25.05  Aligned_cols=21  Identities=29%  Similarity=0.567  Sum_probs=15.4

Q ss_pred             eEEEEcCCCCeeecCCCCceee
Q psy1181          54 KVYINLDKPGNHSCGYCGLRFF   75 (82)
Q Consensus        54 ~Vyi~L~~~~~~~CpYCG~~y~   75 (82)
                      .-|..++ -|...||+||.-|.
T Consensus        40 l~yVeie-vG~~~cP~cge~~~   60 (113)
T PRK03922         40 LDYVEVE-VGLTICPKCGEPFD   60 (113)
T ss_pred             CCeEEEe-cCcccCCCCCCcCC
Confidence            4477765 46789999998663


No 95 
>PF03119 DNA_ligase_ZBD:  NAD-dependent DNA ligase C4 zinc finger domain;  InterPro: IPR004149 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in NAD-dependent DNA ligases. DNA ligases catalyse the crucial step of joining the breaks in duplex DNA during DNA replication, repair and recombination, utilizing either ATP or NAD(+) as a cofactor []. This domain is a small zinc binding motif that is presumably DNA binding. It is found only in NAD-dependent DNA ligases. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003911 DNA ligase (NAD+) activity, 0006260 DNA replication, 0006281 DNA repair; PDB: 1DGS_A 1V9P_B 2OWO_A.
Probab=40.23  E-value=19  Score=18.57  Aligned_cols=14  Identities=29%  Similarity=0.963  Sum_probs=7.6

Q ss_pred             ecCCCCceeeecCC
Q psy1181          66 SCGYCGLRFFKEDS   79 (82)
Q Consensus        66 ~CpYCG~~y~~~~~   79 (82)
                      .||.||..-+++.+
T Consensus         1 ~CP~C~s~l~~~~~   14 (28)
T PF03119_consen    1 TCPVCGSKLVREEG   14 (28)
T ss_dssp             B-TTT--BEEE-CC
T ss_pred             CcCCCCCEeEcCCC
Confidence            49999998876654


No 96 
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=39.96  E-value=52  Score=21.84  Aligned_cols=36  Identities=25%  Similarity=0.494  Sum_probs=26.7

Q ss_pred             CceEeeCCCCCCCCCCeEEEEcCCC-CeeecCCCCceeeec
Q psy1181          38 ERVVWCDGGSGPTGHPKVYINLDKP-GNHSCGYCGLRFFKE   77 (82)
Q Consensus        38 ~r~v~C~Gg~~~lgHP~Vyi~L~~~-~~~~CpYCG~~y~~~   77 (82)
                      ...+.|+-=    |++.|=+++++. ..+.|+-||..|...
T Consensus        19 pt~f~CP~C----ge~~v~v~~~k~~~h~~C~~CG~y~~~~   55 (99)
T PRK14892         19 PKIFECPRC----GKVSISVKIKKNIAIITCGNCGLYTEFE   55 (99)
T ss_pred             CcEeECCCC----CCeEeeeecCCCcceEECCCCCCccCEE
Confidence            357889654    467888888874 457999999987543


No 97 
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=39.65  E-value=13  Score=21.56  Aligned_cols=12  Identities=33%  Similarity=0.786  Sum_probs=9.8

Q ss_pred             eeecCCCCceee
Q psy1181          64 NHSCGYCGLRFF   75 (82)
Q Consensus        64 ~~~CpYCG~~y~   75 (82)
                      .-.|+.||+.|.
T Consensus         8 ~K~C~~C~rpf~   19 (42)
T PF10013_consen    8 SKICPVCGRPFT   19 (42)
T ss_pred             CCcCcccCCcch
Confidence            358999999885


No 98 
>COG0602 NrdG Organic radical activating enzymes [Posttranslational modification, protein turnover, chaperones]
Probab=38.39  E-value=26  Score=25.53  Aligned_cols=32  Identities=22%  Similarity=0.515  Sum_probs=24.2

Q ss_pred             CCCCCCCCCCeEEEEcCCCCeeecCCCCceeee
Q psy1181          44 DGGSGPTGHPKVYINLDKPGNHSCGYCGLRFFK   76 (82)
Q Consensus        44 ~Gg~~~lgHP~Vyi~L~~~~~~~CpYCG~~y~~   76 (82)
                      .|.|...|=|.||+.+. .-...|+||.+.+.-
T Consensus        14 QGEG~~~Gr~~vFVR~~-GC~l~C~~Cdt~~t~   45 (212)
T COG0602          14 QGEGKNIGRPSVFVRFA-GCNLRCPGCDTKYTW   45 (212)
T ss_pred             ecCcccccceeEEEEcC-CCCCCCCCCCChhhh
Confidence            44443569999999986 457899999987553


No 99 
>TIGR02159 PA_CoA_Oxy4 phenylacetate-CoA oxygenase, PaaJ subunit. Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation. Although the exact function of this enzyme has not been determined, it has been shown to be required for phenylacetic acid degradation and has been proposed to function in a multicomponent oxygenase acting on phenylacetate-CoA.
Probab=38.05  E-value=14  Score=25.86  Aligned_cols=13  Identities=23%  Similarity=0.411  Sum_probs=10.8

Q ss_pred             eeecCCCCceeee
Q psy1181          64 NHSCGYCGLRFFK   76 (82)
Q Consensus        64 ~~~CpYCG~~y~~   76 (82)
                      .+.||+||.....
T Consensus       105 ~~~cp~c~s~~t~  117 (146)
T TIGR02159       105 SVQCPRCGSADTT  117 (146)
T ss_pred             CCcCCCCCCCCcE
Confidence            5899999988754


No 100
>COG1885 Uncharacterized protein conserved in archaea [Function unknown]
Probab=37.67  E-value=19  Score=24.82  Aligned_cols=23  Identities=30%  Similarity=0.629  Sum_probs=17.3

Q ss_pred             CCeEEEEcCCCCeeecCCCCceee
Q psy1181          52 HPKVYINLDKPGNHSCGYCGLRFF   75 (82)
Q Consensus        52 HP~Vyi~L~~~~~~~CpYCG~~y~   75 (82)
                      +..-|..++ -|...||-||.-|.
T Consensus        38 ~~LdyV~ie-~G~t~CP~Cg~~~e   60 (115)
T COG1885          38 PDLDYVEIE-VGSTSCPKCGEPFE   60 (115)
T ss_pred             CCCCeEEEe-cccccCCCCCCccc
Confidence            555677776 46789999998764


No 101
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=37.43  E-value=18  Score=19.94  Aligned_cols=16  Identities=31%  Similarity=0.636  Sum_probs=13.0

Q ss_pred             eeecCCCCceeeecCC
Q psy1181          64 NHSCGYCGLRFFKEDS   79 (82)
Q Consensus        64 ~~~CpYCG~~y~~~~~   79 (82)
                      +..|.+|+..|=+++-
T Consensus        12 ~f~C~~C~~~FC~~HR   27 (39)
T smart00154       12 GFKCRHCGNLFCGEHR   27 (39)
T ss_pred             CeECCccCCccccccC
Confidence            6789999999977653


No 102
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=37.04  E-value=18  Score=18.24  Aligned_cols=14  Identities=29%  Similarity=0.814  Sum_probs=11.2

Q ss_pred             CeeecCCCCceeee
Q psy1181          63 GNHSCGYCGLRFFK   76 (82)
Q Consensus        63 ~~~~CpYCG~~y~~   76 (82)
                      +...|.+|+..|..
T Consensus         2 ~~~~C~~C~~~~~~   15 (35)
T smart00451        2 GGFYCKLCNVTFTD   15 (35)
T ss_pred             cCeEccccCCccCC
Confidence            35689999999873


No 103
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=35.84  E-value=20  Score=19.15  Aligned_cols=10  Identities=30%  Similarity=0.873  Sum_probs=7.7

Q ss_pred             CeeecCCCCc
Q psy1181          63 GNHSCGYCGL   72 (82)
Q Consensus        63 ~~~~CpYCG~   72 (82)
                      -+..||.||.
T Consensus        17 ~p~~CP~Cg~   26 (34)
T cd00729          17 APEKCPICGA   26 (34)
T ss_pred             CCCcCcCCCC
Confidence            3568999987


No 104
>COG2093 DNA-directed RNA polymerase, subunit E'' [Transcription]
Probab=35.79  E-value=21  Score=22.42  Aligned_cols=13  Identities=23%  Similarity=0.583  Sum_probs=9.7

Q ss_pred             CCCeeecCCCCce
Q psy1181          61 KPGNHSCGYCGLR   73 (82)
Q Consensus        61 ~~~~~~CpYCG~~   73 (82)
                      .++.-.||+||..
T Consensus        15 ~~d~e~CP~Cgs~   27 (64)
T COG2093          15 PEDTEICPVCGST   27 (64)
T ss_pred             CCCCccCCCCCCc
Confidence            3455679999986


No 105
>PF10601 zf-LITAF-like:  LITAF-like zinc ribbon domain;  InterPro: IPR006629 Members of this family display a conserved zinc ribbon structure [] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS). The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure []. 
Probab=35.63  E-value=26  Score=21.06  Aligned_cols=14  Identities=29%  Similarity=0.712  Sum_probs=10.5

Q ss_pred             CCCeeecCCCCcee
Q psy1181          61 KPGNHSCGYCGLRF   74 (82)
Q Consensus        61 ~~~~~~CpYCG~~y   74 (82)
                      .+....||+|+..=
T Consensus         4 ~p~~~~CP~C~~~~   17 (73)
T PF10601_consen    4 EPVRIYCPYCQQQV   17 (73)
T ss_pred             CceeeECCCCCCEE
Confidence            34568999999764


No 106
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=34.85  E-value=15  Score=22.89  Aligned_cols=14  Identities=29%  Similarity=0.683  Sum_probs=11.3

Q ss_pred             eeecCCCCceeeec
Q psy1181          64 NHSCGYCGLRFFKE   77 (82)
Q Consensus        64 ~~~CpYCG~~y~~~   77 (82)
                      --.||-||..|...
T Consensus        17 ~lrCPRC~~~FR~~   30 (65)
T COG4049          17 FLRCPRCGMVFRRR   30 (65)
T ss_pred             eeeCCchhHHHHHh
Confidence            46899999999653


No 107
>PF11793 FANCL_C:  FANCL C-terminal domain; PDB: 3K1L_A.
Probab=34.64  E-value=25  Score=21.37  Aligned_cols=14  Identities=21%  Similarity=0.411  Sum_probs=8.7

Q ss_pred             eeecCCCCceeeec
Q psy1181          64 NHSCGYCGLRFFKE   77 (82)
Q Consensus        64 ~~~CpYCG~~y~~~   77 (82)
                      ...||||.+....+
T Consensus        55 ~G~CP~C~~~i~~~   68 (70)
T PF11793_consen   55 FGECPYCSSPISWS   68 (70)
T ss_dssp             EEE-TTT-SEEEGG
T ss_pred             ccCCcCCCCeeeEe
Confidence            46899999876543


No 108
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=34.25  E-value=17  Score=26.38  Aligned_cols=22  Identities=36%  Similarity=0.634  Sum_probs=16.1

Q ss_pred             CeEEEEcCCCCeeecCCCCceeee
Q psy1181          53 PKVYINLDKPGNHSCGYCGLRFFK   76 (82)
Q Consensus        53 P~Vyi~L~~~~~~~CpYCG~~y~~   76 (82)
                      |+||.+-  +.--.|+-||+.|=.
T Consensus       121 ~~~~~~~--~~f~~C~~CgkiYW~  142 (165)
T COG1656         121 EKVYRNY--EEFYRCPKCGKIYWK  142 (165)
T ss_pred             hhhhhcc--cceeECCCCcccccC
Confidence            4577774  356789999999854


No 109
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=33.88  E-value=20  Score=29.35  Aligned_cols=19  Identities=21%  Similarity=0.427  Sum_probs=15.6

Q ss_pred             CCCeeecCCCCceeeecCC
Q psy1181          61 KPGNHSCGYCGLRFFKEDS   79 (82)
Q Consensus        61 ~~~~~~CpYCG~~y~~~~~   79 (82)
                      ++++-+|+.|++||+.-.|
T Consensus       395 ~~KPYrCevC~KRYKNlNG  413 (423)
T COG5189         395 KDKPYRCEVCDKRYKNLNG  413 (423)
T ss_pred             cCCceeccccchhhccCcc
Confidence            4577899999999987654


No 110
>KOG1391|consensus
Probab=33.58  E-value=14  Score=29.71  Aligned_cols=37  Identities=27%  Similarity=0.315  Sum_probs=31.2

Q ss_pred             ccChhHHHhhhhcCCCeeecCceEeeCCCCCCCCCCe
Q psy1181          18 HVNTQFAIDLIAEVPPKPCKERVVWCDGGSGPTGHPK   54 (82)
Q Consensus        18 ~~n~~~a~~li~e~P~i~v~~r~v~C~Gg~~~lgHP~   54 (82)
                      ++|.-+|...++-+....++...+.-.||.-+||||.
T Consensus       317 EvNEAFApQ~LAv~r~L~ld~sKlNVNGGAIALGHPL  353 (396)
T KOG1391|consen  317 EVNEAFAPQYLAVERSLDLDISKLNVNGGAIALGHPL  353 (396)
T ss_pred             EechhhchHHHHHHHhhCCChhhccccCceeeccCcc
Confidence            6799999988888888788877888888877899995


No 111
>cd04487 RecJ_OBF2_like RecJ_OBF2_like: A subfamily of OB folds corresponding to the second OB fold (OBF2) of archaeal-specific proteins with similarity to eubacterial RecJ. RecJ is an ssDNA-specific exonuclease. Although the overall sequence similarity of these proteins to eubacterial RecJ proteins is marginal, they appear to carry motifs, which have been shown to be essential for nuclease function in Escherichia coli RecJ. In addition to this OB fold, most proteins in this subfamily contain: i) an N-terminal OB fold belonging to a different domain family (the ribosomal S1-like RNA-binding family); and ii) a domain, C-terminal to OBF2, characteristic of DHH family proteins. DHH family proteins include E. coli RecJ, and are predicted to have a phosphoesterase function.
Probab=33.52  E-value=52  Score=20.08  Aligned_cols=30  Identities=17%  Similarity=0.150  Sum_probs=17.3

Q ss_pred             eecCceEeeCCCCCCCCCCeEEEEcCCC-CeeecCC
Q psy1181          35 PCKERVVWCDGGSGPTGHPKVYINLDKP-GNHSCGY   69 (82)
Q Consensus        35 ~v~~r~v~C~Gg~~~lgHP~Vyi~L~~~-~~~~CpY   69 (82)
                      +|.+.+....-   .-||  +|++|.++ ....|-.
T Consensus         2 ~v~GeVs~~~~---~~GH--vyfsLkD~~a~i~cv~   32 (73)
T cd04487           2 HIEGEVVQIKQ---TSGP--TIFTLRDETGTVWAAA   32 (73)
T ss_pred             EEEEEEecccc---CCCC--EEEEEEcCCEEEEEEE
Confidence            34444444432   3477  99999554 3567744


No 112
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=33.43  E-value=25  Score=19.17  Aligned_cols=13  Identities=31%  Similarity=0.682  Sum_probs=10.2

Q ss_pred             eecCCCCceeeec
Q psy1181          65 HSCGYCGLRFFKE   77 (82)
Q Consensus        65 ~~CpYCG~~y~~~   77 (82)
                      ..|+-||..|-..
T Consensus         2 r~C~~Cg~~Yh~~   14 (36)
T PF05191_consen    2 RICPKCGRIYHIE   14 (36)
T ss_dssp             EEETTTTEEEETT
T ss_pred             cCcCCCCCccccc
Confidence            4799999999654


No 113
>cd03469 Rieske_RO_Alpha_N Rieske non-heme iron oxygenase (RO) family, N-terminal Rieske domain of the oxygenase alpha subunit; The RO family comprise a large class of aromatic ring-hydroxylating dioxygenases found predominantly in microorganisms. These enzymes enable microorganisms to tolerate and even exclusively utilize aromatic compounds for growth. ROs consist of two or three components: reductase, oxygenase, and ferredoxin (in some cases) components. The oxygenase component may contain alpha and beta subunits, with the beta subunit having a purely structural function. Some oxygenase components contain only an alpha subunit. The oxygenase alpha subunit has two domains, an N-terminal Rieske domain with an [2Fe-2S] cluster and a C-terminal catalytic domain with a mononuclear Fe(II) binding site. The Rieske [2Fe-2S] cluster accepts electrons from the reductase or ferredoxin component and transfers them to the mononuclear iron for catalysis. Reduced pyridine nucleotide is used as the i
Probab=32.92  E-value=80  Score=19.80  Aligned_cols=29  Identities=17%  Similarity=0.231  Sum_probs=21.0

Q ss_pred             CCCCeEEEEcCCCCeeecCCCCceeeecC
Q psy1181          50 TGHPKVYINLDKPGNHSCGYCGLRFFKED   78 (82)
Q Consensus        50 lgHP~Vyi~L~~~~~~~CpYCG~~y~~~~   78 (82)
                      .|-|..+-.+...+...|||-|.+|-+++
T Consensus        46 ~g~~L~~g~~~~~~~i~Cp~Hg~~Fd~~G   74 (118)
T cd03469          46 RGARLCEGRGGNAGRLVCPYHGWTYDLDG   74 (118)
T ss_pred             CCCEeeeccCCCCCEEECCCCCCEECCCC
Confidence            35555555553457899999999998873


No 114
>cd00022 BIR Baculoviral inhibition of apoptosis protein repeat domain; Found in inhibitors of apoptosis proteins (IAPs) and other proteins. In higher eukaryotes, BIR domains inhibit apoptosis by acting as direct inhibitors of the caspase family of protease enzymes. In yeast, BIR domains are involved in regulating cytokinesis. This novel fold is stabilized by zinc tetrahedrally coordinated by one histidine and three cysteine residues and resembles a classical zinc finger.
Probab=32.69  E-value=36  Score=19.80  Aligned_cols=15  Identities=27%  Similarity=0.687  Sum_probs=12.2

Q ss_pred             CCeeecCCCCceeee
Q psy1181          62 PGNHSCGYCGLRFFK   76 (82)
Q Consensus        62 ~~~~~CpYCG~~y~~   76 (82)
                      ...+.|.||+..+..
T Consensus        32 ~d~v~C~~C~~~~~~   46 (69)
T cd00022          32 GDEVKCFFCGLELKN   46 (69)
T ss_pred             CCEEEeCCCCCCccC
Confidence            457999999998854


No 115
>PHA00732 hypothetical protein
Probab=32.15  E-value=21  Score=22.55  Aligned_cols=13  Identities=15%  Similarity=0.577  Sum_probs=10.8

Q ss_pred             ecCCCCceeeecC
Q psy1181          66 SCGYCGLRFFKED   78 (82)
Q Consensus        66 ~CpYCG~~y~~~~   78 (82)
                      .|+.||..|....
T Consensus        29 ~C~~CgKsF~~l~   41 (79)
T PHA00732         29 KCPVCNKSYRRLN   41 (79)
T ss_pred             ccCCCCCEeCChh
Confidence            7999999997543


No 116
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=31.73  E-value=32  Score=20.80  Aligned_cols=14  Identities=21%  Similarity=0.378  Sum_probs=7.9

Q ss_pred             eeecCCCCceeeec
Q psy1181          64 NHSCGYCGLRFFKE   77 (82)
Q Consensus        64 ~~~CpYCG~~y~~~   77 (82)
                      .+.||.||+.....
T Consensus         2 ~v~CP~C~k~~~~~   15 (57)
T PF03884_consen    2 TVKCPICGKPVEWS   15 (57)
T ss_dssp             EEE-TTT--EEE-S
T ss_pred             cccCCCCCCeeccc
Confidence            47899999998763


No 117
>KOG1522|consensus
Probab=31.69  E-value=30  Score=27.15  Aligned_cols=71  Identities=20%  Similarity=0.200  Sum_probs=42.4

Q ss_pred             CcCcccccccccChhH--HHhhhhcCCCeeecCceEeeCCCC---CCCCCCeEEEEcCCCC------------eeecCCC
Q psy1181           8 RPVRFVDKEKHVNTQF--AIDLIAEVPPKPCKERVVWCDGGS---GPTGHPKVYINLDKPG------------NHSCGYC   70 (82)
Q Consensus         8 ~~~rf~~~~~~~n~~~--a~~li~e~P~i~v~~r~v~C~Gg~---~~lgHP~Vyi~L~~~~------------~~~CpYC   70 (82)
                      .+++|+.+...+.--+  ..=||+|+|.|.++--.+-=...-   .-+-|-.=-|.|..+.            ..-|+.|
T Consensus        16 d~vkF~L~nTdlsvANsLRRV~iaEvPTiAID~VeIe~NssVL~DEFiAHRLGLIPl~S~~~~~l~ytrdC~C~~~C~eC   95 (285)
T KOG1522|consen   16 DNVKFVLSNTDLSVANSLRRVMIAEVPTIAIDLVEIEVNSSVLPDEFIAHRLGLIPLISDRIVELQYTRDCECDEFCPEC   95 (285)
T ss_pred             CceEEEEecChHHHHHHHHHHHHhcCceeEEEEEEEecccccccHHHHHhhhcceeccchhhhhhhhcccCchhccCCcc
Confidence            3578888776552222  345899999986653333222111   1235555556665542            2359999


Q ss_pred             CceeeecC
Q psy1181          71 GLRFFKED   78 (82)
Q Consensus        71 G~~y~~~~   78 (82)
                      +..|.++-
T Consensus        96 SVef~L~~  103 (285)
T KOG1522|consen   96 SVEFTLDV  103 (285)
T ss_pred             eEEEEEee
Confidence            99998864


No 118
>cd03529 Rieske_NirD Assimilatory nitrite reductase (NirD) family, Rieske domain; Assimilatory nitrate and nitrite reductases convert nitrate through nitrite to ammonium. Members include bacterial and fungal proteins. The bacterial NirD contains a single Rieske domain while fungal proteins have a C-terminal Rieske domain in addition to several other domains. The fungal NirD is involved in nutrient acquisition, functioning at the soil/fungus interface to control nutrient exchange between the fungus and the host plant. The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer. The Rieske [2Fe-2S] cluster is liganded to two histidine and two cysteine residues present in conserved sequences called Rieske motifs. In this family, only a few members contain these residues. Other members may have lost the ability to bind the Rieske [2Fe-2S] cluster.
Probab=31.04  E-value=97  Score=19.35  Aligned_cols=18  Identities=6%  Similarity=-0.101  Sum_probs=15.1

Q ss_pred             CCeeecCCCCceeeecCC
Q psy1181          62 PGNHSCGYCGLRFFKEDS   79 (82)
Q Consensus        62 ~~~~~CpYCG~~y~~~~~   79 (82)
                      .+..+|||-|.+|-++.+
T Consensus        61 ~~~i~Cp~Hg~~Fdl~tG   78 (103)
T cd03529          61 EPVVASPLYKQHFSLKTG   78 (103)
T ss_pred             CeEEECCCCCCEEEcCCC
Confidence            347999999999987665


No 119
>smart00729 Elp3 Elongator protein 3, MiaB family, Radical SAM. This superfamily contains MoaA, NifB, PqqE, coproporphyrinogen III oxidase, biotin synthase and MiaB families, and includes a representative in the eukaryotic elongator subunit, Elp-3. Some members of the family are methyltransferases.
Probab=30.95  E-value=33  Score=22.34  Aligned_cols=21  Identities=10%  Similarity=0.344  Sum_probs=15.7

Q ss_pred             eEEEEcCCCCeeecCCCCcee
Q psy1181          54 KVYINLDKPGNHSCGYCGLRF   74 (82)
Q Consensus        54 ~Vyi~L~~~~~~~CpYCG~~y   74 (82)
                      ..+|.+...-...|.||....
T Consensus         2 ~~~i~~t~~C~~~C~yC~~~~   22 (216)
T smart00729        2 LALYIITRGCPRRCTFCSFPS   22 (216)
T ss_pred             ccEEEecCchhccCCcCCcCc
Confidence            457777766678899998754


No 120
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=30.67  E-value=19  Score=29.60  Aligned_cols=14  Identities=29%  Similarity=0.567  Sum_probs=12.1

Q ss_pred             ecCCCCceeeecCC
Q psy1181          66 SCGYCGLRFFKEDS   79 (82)
Q Consensus        66 ~CpYCG~~y~~~~~   79 (82)
                      .||+||.+.++++.
T Consensus       352 ~Cp~Cg~~m~S~G~  365 (421)
T COG1571         352 VCPRCGGRMKSAGR  365 (421)
T ss_pred             CCCccCCchhhcCC
Confidence            69999999988764


No 121
>cd00085 HNHc HNH nucleases; HNH endonuclease signature which is found in viral, prokaryotic, and eukaryotic proteins. The alignment includes members of the large group of homing endonucleases, yeast intron 1 protein, MutS, as well as bacterial colicins, pyocins, and anaredoxins.
Probab=30.44  E-value=22  Score=18.89  Aligned_cols=10  Identities=40%  Similarity=0.803  Sum_probs=8.3

Q ss_pred             eecCCCCcee
Q psy1181          65 HSCGYCGLRF   74 (82)
Q Consensus        65 ~~CpYCG~~y   74 (82)
                      ..|+|||..+
T Consensus        12 ~~C~~c~~~~   21 (57)
T cd00085          12 GLCPYCGKPG   21 (57)
T ss_pred             CcCccCCCcC
Confidence            4799999875


No 122
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=30.31  E-value=25  Score=19.62  Aligned_cols=8  Identities=38%  Similarity=0.941  Sum_probs=6.8

Q ss_pred             eecCCCCc
Q psy1181          65 HSCGYCGL   72 (82)
Q Consensus        65 ~~CpYCG~   72 (82)
                      ..||.||.
T Consensus        19 ~~CP~Cg~   26 (46)
T PF12760_consen   19 FVCPHCGS   26 (46)
T ss_pred             CCCCCCCC
Confidence            56999996


No 124
>PF13005 zf-IS66:  zinc-finger binding domain of transposase IS66 ;  InterPro: IPR024474 This entry represents a predicted helix-turn-helix domain from insertion element IS66 transposases [].
Probab=30.30  E-value=34  Score=18.65  Aligned_cols=15  Identities=20%  Similarity=0.430  Sum_probs=11.2

Q ss_pred             eeecCCCCceeeecC
Q psy1181          64 NHSCGYCGLRFFKED   78 (82)
Q Consensus        64 ~~~CpYCG~~y~~~~   78 (82)
                      +..||.||..+...+
T Consensus         2 ~~~C~~Cg~~l~~ig   16 (47)
T PF13005_consen    2 PRACPDCGGELKEIG   16 (47)
T ss_pred             CCcCCCCCceeeECC
Confidence            357999999887544


No 125
>cd03531 Rieske_RO_Alpha_KSH The alignment model represents the N-terminal rieske iron-sulfur domain of KshA, the oxygenase component of 3-ketosteroid 9-alpha-hydroxylase (KSH).  The terminal oxygenase component of KSH is a key enzyme in the microbial steroid degradation pathway, catalyzing the 9 alpha-hydroxylation of 4-androstene-3,17-dione (AD) and 1,4-androstadiene-3,17-dione (ADD). KSH is a two-component class IA monooxygenase, with terminal oxygenase (KshA) and oxygenase reductase (KshB) components.  KSH activity has been found in many actino- and proteo- bacterial genera including Rhodococcus, Nocardia, Arthrobacter, Mycobacterium, and Burkholderia.
Probab=30.30  E-value=42  Score=21.78  Aligned_cols=17  Identities=12%  Similarity=0.319  Sum_probs=14.3

Q ss_pred             CCeeecCCCCceeeecC
Q psy1181          62 PGNHSCGYCGLRFFKED   78 (82)
Q Consensus        62 ~~~~~CpYCG~~y~~~~   78 (82)
                      .+..+|||.|-+|-+++
T Consensus        57 ~~~i~CP~Hg~~fd~~G   73 (115)
T cd03531          57 GDEIACPFHDWRWGGDG   73 (115)
T ss_pred             CCEEECCCCCCEECCCC
Confidence            46899999999998844


No 126
>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics]
Probab=30.29  E-value=32  Score=26.93  Aligned_cols=31  Identities=23%  Similarity=0.544  Sum_probs=22.4

Q ss_pred             CceEeeCCCCCCCCCCeEEEEcC-------CCCeeecCCCCc
Q psy1181          38 ERVVWCDGGSGPTGHPKVYINLD-------KPGNHSCGYCGL   72 (82)
Q Consensus        38 ~r~v~C~Gg~~~lgHP~Vyi~L~-------~~~~~~CpYCG~   72 (82)
                      +.+|+|||.    .=++.|+.|+       ..|.-.||.|-.
T Consensus       232 GqMVaCDn~----nCkrEWFH~~CVGLk~pPKG~WYC~eCk~  269 (271)
T COG5034         232 GQMVACDNA----NCKREWFHLECVGLKEPPKGKWYCPECKK  269 (271)
T ss_pred             ccceecCCC----CCchhheeccccccCCCCCCcEeCHHhHh
Confidence            678888876    4567788776       236788999853


No 127
>TIGR02378 nirD_assim_sml nitrite reductase [NAD(P)H], small subunit. This model describes NirD, the small subunit of nitrite reductase [NAD(P)H] (the assimilatory nitrite reductase), which associates with NirB, the large subunit (TIGR02374). In a few bacteria such as Klebsiella pneumoniae and in Fungi, the two regions are fused.
Probab=30.18  E-value=41  Score=21.07  Aligned_cols=16  Identities=25%  Similarity=0.241  Sum_probs=13.9

Q ss_pred             eeecCCCCceeeecCC
Q psy1181          64 NHSCGYCGLRFFKEDS   79 (82)
Q Consensus        64 ~~~CpYCG~~y~~~~~   79 (82)
                      ..+|||.|-+|-++.+
T Consensus        64 ~i~Cp~Hg~~Fdl~tG   79 (105)
T TIGR02378        64 WVACPLHKRNFRLEDG   79 (105)
T ss_pred             EEECCcCCCEEEcCCc
Confidence            3999999999998765


No 128
>PRK09965 3-phenylpropionate dioxygenase ferredoxin subunit; Provisional
Probab=30.03  E-value=1.5e+02  Score=18.72  Aligned_cols=20  Identities=10%  Similarity=0.240  Sum_probs=15.9

Q ss_pred             CCCCeeecCCCCceeeecCC
Q psy1181          60 DKPGNHSCGYCGLRFFKEDS   79 (82)
Q Consensus        60 ~~~~~~~CpYCG~~y~~~~~   79 (82)
                      +..+...||+-|.+|-++.|
T Consensus        55 ~~~~~i~Cp~Hg~~Fd~~tG   74 (106)
T PRK09965         55 EDDATVECPLHAASFCLRTG   74 (106)
T ss_pred             CCCCEEEcCCCCCEEEcCCC
Confidence            34468999999999988655


No 129
>cd03542 Rieske_RO_Alpha_HBDO Rieske non-heme iron oxygenase (RO) family, 2-Halobenzoate 1,2-dioxygenase (HBDO) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth. The oxygenase alpha subunit contains an N-terminal Rieske domain with an [2Fe-2S] cluster and a C-terminal catalytic domain with a mononuclear Fe(II) binding site. The Rieske [2Fe-2S] cluster accepts electrons from a reductase or ferredoxin component and transfers them to the mononuclear iron for catalysis. HBDO catalyzes the double hydroxylation of 2-halobenzoates with concomitant release of halogenide and carbon dioxide, yielding catechol.
Probab=29.86  E-value=50  Score=21.89  Aligned_cols=28  Identities=18%  Similarity=0.352  Sum_probs=18.9

Q ss_pred             CCCeEEEEcCCCCeeecCCCCceeeecC
Q psy1181          51 GHPKVYINLDKPGNHSCGYCGLRFFKED   78 (82)
Q Consensus        51 gHP~Vyi~L~~~~~~~CpYCG~~y~~~~   78 (82)
                      |.|...-.+...+..+|||-|-+|-.++
T Consensus        47 g~~L~~g~~~~~~~i~CP~Hg~~Fd~~G   74 (123)
T cd03542          47 GAMLCRRKQGNKGTFTCPFHGWTFSNTG   74 (123)
T ss_pred             CCccccccccCCCEEECcCCCCEecCCc
Confidence            4444433344456899999999998544


No 130
>PF14569 zf-UDP:  Zinc-binding RING-finger; PDB: 1WEO_A.
Probab=29.54  E-value=17  Score=23.66  Aligned_cols=17  Identities=35%  Similarity=0.788  Sum_probs=7.6

Q ss_pred             CCCeeecCCCCceeeec
Q psy1181          61 KPGNHSCGYCGLRFFKE   77 (82)
Q Consensus        61 ~~~~~~CpYCG~~y~~~   77 (82)
                      ++|...||-|+++|..-
T Consensus        48 keg~q~CpqCkt~ykr~   64 (80)
T PF14569_consen   48 KEGNQVCPQCKTRYKRH   64 (80)
T ss_dssp             HTS-SB-TTT--B----
T ss_pred             hcCcccccccCCCcccc
Confidence            46788999999999753


No 131
>smart00746 TRASH metallochaperone-like domain.
Probab=29.51  E-value=25  Score=16.28  Aligned_cols=9  Identities=33%  Similarity=1.435  Sum_probs=7.2

Q ss_pred             cCCCCceee
Q psy1181          67 CGYCGLRFF   75 (82)
Q Consensus        67 CpYCG~~y~   75 (82)
                      |++||....
T Consensus         1 c~~C~~~~~    9 (39)
T smart00746        1 CSFCGKDIY    9 (39)
T ss_pred             CCCCCCCcc
Confidence            888988765


No 132
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=29.35  E-value=24  Score=19.91  Aligned_cols=10  Identities=30%  Similarity=0.690  Sum_probs=7.0

Q ss_pred             ecCCCCceee
Q psy1181          66 SCGYCGLRFF   75 (82)
Q Consensus        66 ~CpYCG~~y~   75 (82)
                      .||.||.+-.
T Consensus         1 ~CP~Cg~~a~   10 (47)
T PF04606_consen    1 RCPHCGSKAR   10 (47)
T ss_pred             CcCCCCCeeE
Confidence            4888887654


No 133
>PF06676 DUF1178:  Protein of unknown function (DUF1178);  InterPro: IPR009562 This family consists of several hypothetical bacterial proteins of around 150 residues in length. The function of this family is unknown.
Probab=29.04  E-value=30  Score=24.53  Aligned_cols=17  Identities=29%  Similarity=0.483  Sum_probs=12.8

Q ss_pred             CCCeeecCCCCceeeec
Q psy1181          61 KPGNHSCGYCGLRFFKE   77 (82)
Q Consensus        61 ~~~~~~CpYCG~~y~~~   77 (82)
                      ..|-..||+||..=+.+
T Consensus        29 ~~glv~CP~Cgs~~V~K   45 (148)
T PF06676_consen   29 ARGLVSCPVCGSTEVSK   45 (148)
T ss_pred             HcCCccCCCCCCCeEee
Confidence            34778999999876544


No 134
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=28.99  E-value=25  Score=19.23  Aligned_cols=14  Identities=36%  Similarity=0.610  Sum_probs=8.7

Q ss_pred             CeeecCCCCceeee
Q psy1181          63 GNHSCGYCGLRFFK   76 (82)
Q Consensus        63 ~~~~CpYCG~~y~~   76 (82)
                      ....|+.||-+|.+
T Consensus        20 ~~isC~~CGPr~~i   33 (35)
T PF07503_consen   20 QFISCTNCGPRYSI   33 (35)
T ss_dssp             TT--BTTCC-SCCC
T ss_pred             cCccCCCCCCCEEE
Confidence            35789999999865


No 135
>cd03474 Rieske_T4moC Toluene-4-monooxygenase effector protein complex (T4mo), Rieske ferredoxin subunit; The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer. T4mo is a four-protein complex that catalyzes the NADH- and O2-dependent hydroxylation of toluene to form p-cresol. T4mo consists of an NADH oxidoreductase (T4moF), a diiron hydroxylase (T4moH), a catalytic effector protein (T4moD), and a Rieske ferredoxin (T4moC). T4moC contains a Rieske domain and functions as an obligate electron carrier between T4moF and T4moH. Rieske ferredoxins are found as subunits of membrane oxidase complexes, cis-dihydrodiol-forming aromatic dioxygenases, bacterial assimilatory nitrite reductases, and arsenite oxidase. Rieske ferredoxins are also found as soluble electron carriers in bacterial dioxygenase and monooxygenase complexes.
Probab=28.91  E-value=90  Score=19.53  Aligned_cols=19  Identities=16%  Similarity=0.202  Sum_probs=15.9

Q ss_pred             CCeeecCCCCceeeecCCC
Q psy1181          62 PGNHSCGYCGLRFFKEDSH   80 (82)
Q Consensus        62 ~~~~~CpYCG~~y~~~~~~   80 (82)
                      .+...|||-|.+|-++++.
T Consensus        56 g~~i~CP~Hg~~Fdl~~G~   74 (108)
T cd03474          56 GGVLTCRAHLWQFDADTGE   74 (108)
T ss_pred             CCEEEeCCcCCEEECCCcc
Confidence            3589999999999988763


No 136
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins. The non-PICOT members of this family contain only the GRX-like domain, whereas PICOT contains an N-terminal TRX-like domain followed by one to three GRX-like domains. It is interesting to note that PICOT from plants contain three repeats of the GRX-like domain, metazoan proteins (except for insect) have two repeats, while fungal sequences contain only one copy of the domain. PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes. PICOT inhibits the activation of c-Jun N-terminal kinase and the transcription factors, AP-1 and NF-kB, induced by PKC theta or T-cell activating stimuli. Both GRX and TRX domains of PICOT are required for its activity. Characterized non-PICOT members of this family include CXIP1, a CAX-interacting protein 
Probab=28.88  E-value=35  Score=20.99  Aligned_cols=22  Identities=23%  Similarity=0.504  Sum_probs=14.8

Q ss_pred             CCCeEEEEcCCCCeeecCCCCc
Q psy1181          51 GHPKVYINLDKPGNHSCGYCGL   72 (82)
Q Consensus        51 gHP~Vyi~L~~~~~~~CpYCG~   72 (82)
                      .||.|-+.-..++.-.||||..
T Consensus         7 ~~~vvvf~k~~~~~~~Cp~C~~   28 (90)
T cd03028           7 ENPVVLFMKGTPEEPRCGFSRK   28 (90)
T ss_pred             cCCEEEEEcCCCCCCCCcHHHH
Confidence            5777766544345568999976


No 137
>cd03478 Rieske_AIFL_N AIFL (apoptosis-inducing factor like) family, N-terminal Rieske domain; members of this family show similarity to human AIFL, containing an N-terminal Rieske domain and a C-terminal pyridine nucleotide-disulfide oxidoreductase domain (Pyr_redox). The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer. AIFL shares 35% homology with human AIF (apoptosis-inducing factor), mainly in the Pyr_redox domain. AIFL is predominantly localized to the mitochondria. AIFL induces apoptosis in a caspase-dependent manner.
Probab=28.79  E-value=1.4e+02  Score=18.21  Aligned_cols=18  Identities=22%  Similarity=0.414  Sum_probs=15.1

Q ss_pred             CCeeecCCCCceeeecCC
Q psy1181          62 PGNHSCGYCGLRFFKEDS   79 (82)
Q Consensus        62 ~~~~~CpYCG~~y~~~~~   79 (82)
                      .+...|||-|.+|-++.+
T Consensus        54 ~~~i~CP~Hg~~Fdl~tG   71 (95)
T cd03478          54 DGRIRCPWHGACFNLRTG   71 (95)
T ss_pred             CCEEEcCCCCCEEECCCC
Confidence            468999999999998554


No 138
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=28.24  E-value=35  Score=17.87  Aligned_cols=10  Identities=30%  Similarity=0.783  Sum_probs=7.9

Q ss_pred             CeeecCCCCc
Q psy1181          63 GNHSCGYCGL   72 (82)
Q Consensus        63 ~~~~CpYCG~   72 (82)
                      ..-.||-||.
T Consensus        16 ~~~~CP~Cg~   25 (33)
T cd00350          16 APWVCPVCGA   25 (33)
T ss_pred             CCCcCcCCCC
Confidence            4568999986


No 139
>KOG1280|consensus
Probab=27.75  E-value=26  Score=28.58  Aligned_cols=25  Identities=32%  Similarity=0.725  Sum_probs=16.0

Q ss_pred             CCCCCeEEEEcC---------------CCCeeecCCCCce
Q psy1181          49 PTGHPKVYINLD---------------KPGNHSCGYCGLR   73 (82)
Q Consensus        49 ~lgHP~Vyi~L~---------------~~~~~~CpYCG~~   73 (82)
                      ...||.+=|-+.               .+..-+|||||..
T Consensus        49 ~~dHPmqcil~~~dfeL~f~Ge~i~~y~~qSftCPyC~~~   88 (381)
T KOG1280|consen   49 DEDHPMQCILSRVDFELYFGGEPISHYDPQSFTCPYCGIM   88 (381)
T ss_pred             CCCCceeEEeeccceeeEecCccccccccccccCCccccc
Confidence            347777655443               2334689999975


No 140
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=27.54  E-value=27  Score=21.16  Aligned_cols=15  Identities=27%  Similarity=0.479  Sum_probs=11.1

Q ss_pred             CCeeecCCCCceeee
Q psy1181          62 PGNHSCGYCGLRFFK   76 (82)
Q Consensus        62 ~~~~~CpYCG~~y~~   76 (82)
                      .-...||+||..+.-
T Consensus        12 ~v~~~Cp~cGipthc   26 (55)
T PF13824_consen   12 HVNFECPDCGIPTHC   26 (55)
T ss_pred             ccCCcCCCCCCcCcc
Confidence            345689999987654


No 141
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=27.50  E-value=38  Score=19.68  Aligned_cols=12  Identities=33%  Similarity=0.816  Sum_probs=6.1

Q ss_pred             CeeecCCCCcee
Q psy1181          63 GNHSCGYCGLRF   74 (82)
Q Consensus        63 ~~~~CpYCG~~y   74 (82)
                      +...|+-||..+
T Consensus        36 ~r~~C~~Cgyt~   47 (50)
T PRK00432         36 DRWHCGKCGYTE   47 (50)
T ss_pred             CcEECCCcCCEE
Confidence            344555555544


No 142
>PHA03294 envelope glycoprotein H; Provisional
Probab=27.45  E-value=46  Score=29.59  Aligned_cols=33  Identities=27%  Similarity=0.554  Sum_probs=19.5

Q ss_pred             EeeCCCCCCCCCCeEEEEcCCCCeeecCCCCceeee
Q psy1181          41 VWCDGGSGPTGHPKVYINLDKPGNHSCGYCGLRFFK   76 (82)
Q Consensus        41 v~C~Gg~~~lgHP~Vyi~L~~~~~~~CpYCG~~y~~   76 (82)
                      -.|....+  .+--+.|++.. ....|+|||..|..
T Consensus       701 ~~C~~~~~--~i~p~~l~~~~-~~~~C~yCgSV~mr  733 (835)
T PHA03294        701 ATCESTSG--NIEPVRLPRPG-NLKDCLYCGCVFMR  733 (835)
T ss_pred             CCccCCCC--CCCceEecCCC-CcccCCcCCeEEEE
Confidence            45755422  23334555443 34789999998853


No 143
>smart00238 BIR Baculoviral inhibition of apoptosis protein repeat. Domain found in inhibitor of apoptosis proteins (IAPs) and other proteins. Acts as a direct inhibitor of caspase enzymes.
Probab=27.18  E-value=52  Score=19.21  Aligned_cols=15  Identities=20%  Similarity=0.474  Sum_probs=11.8

Q ss_pred             CCeeecCCCCceeee
Q psy1181          62 PGNHSCGYCGLRFFK   76 (82)
Q Consensus        62 ~~~~~CpYCG~~y~~   76 (82)
                      ...+.|.||+..+..
T Consensus        34 ~d~v~C~~C~~~l~~   48 (71)
T smart00238       34 GDEVKCFFCGGELDN   48 (71)
T ss_pred             CCEEEeCCCCCCcCC
Confidence            347999999998754


No 144
>cd03541 Rieske_RO_Alpha_CMO Rieske non-heme iron oxygenase (RO) family, Choline monooxygenase (CMO) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth. The oxygenase alpha subunit contains an N-terminal Rieske domain with an [2Fe-2S] cluster and a C-terminal catalytic domain with a mononuclear Fe(II) binding site. The Rieske [2Fe-2S] cluster accepts electrons from a reductase or ferredoxin component and transfers them to the mononuclear iron for catalysis. CMO is a novel RO found in certain plants which catalyzes the first step in betaine synthesis. CMO is not found in animals or bacteria. In these organisms, the first step in betaine synthesis is catalyzed by either the membrane-bound choline dehydrogenase (CDH) or the soluble choline oxidase (COX).
Probab=27.16  E-value=48  Score=21.91  Aligned_cols=17  Identities=18%  Similarity=0.350  Sum_probs=14.5

Q ss_pred             CCeeecCCCCceeeecC
Q psy1181          62 PGNHSCGYCGLRFFKED   78 (82)
Q Consensus        62 ~~~~~CpYCG~~y~~~~   78 (82)
                      .+..+|||-|-+|-+++
T Consensus        58 ~~~i~CP~Hgw~f~l~G   74 (118)
T cd03541          58 KSCFVCPYHGWVYGLDG   74 (118)
T ss_pred             cCEEEeCCCCCEEcCCC
Confidence            35789999999998876


No 145
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=26.80  E-value=51  Score=19.23  Aligned_cols=23  Identities=22%  Similarity=0.430  Sum_probs=14.6

Q ss_pred             CCCeEEEEcCCCCeeecCCCCceee
Q psy1181          51 GHPKVYINLDKPGNHSCGYCGLRFF   75 (82)
Q Consensus        51 gHP~Vyi~L~~~~~~~CpYCG~~y~   75 (82)
                      ||...- ++ ......|+-||..+-
T Consensus        35 G~~~~~-~~-~~r~~~C~~Cg~~~~   57 (69)
T PF07282_consen   35 GHRNKK-RR-SGRVFTCPNCGFEMD   57 (69)
T ss_pred             cccccc-cc-ccceEEcCCCCCEEC
Confidence            666555 22 235678999988754


No 146
>PHA00733 hypothetical protein
Probab=26.50  E-value=34  Score=23.14  Aligned_cols=15  Identities=20%  Similarity=0.394  Sum_probs=9.0

Q ss_pred             CCeeecCCCCceeee
Q psy1181          62 PGNHSCGYCGLRFFK   76 (82)
Q Consensus        62 ~~~~~CpYCG~~y~~   76 (82)
                      ..+..|+.||+.|..
T Consensus        71 ~kPy~C~~Cgk~Fss   85 (128)
T PHA00733         71 VSPYVCPLCLMPFSS   85 (128)
T ss_pred             CCCccCCCCCCcCCC
Confidence            345566666666654


No 147
>TIGR00510 lipA lipoate synthase. The family shows strong sequence conservation.
Probab=26.47  E-value=53  Score=25.36  Aligned_cols=49  Identities=10%  Similarity=0.170  Sum_probs=30.7

Q ss_pred             hhhhcCCCeeecCceEeeCCCCCC-CCCCeEEEEcCCCCeeecCCCCceee
Q psy1181          26 DLIAEVPPKPCKERVVWCDGGSGP-TGHPKVYINLDKPGNHSCGYCGLRFF   75 (82)
Q Consensus        26 ~li~e~P~i~v~~r~v~C~Gg~~~-lgHP~Vyi~L~~~~~~~CpYCG~~y~   75 (82)
                      +++.+.-.-.|=+ .+.|+.-+.- .++=+.||.|...-...|.||+..+.
T Consensus        36 ~~~~~~~l~tvc~-~a~cpn~~ec~~~~tatfm~i~~gC~~~C~FC~v~~~   85 (302)
T TIGR00510        36 NTMKNKGLHTVCE-EASCPNLTECWNHGTATFMILGDICTRRCPFCDVAHG   85 (302)
T ss_pred             HHHHHCCCceeec-CCCCCCcccccCCCEEEEEecCcCcCCCCCcCCccCC
Confidence            4444444433311 1356544332 37788999998877899999998654


No 148
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=26.21  E-value=29  Score=17.53  Aligned_cols=11  Identities=18%  Similarity=0.238  Sum_probs=9.0

Q ss_pred             eecCCCCceee
Q psy1181          65 HSCGYCGLRFF   75 (82)
Q Consensus        65 ~~CpYCG~~y~   75 (82)
                      +.||-|++.+.
T Consensus         2 v~CPiC~~~v~   12 (26)
T smart00734        2 VQCPVCFREVP   12 (26)
T ss_pred             CcCCCCcCccc
Confidence            57999999873


No 149
>KOG3623|consensus
Probab=26.03  E-value=16  Score=32.71  Aligned_cols=16  Identities=25%  Similarity=0.536  Sum_probs=14.3

Q ss_pred             eeecCCCCceeeecCC
Q psy1181          64 NHSCGYCGLRFFKEDS   79 (82)
Q Consensus        64 ~~~CpYCG~~y~~~~~   79 (82)
                      ...|+.||+.|++++|
T Consensus       281 KFKCtECgKAFKfKHH  296 (1007)
T KOG3623|consen  281 KFKCTECGKAFKFKHH  296 (1007)
T ss_pred             cccccccchhhhhHHH
Confidence            5789999999999886


No 150
>PF10080 DUF2318:  Predicted membrane protein (DUF2318);  InterPro: IPR018758 This domain of unknown function is found in hypothetical bacterial membrane proteins with no known function. 
Probab=25.99  E-value=40  Score=22.44  Aligned_cols=21  Identities=29%  Similarity=0.638  Sum_probs=16.4

Q ss_pred             EEEcCCCCeeecCCCCceeeecC
Q psy1181          56 YINLDKPGNHSCGYCGLRFFKED   78 (82)
Q Consensus        56 yi~L~~~~~~~CpYCG~~y~~~~   78 (82)
                      |..  +.+.+.|..||++|.+..
T Consensus        46 Y~q--~g~~lvC~~C~~~~~~~~   66 (102)
T PF10080_consen   46 YYQ--EGDQLVCKNCGVRFNLPT   66 (102)
T ss_pred             eEE--ECCEEEEecCCCEEehhh
Confidence            663  457899999999997653


No 151
>cd03467 Rieske Rieske domain; a [2Fe-2S] cluster binding domain commonly found in Rieske non-heme iron oxygenase (RO) systems such as naphthalene and biphenyl dioxygenases, as well as in plant/cyanobacterial chloroplast b6f and mitochondrial cytochrome bc(1) complexes. The Rieske domain can be divided into two subdomains, with an incomplete six-stranded, antiparallel beta-barrel at one end, and an iron-sulfur cluster binding subdomain at the other. The Rieske iron-sulfur center contains a [2Fe-2S] cluster, which is involved in electron transfer, and is liganded to two histidine and two cysteine residues present in conserved sequences called Rieske motifs. In RO systems, the N-terminal Rieske domain of the alpha subunit acts as an electron shuttle that accepts electrons from a reductase or ferredoxin component and transfers them to the mononuclear iron in the alpha subunit C-terminal domain to be used for catalysis.
Probab=25.82  E-value=1.6e+02  Score=17.82  Aligned_cols=40  Identities=20%  Similarity=0.165  Sum_probs=23.6

Q ss_pred             ceEeeCCCCCCCCCCeEEEEcCCCCeeecCCCCceeeecCC
Q psy1181          39 RVVWCDGGSGPTGHPKVYINLDKPGNHSCGYCGLRFFKEDS   79 (82)
Q Consensus        39 r~v~C~Gg~~~lgHP~Vyi~L~~~~~~~CpYCG~~y~~~~~   79 (82)
                      ...+.++--+-.|-|...-. ...+...||+-|.+|-+++|
T Consensus        34 ~~~a~~~~CpH~g~~l~~~~-~~~~~i~Cp~H~~~f~~~~G   73 (98)
T cd03467          34 EVYALSNRCTHQGCPLSEGE-GEDGCIVCPCHGSRFDLRTG   73 (98)
T ss_pred             EEEEEcCcCCCCCccCCcCc-cCCCEEEeCCCCCEEeCCCc
Confidence            45554443333333332222 23578999999999999654


No 152
>PRK06366 acetyl-CoA acetyltransferase; Provisional
Probab=25.79  E-value=23  Score=27.69  Aligned_cols=37  Identities=24%  Similarity=0.303  Sum_probs=25.9

Q ss_pred             ccChhHHHhhhhcCCCeeecCceEeeCCCCCCCCCCe
Q psy1181          18 HVNTQFAIDLIAEVPPKPCKERVVWCDGGSGPTGHPK   54 (82)
Q Consensus        18 ~~n~~~a~~li~e~P~i~v~~r~v~C~Gg~~~lgHP~   54 (82)
                      ++|..+|..-+....-..++..+|.-.||.-++|||.
T Consensus       309 Ei~daFa~~~l~~le~lgl~g~~vN~~GG~la~GHP~  345 (388)
T PRK06366        309 EHNEAFSIASIIVRDQLKIDNERFNVNGGAVAIGHPI  345 (388)
T ss_pred             eccchhHHHHHHHHHHhCCCCCccCCCCchhhhCCCc
Confidence            5566666655555555555666899998877889993


No 153
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=25.77  E-value=43  Score=22.21  Aligned_cols=30  Identities=23%  Similarity=0.547  Sum_probs=16.6

Q ss_pred             cCceEeeCCCCCCCCCCeEEEEcCCCCeeecCCCCce
Q psy1181          37 KERVVWCDGGSGPTGHPKVYINLDKPGNHSCGYCGLR   73 (82)
Q Consensus        37 ~~r~v~C~Gg~~~lgHP~Vyi~L~~~~~~~CpYCG~~   73 (82)
                      -.-.+.|.-=+.       ++.+.......||.||..
T Consensus        67 ~p~~~~C~~Cg~-------~~~~~~~~~~~CP~Cgs~   96 (114)
T PRK03681         67 QEAECWCETCQQ-------YVTLLTQRVRRCPQCHGD   96 (114)
T ss_pred             eCcEEEcccCCC-------eeecCCccCCcCcCcCCC
Confidence            344567753221       444443333579999965


No 154
>TIGR03655 anti_R_Lar restriction alleviation protein, Lar family. Restriction alleviation proteins provide a countermeasure to host cell restriction enzyme defense against foreign DNA such as phage or plasmids. This family consists of homologs to the phage antirestriction protein Lar, and most members belong to phage genomes or prophage regions of bacterial genomes.
Probab=25.62  E-value=30  Score=19.82  Aligned_cols=10  Identities=30%  Similarity=0.803  Sum_probs=7.2

Q ss_pred             ecCCCCceee
Q psy1181          66 SCGYCGLRFF   75 (82)
Q Consensus        66 ~CpYCG~~y~   75 (82)
                      .||.||-.=.
T Consensus         3 PCPfCGg~~~   12 (53)
T TIGR03655         3 PCPFCGGADV   12 (53)
T ss_pred             CCCCCCCcce
Confidence            5999996533


No 155
>TIGR02646 conserved hypothetical protein TIGR02646. Members of this uncharacterized protein family are found exclusively in bacteria. Neighboring genes in various genomes are also uncharacterized or may annotated as similar to restriction system proteins.
Probab=25.55  E-value=31  Score=23.46  Aligned_cols=14  Identities=21%  Similarity=0.425  Sum_probs=10.2

Q ss_pred             eeecCCCCceeeec
Q psy1181          64 NHSCGYCGLRFFKE   77 (82)
Q Consensus        64 ~~~CpYCG~~y~~~   77 (82)
                      ...|.||+..+...
T Consensus        24 ~~~C~YC~~~~~~~   37 (144)
T TIGR02646        24 GGLCAYCEREIELL   37 (144)
T ss_pred             CCCcCccCCCcCCC
Confidence            35799999966533


No 156
>PRK06245 cofG FO synthase subunit 1; Reviewed
Probab=25.44  E-value=40  Score=25.50  Aligned_cols=21  Identities=33%  Similarity=0.798  Sum_probs=16.5

Q ss_pred             CCeEEEEcCCCCeeecCCCCc
Q psy1181          52 HPKVYINLDKPGNHSCGYCGL   72 (82)
Q Consensus        52 HP~Vyi~L~~~~~~~CpYCG~   72 (82)
                      =+..+|++...-...|.||+-
T Consensus        11 ~~~~~i~~Tn~C~~~C~fC~~   31 (336)
T PRK06245         11 SRNVFIPLTYECRNRCGYCTF   31 (336)
T ss_pred             ecceeeeccccccCCCccCCC
Confidence            356678887777889999984


No 157
>PRK00420 hypothetical protein; Validated
Probab=25.11  E-value=47  Score=22.58  Aligned_cols=18  Identities=22%  Similarity=0.429  Sum_probs=14.6

Q ss_pred             CCCeeecCCCCceeeecC
Q psy1181          61 KPGNHSCGYCGLRFFKED   78 (82)
Q Consensus        61 ~~~~~~CpYCG~~y~~~~   78 (82)
                      +.|...||-||..+.-+.
T Consensus        37 k~g~~~Cp~Cg~~~~v~~   54 (112)
T PRK00420         37 KDGEVVCPVHGKVYIVKS   54 (112)
T ss_pred             CCCceECCCCCCeeeecc
Confidence            578999999999876544


No 158
>smart00507 HNHc HNH nucleases.
Probab=24.90  E-value=29  Score=18.01  Aligned_cols=11  Identities=36%  Similarity=0.830  Sum_probs=9.2

Q ss_pred             eecCCCCceee
Q psy1181          65 HSCGYCGLRFF   75 (82)
Q Consensus        65 ~~CpYCG~~y~   75 (82)
                      ..|.|||..+.
T Consensus        11 ~~C~~C~~~~~   21 (52)
T smart00507       11 GVCAYCGKPAS   21 (52)
T ss_pred             CCCcCCcCCCC
Confidence            58999999874


No 159
>PF03470 zf-XS:  XS zinc finger domain;  InterPro: IPR005381 This domain is a putative nucleic acid binding zinc finger and is found at the N terminus of proteins that also contain an adjacent XS domain IPR005380 from INTERPRO and in some proteins a C-terminal XH domain IPR005379 from INTERPRO.
Probab=24.82  E-value=30  Score=20.01  Aligned_cols=7  Identities=29%  Similarity=1.103  Sum_probs=5.7

Q ss_pred             cCCCCce
Q psy1181          67 CGYCGLR   73 (82)
Q Consensus        67 CpYCG~~   73 (82)
                      ||||...
T Consensus         1 CP~C~~k    7 (43)
T PF03470_consen    1 CPFCPGK    7 (43)
T ss_pred             CCCCCCC
Confidence            9999764


No 160
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=24.74  E-value=66  Score=16.92  Aligned_cols=13  Identities=23%  Similarity=0.733  Sum_probs=10.3

Q ss_pred             eecCCCCceeeec
Q psy1181          65 HSCGYCGLRFFKE   77 (82)
Q Consensus        65 ~~CpYCG~~y~~~   77 (82)
                      ..|+-||..|...
T Consensus        33 ~~C~~CGE~~~~~   45 (46)
T TIGR03831        33 LVCPQCGEEYLDA   45 (46)
T ss_pred             cccccCCCEeeCC
Confidence            3699999998754


No 161
>cd03532 Rieske_RO_Alpha_VanA_DdmC Rieske non-heme iron oxygenase (RO) family, Vanillate-O-demethylase oxygenase (VanA) and dicamba O-demethylase oxygenase (DdmC) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth. The oxygenase alpha subunit contains an N-terminal Rieske domain with an [2Fe-2S] cluster and a C-terminal catalytic domain with a mononuclear Fe(II) binding site. The Rieske [2Fe-2S] cluster accepts electrons from a reductase or ferredoxin component and transfers them to the mononuclear iron for catalysis. Vanillate-O-demethylase is a heterodimeric enzyme consisting of a terminal oxygenase (VanA) and reductase (VanB) components. This enzyme reductively catalyzes the conversion of vanillate into protocatechuate and formaldehyde. Protocatechuate and vanillate are important intermediate metabolites in the degrad
Probab=24.74  E-value=96  Score=19.91  Aligned_cols=17  Identities=41%  Similarity=0.853  Sum_probs=14.1

Q ss_pred             CCeeecCCCCceeeecC
Q psy1181          62 PGNHSCGYCGLRFFKED   78 (82)
Q Consensus        62 ~~~~~CpYCG~~y~~~~   78 (82)
                      .+...|||.|-+|-.++
T Consensus        60 ~~~i~Cp~Hg~~fd~~G   76 (116)
T cd03532          60 GGGLVCGYHGLEFDSDG   76 (116)
T ss_pred             CCEEEeCCCCcEEcCCC
Confidence            46899999999998543


No 162
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=24.20  E-value=52  Score=24.58  Aligned_cols=15  Identities=27%  Similarity=0.572  Sum_probs=10.4

Q ss_pred             CCeeecCCCCceeee
Q psy1181          62 PGNHSCGYCGLRFFK   76 (82)
Q Consensus        62 ~~~~~CpYCG~~y~~   76 (82)
                      +..-.|+.|++.|+-
T Consensus        75 ~~K~~C~lc~KlFkg   89 (214)
T PF04959_consen   75 EDKWRCPLCGKLFKG   89 (214)
T ss_dssp             SEEEEE-SSS-EESS
T ss_pred             CCEECCCCCCcccCC
Confidence            456899999999964


No 163
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=24.09  E-value=34  Score=20.81  Aligned_cols=11  Identities=27%  Similarity=0.652  Sum_probs=8.2

Q ss_pred             eecCCCCceee
Q psy1181          65 HSCGYCGLRFF   75 (82)
Q Consensus        65 ~~CpYCG~~y~   75 (82)
                      ..|++||..-.
T Consensus         4 kHC~~CG~~Ip   14 (59)
T PF09889_consen    4 KHCPVCGKPIP   14 (59)
T ss_pred             CcCCcCCCcCC
Confidence            46999997643


No 164
>PRK10824 glutaredoxin-4; Provisional
Probab=24.08  E-value=48  Score=22.23  Aligned_cols=23  Identities=22%  Similarity=0.423  Sum_probs=13.7

Q ss_pred             CCCeEEEEcCCCCeeecCCCCce
Q psy1181          51 GHPKVYINLDKPGNHSCGYCGLR   73 (82)
Q Consensus        51 gHP~Vyi~L~~~~~~~CpYCG~~   73 (82)
                      .||.|-+.-..+..-.||||.+.
T Consensus        14 ~~~Vvvf~Kg~~~~p~Cpyc~~a   36 (115)
T PRK10824         14 ENPILLYMKGSPKLPSCGFSAQA   36 (115)
T ss_pred             cCCEEEEECCCCCCCCCchHHHH
Confidence            45555553333445689999754


No 165
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=24.01  E-value=60  Score=19.13  Aligned_cols=18  Identities=22%  Similarity=0.501  Sum_probs=13.8

Q ss_pred             CCeeecCCCCceeeecCC
Q psy1181          62 PGNHSCGYCGLRFFKEDS   79 (82)
Q Consensus        62 ~~~~~CpYCG~~y~~~~~   79 (82)
                      +....|.-||..|+...+
T Consensus         2 Dk~l~C~dCg~~FvfTa~   19 (49)
T PF13451_consen    2 DKTLTCKDCGAEFVFTAG   19 (49)
T ss_pred             CeeEEcccCCCeEEEehh
Confidence            346789999999987543


No 166
>PF14952 zf-tcix:  Putative treble-clef, zinc-finger, Zn-binding
Probab=23.60  E-value=36  Score=19.90  Aligned_cols=11  Identities=36%  Similarity=0.827  Sum_probs=8.8

Q ss_pred             CeeecCCCCce
Q psy1181          63 GNHSCGYCGLR   73 (82)
Q Consensus        63 ~~~~CpYCG~~   73 (82)
                      |...||-||+-
T Consensus        10 GirkCp~CGt~   20 (44)
T PF14952_consen   10 GIRKCPKCGTY   20 (44)
T ss_pred             ccccCCcCcCc
Confidence            67789999863


No 167
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=23.54  E-value=38  Score=20.01  Aligned_cols=9  Identities=44%  Similarity=1.217  Sum_probs=7.3

Q ss_pred             eeecCCCCc
Q psy1181          64 NHSCGYCGL   72 (82)
Q Consensus        64 ~~~CpYCG~   72 (82)
                      .-+|++||.
T Consensus        44 ~y~C~~Cg~   52 (54)
T PF10058_consen   44 QYRCPYCGA   52 (54)
T ss_pred             EEEcCCCCC
Confidence            458999995


No 168
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=23.36  E-value=60  Score=17.73  Aligned_cols=16  Identities=19%  Similarity=0.407  Sum_probs=11.5

Q ss_pred             eeecCCCCcee-eecCC
Q psy1181          64 NHSCGYCGLRF-FKEDS   79 (82)
Q Consensus        64 ~~~CpYCG~~y-~~~~~   79 (82)
                      .+.||+|+..= +.+.|
T Consensus         5 ~v~CP~C~s~~~v~k~G   21 (36)
T PF03811_consen    5 DVHCPRCQSTEGVKKNG   21 (36)
T ss_pred             eeeCCCCCCCCcceeCC
Confidence            47899999865 55554


No 169
>PF14122 YokU:  YokU-like protein
Probab=22.95  E-value=87  Score=20.69  Aligned_cols=36  Identities=22%  Similarity=0.659  Sum_probs=21.4

Q ss_pred             eeCCCCCCCCCCeEEEEcC---------CCCeeecCCCCceeeec
Q psy1181          42 WCDGGSGPTGHPKVYINLD---------KPGNHSCGYCGLRFFKE   77 (82)
Q Consensus        42 ~C~Gg~~~lgHP~Vyi~L~---------~~~~~~CpYCG~~y~~~   77 (82)
                      +|.+.....+--.||-.|.         .+-...|.-||-.|.-+
T Consensus         4 wC~~~~a~~~~~tvyWeLpdGtraIeI~~tP~i~C~~CgmvYq~d   48 (87)
T PF14122_consen    4 WCGSEEASESESTVYWELPDGTRAIEITDTPAIICSNCGMVYQDD   48 (87)
T ss_pred             cccCcccccccceEEEEcCCCceEEEecCCceeeecCCCcEEehh
Confidence            4544333334445555444         33456899999999754


No 170
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=22.93  E-value=19  Score=21.07  Aligned_cols=12  Identities=33%  Similarity=0.800  Sum_probs=3.8

Q ss_pred             eecCCCCceeee
Q psy1181          65 HSCGYCGLRFFK   76 (82)
Q Consensus        65 ~~CpYCG~~y~~   76 (82)
                      ..|..|++.|-+
T Consensus        10 ~~C~~C~~~F~~   21 (69)
T PF01363_consen   10 SNCMICGKKFSL   21 (69)
T ss_dssp             SB-TTT--B-BS
T ss_pred             CcCcCcCCcCCC
Confidence            445555555533


No 171
>KOG3993|consensus
Probab=22.50  E-value=22  Score=29.83  Aligned_cols=17  Identities=35%  Similarity=0.813  Sum_probs=13.9

Q ss_pred             CCCeeecCCCCceeeec
Q psy1181          61 KPGNHSCGYCGLRFFKE   77 (82)
Q Consensus        61 ~~~~~~CpYCG~~y~~~   77 (82)
                      .+|...|.+||+.|...
T Consensus       353 s~gi~~C~~C~KkFrRq  369 (500)
T KOG3993|consen  353 SSGIFSCHTCGKKFRRQ  369 (500)
T ss_pred             cCceeecHHhhhhhHHH
Confidence            45788999999999754


No 172
>PF14239 RRXRR:  RRXRR protein
Probab=22.49  E-value=39  Score=24.66  Aligned_cols=40  Identities=20%  Similarity=0.313  Sum_probs=23.5

Q ss_pred             ccCCcCccccccccc-------------ChhHHHhhhhcCCCeeecCceEeeC
Q psy1181           5 DDYRPVRFVDKEKHV-------------NTQFAIDLIAEVPPKPCKERVVWCD   44 (82)
Q Consensus         5 ~~~~~~rf~~~~~~~-------------n~~~a~~li~e~P~i~v~~r~v~C~   44 (82)
                      --||..||.|+.+..             .-.|...|..=.|+..+.-..|.=|
T Consensus       107 ~RyR~~RF~NR~r~~gwL~PSl~~rv~~~l~~v~~L~~~~PIt~i~~E~v~FD  159 (176)
T PF14239_consen  107 TRYRKARFDNRKRPKGWLPPSLRHRVDTHLRWVKRLCKLLPITAIVVELVKFD  159 (176)
T ss_pred             cccccccccccCCCCCCcCcCHHHHHHHHHHHHHHHHHhCCccceEEEEEEee
Confidence            369999999987542             1233344555566655554444443


No 173
>PF14616 DUF4451:  Domain of unknown function (DUF4451)
Probab=22.38  E-value=1.1e+02  Score=20.64  Aligned_cols=16  Identities=25%  Similarity=0.472  Sum_probs=12.5

Q ss_pred             eeecCCCC--ceeeecCC
Q psy1181          64 NHSCGYCG--LRFFKEDS   79 (82)
Q Consensus        64 ~~~CpYCG--~~y~~~~~   79 (82)
                      ..-||||-  .-|.++.+
T Consensus        25 eGlCp~C~~~~wl~lKnS   42 (124)
T PF14616_consen   25 EGLCPYCPGGNWLKLKNS   42 (124)
T ss_pred             eeECCCCCCCcEeeeccc
Confidence            78999998  77777664


No 174
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=22.31  E-value=39  Score=24.44  Aligned_cols=17  Identities=24%  Similarity=0.577  Sum_probs=13.1

Q ss_pred             EEEcCCCCeeecCCCCce
Q psy1181          56 YINLDKPGNHSCGYCGLR   73 (82)
Q Consensus        56 yi~L~~~~~~~CpYCG~~   73 (82)
                      |+-.+ +-+..||-||..
T Consensus       142 y~~~g-e~P~~CPiCga~  158 (166)
T COG1592         142 YTHEG-EAPEVCPICGAP  158 (166)
T ss_pred             CcccC-CCCCcCCCCCCh
Confidence            66666 678899999953


No 175
>PF13821 DUF4187:  Domain of unknown function (DUF4187)
Probab=21.78  E-value=33  Score=20.37  Aligned_cols=14  Identities=29%  Similarity=0.835  Sum_probs=11.2

Q ss_pred             eeecCCCCceeeec
Q psy1181          64 NHSCGYCGLRFFKE   77 (82)
Q Consensus        64 ~~~CpYCG~~y~~~   77 (82)
                      -.-|=|||..|...
T Consensus        27 ~~YC~~Cg~~Y~d~   40 (55)
T PF13821_consen   27 HNYCFWCGTKYDDE   40 (55)
T ss_pred             CceeeeeCCccCCH
Confidence            45799999999754


No 176
>cd03530 Rieske_NirD_small_Bacillus Small subunit of nitrite reductase (NirD) family, Rieske domain; composed of proteins similar to the Bacillus subtilis small subunit of assimilatory nitrite reductase containing a Rieske domain. The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer. Assimilatory nitrate and nitrite reductases convert nitrate through nitrite to ammonium.
Probab=21.47  E-value=1.9e+02  Score=17.56  Aligned_cols=18  Identities=11%  Similarity=0.010  Sum_probs=15.5

Q ss_pred             CCeeecCCCCceeeecCC
Q psy1181          62 PGNHSCGYCGLRFFKEDS   79 (82)
Q Consensus        62 ~~~~~CpYCG~~y~~~~~   79 (82)
                      .+...|||=|.+|-++++
T Consensus        56 ~~~i~Cp~Hg~~Fdl~~G   73 (98)
T cd03530          56 GEYVTCPLHNWVIDLETG   73 (98)
T ss_pred             CCEEECCCCCCEEECCCC
Confidence            468999999999998765


No 177
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=21.43  E-value=66  Score=21.89  Aligned_cols=51  Identities=22%  Similarity=0.328  Sum_probs=29.2

Q ss_pred             HHhhhhcCCCee-e---cCceEeeCCCCC--------CCCCCeEEEEcCCCCeeecCCCCceeee
Q psy1181          24 AIDLIAEVPPKP-C---KERVVWCDGGSG--------PTGHPKVYINLDKPGNHSCGYCGLRFFK   76 (82)
Q Consensus        24 a~~li~e~P~i~-v---~~r~v~C~Gg~~--------~lgHP~Vyi~L~~~~~~~CpYCG~~y~~   76 (82)
                      ..+++....+.. .   -+|=..|.|.--        ..-.|.||-..+  ..-.||=||+.|=.
T Consensus        74 L~ev~~~~~l~~~~~~~~sRC~~CN~~L~~v~~~~v~~~vp~~v~~~~~--~f~~C~~C~kiyW~  136 (147)
T PF01927_consen   74 LREVLERFGLKLRLDPIFSRCPKCNGPLRPVSKEEVKDRVPPYVYETYD--EFWRCPGCGKIYWE  136 (147)
T ss_pred             HHHHHHHcCCccccCCCCCccCCCCcEeeechhhccccccCccccccCC--eEEECCCCCCEecc
Confidence            344555555432 2   256666766321        124556665543  37899999999854


No 178
>PRK02048 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Provisional
Probab=21.37  E-value=51  Score=28.47  Aligned_cols=17  Identities=29%  Similarity=0.475  Sum_probs=13.5

Q ss_pred             EcCCCCeeecCCCCcee
Q psy1181          58 NLDKPGNHSCGYCGLRF   74 (82)
Q Consensus        58 ~L~~~~~~~CpYCG~~y   74 (82)
                      .+.|++.+.||=||+.+
T Consensus       512 R~sKTEyISCPsCGRTL  528 (611)
T PRK02048        512 RTSKTEYISCPGCGRTL  528 (611)
T ss_pred             ccccceEEECCCCCcch
Confidence            34567789999999875


No 179
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=21.33  E-value=18  Score=23.89  Aligned_cols=10  Identities=30%  Similarity=0.909  Sum_probs=5.8

Q ss_pred             CeeecCCCCc
Q psy1181          63 GNHSCGYCGL   72 (82)
Q Consensus        63 ~~~~CpYCG~   72 (82)
                      ....||+||.
T Consensus        35 a~y~CpfCgk   44 (90)
T PTZ00255         35 AKYFCPFCGK   44 (90)
T ss_pred             CCccCCCCCC
Confidence            3456666664


No 180
>cd01449 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain. TST contains 2 copies of the Rhodanese Homology Domain; this is the second repeat. Only the second repeat contains the catalytically active Cys residue.
Probab=21.29  E-value=84  Score=19.40  Aligned_cols=32  Identities=28%  Similarity=0.443  Sum_probs=19.1

Q ss_pred             hhhhcCCCeeecCceEeeCCCCC---------CCCCCeEEE
Q psy1181          26 DLIAEVPPKPCKERVVWCDGGSG---------PTGHPKVYI   57 (82)
Q Consensus        26 ~li~e~P~i~v~~r~v~C~Gg~~---------~lgHP~Vyi   57 (82)
                      .++.+..+..-..-++.|.+|..         .+||+.|++
T Consensus        68 ~~~~~~~~~~~~~iv~yc~~g~~s~~~~~~l~~~G~~~v~~  108 (118)
T cd01449          68 ALFAALGITPDKPVIVYCGSGVTACVLLLALELLGYKNVRL  108 (118)
T ss_pred             HHHHHcCCCCCCCEEEECCcHHHHHHHHHHHHHcCCCCeee
Confidence            44444444344456788987532         259988764


No 181
>PRK08116 hypothetical protein; Validated
Probab=21.26  E-value=44  Score=24.89  Aligned_cols=15  Identities=33%  Similarity=0.742  Sum_probs=11.1

Q ss_pred             CCCeeecCCCCceee
Q psy1181          61 KPGNHSCGYCGLRFF   75 (82)
Q Consensus        61 ~~~~~~CpYCG~~y~   75 (82)
                      .++...|++||....
T Consensus        13 ~~~~~~C~~Cg~~~~   27 (268)
T PRK08116         13 EDGGEYCEVCGKRIE   27 (268)
T ss_pred             cccCccCcCCCCcce
Confidence            446678999998654


No 182
>PF09180 ProRS-C_1:  Prolyl-tRNA synthetase, C-terminal;  InterPro: IPR016061 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology []. The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric []. Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices [], and are mostly dimeric or multimeric, containing at least three conserved regions [, , ]. However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases []. Based on their mode of binding to the tRNA acceptor stem, both classes of tRNA synthetases have been subdivided into three subclasses, designated 1a, 1b, 1c and 2a, 2b, 2c. Prolyl tRNA synthetase (6.1.1.15 from EC) exists in two forms, which are loosely related. The first form is present in the majority of eubacteria species. The second one, present in some eubacteria, is essentially present in archaea and eukaryota. Prolyl-tRNA synthetase belongs to class IIa.  This domain is found at the C-terminal in archaeal and eukaryotic enzymes, as well as in certain bacterial ones.; GO: 0000166 nucleotide binding, 0004827 proline-tRNA ligase activity, 0005524 ATP binding, 0006433 prolyl-tRNA aminoacylation, 0005737 cytoplasm; PDB: 1NJ6_A 1NJ2_A 1NJ5_A 1NJ1_A 1H4T_C 1H4S_A 1HC7_C 1H4Q_B 3IAL_B.
Probab=20.87  E-value=42  Score=20.31  Aligned_cols=12  Identities=33%  Similarity=0.747  Sum_probs=6.6

Q ss_pred             CCeeecCCCCce
Q psy1181          62 PGNHSCGYCGLR   73 (82)
Q Consensus        62 ~~~~~CpYCG~~   73 (82)
                      .....|.+||+.
T Consensus        46 ~~~~~Ci~cgk~   57 (68)
T PF09180_consen   46 PEGGKCIVCGKP   57 (68)
T ss_dssp             BTT-B-TTT-SB
T ss_pred             CCCCeeecCCCh
Confidence            456899999963


No 183
>PRK00423 tfb transcription initiation factor IIB; Reviewed
Probab=20.31  E-value=57  Score=24.92  Aligned_cols=16  Identities=31%  Similarity=0.588  Sum_probs=12.9

Q ss_pred             CCCCeeecCCCCceee
Q psy1181          60 DKPGNHSCGYCGLRFF   75 (82)
Q Consensus        60 ~~~~~~~CpYCG~~y~   75 (82)
                      ...|...|..||+...
T Consensus        26 ~~~Ge~vC~~CG~Vl~   41 (310)
T PRK00423         26 YERGEIVCADCGLVIE   41 (310)
T ss_pred             CCCCeEeecccCCccc
Confidence            3579999999998763


Done!