Query         psy11836
Match_columns 112
No_of_seqs    103 out of 1165
Neff          10.0
Searched_HMMs 46136
Date          Fri Aug 16 20:11:57 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy11836.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/11836hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PHA03234 DNA packaging protein  99.8 5.3E-20 1.1E-24  125.3   7.1   76    2-77    240-323 (338)
  2 KOG4219|consensus               99.8 7.3E-20 1.6E-24  124.2   4.4   77    1-77    263-342 (423)
  3 PHA03235 DNA packaging protein  99.8 5.9E-19 1.3E-23  122.7   8.3   70    2-71    247-324 (409)
  4 PHA02834 chemokine receptor-li  99.7 6.9E-18 1.5E-22  114.3   6.7   69    2-70    232-309 (323)
  5 PHA02638 CC chemokine receptor  99.7 1.3E-16 2.9E-21  111.3   6.4   71    1-71    315-398 (417)
  6 KOG4220|consensus               99.7 2.7E-17 5.8E-22  112.3   1.9   68    2-70    420-487 (503)
  7 PHA03087 G protein-coupled che  99.5 9.7E-15 2.1E-19   99.1   5.7   69    2-70    247-323 (335)
  8 KOG2087|consensus               99.1 4.2E-12 9.2E-17   85.8  -1.7   81    2-82    238-318 (363)
  9 PF00001 7tm_1:  7 transmembran  99.0 9.5E-10 2.1E-14   70.8   4.6   52    2-53    205-257 (257)
 10 PF10324 7TM_GPCR_Srw:  Serpent  98.4 9.3E-07   2E-11   59.9   5.1   69    2-70    245-317 (318)
 11 PF10320 7TM_GPCR_Srsx:  Serpen  97.4 5.4E-05 1.2E-09   50.1   1.3   67    2-68    190-257 (257)
 12 PF05462 Dicty_CAR:  Slime mold  97.1  0.0045 9.7E-08   42.2   7.3   63    5-70    208-270 (303)
 13 PF11970 Git3_C:  G protein-cou  97.0   0.001 2.2E-08   36.1   3.3   53    6-58     19-72  (76)
 14 PF10323 7TM_GPCR_Srv:  Serpent  96.5   0.011 2.5E-07   39.7   5.9   37   34-70    247-283 (283)
 15 PF05296 TAS2R:  Mammalian tast  96.3   0.016 3.5E-07   39.4   5.8   67    4-70    235-301 (303)
 16 PF10321 7TM_GPCR_Srt:  Serpent  95.4    0.02 4.3E-07   39.3   3.3   39   31-69    268-306 (313)
 17 PF02101 Ocular_alb:  Ocular al  93.9     0.1 2.3E-06   36.6   3.8   20    2-21    247-266 (405)
 18 PF10317 7TM_GPCR_Srd:  Serpent  90.6    0.45 9.7E-06   32.2   3.7   55   10-66    238-292 (292)
 19 PF10318 7TM_GPCR_Srh:  Serpent  89.7     1.4 3.1E-05   29.7   5.6   60    8-70    243-302 (302)
 20 KOG4564|consensus               87.7    0.95 2.1E-05   33.0   3.8   31   41-71    390-420 (473)
 21 PF10328 7TM_GPCR_Srx:  Serpent  80.8       1 2.2E-05   30.0   1.5   24   44-67    249-272 (274)
 22 PF10326 7TM_GPCR_Str:  Serpent  77.2    0.26 5.5E-06   33.4  -2.3   55    8-65    253-307 (307)
 23 PF10327 7TM_GPCR_Sri:  Serpent  75.3       3 6.5E-05   28.5   2.5   55    7-63    248-302 (303)
 24 KOG2575|consensus               67.2     3.2 6.9E-05   29.9   1.2   17    2-18    262-278 (510)
 25 PF03125 Sre:  C. elegans Sre G  66.8      42 0.00091   23.6   7.4   39   33-71    284-322 (365)
 26 PF03402 V1R:  Vomeronasal orga  54.8      19 0.00042   24.3   3.2   60    2-64    204-263 (265)
 27 PHA02849 putative transmembran  49.2      22 0.00047   19.4   2.2   22    2-23     19-40  (82)
 28 KOG4686|consensus               44.3      26 0.00057   24.7   2.6   20    2-21    270-289 (459)
 29 PF10624 TraS:  Plasmid conjuga  43.5      16 0.00035   22.1   1.3   49    4-52     30-80  (164)
 30 PF05391 Lsm_interact:  Lsm int  43.5      13 0.00027   14.9   0.6    9   56-64     11-19  (21)
 31 PHA02657 hypothetical protein;  43.1      31 0.00067   19.2   2.3   21    3-23     30-50  (95)
 32 PF05393 Hum_adeno_E3A:  Human   43.0      13 0.00028   20.8   0.8   10    4-13     47-56  (94)
 33 KOG4193|consensus               42.2      46 0.00099   25.5   3.7   19   51-69    562-580 (610)
 34 PHA02754 hypothetical protein;  40.5      30 0.00065   17.7   1.8   17   53-69      9-25  (67)
 35 COG3821 Predicted membrane pro  38.9      16 0.00035   23.8   0.9   17    3-19      8-24  (234)
 36 PF11036 YqgB:  Virulence promo  36.5      14 0.00031   17.3   0.3   10   49-58     18-27  (43)
 37 PF02118 Srg:  Srg family chemo  35.6      80  0.0017   20.8   3.9   29   35-63    246-274 (275)
 38 PF04505 Dispanin:  Interferon-  35.3      24 0.00052   19.3   1.1   22    4-25     22-43  (82)
 39 PF03155 Alg6_Alg8:  ALG6, ALG8  32.6      29 0.00063   25.6   1.5   15    2-16    228-242 (469)
 40 PF10319 7TM_GPCR_Srj:  Serpent  31.3      78  0.0017   22.1   3.3   53    9-63    257-309 (310)
 41 PF10842 DUF2642:  Protein of u  31.2      28 0.00061   18.3   0.9   11   44-54      4-14  (66)
 42 PF05399 EVI2A:  Ectropic viral  29.9      20 0.00043   23.5   0.2   10    2-11    135-144 (227)
 43 PHA03169 hypothetical protein;  28.8      19 0.00041   25.7   0.0   59    9-71    326-389 (413)
 44 PF11014 DUF2852:  Protein of u  28.8      62  0.0013   19.1   2.1    8    3-10     14-21  (115)
 45 TIGR01096 3A0103s03R lysine-ar  26.3      39 0.00084   21.7   1.2   19    3-21      3-21  (250)
 46 KOG3827|consensus               25.3      16 0.00034   26.2  -0.9   20    2-21     67-86  (400)
 47 PF11587 Prion_bPrPp:  Major pr  24.4      46 0.00099   14.5   0.8   13   10-22      7-19  (29)
 48 KOG1735|consensus               24.3       8 0.00017   23.7  -2.1   12    7-18     87-98  (146)
 49 COG4818 Predicted membrane pro  24.2   1E+02  0.0022   17.6   2.4   12    5-16     47-58  (105)
 50 PF02295 z-alpha:  Adenosine de  24.1      51  0.0011   17.2   1.1   13   45-57     34-46  (66)
 51 PF04628 Sedlin_N:  Sedlin, N-t  24.1      44 0.00096   19.8   1.0   29   41-69    100-131 (132)
 52 PHA02132 hypothetical protein   23.7 1.2E+02  0.0026   16.2   2.5   20    6-25     55-74  (86)
 53 PF07746 LigA:  Aromatic-ring-o  23.0 1.1E+02  0.0024   17.0   2.4   20   48-67      1-20  (88)
 54 PF13153 DUF3985:  Protein of u  22.4   1E+02  0.0022   14.4   1.8   19    3-21      9-27  (44)
 55 PRK13378 protocatechuate 4,5-d  22.4 1.2E+02  0.0026   17.9   2.5   20   47-66     26-45  (117)
 56 PF11601 Shal-type:  Shal-type   22.2      44 0.00094   14.3   0.5   13   10-22      4-16  (28)
 57 PF04654 DUF599:  Protein of un  22.1      82  0.0018   20.6   2.0   24    3-26      2-25  (216)
 58 cd07925 LigA_like_1 The A subu  21.9 1.3E+02  0.0027   17.5   2.5   20   47-66     15-34  (106)
 59 PRK06099 F0F1 ATP synthase sub  21.3 1.1E+02  0.0024   18.3   2.3   19    6-24     43-61  (126)
 60 PRK06761 hypothetical protein;  21.3      15 0.00033   25.0  -1.5   32   38-70    172-203 (282)
 61 PF07325 Curto_V2:  Curtovirus   21.1      93   0.002   18.1   1.8   12   59-70     52-63  (126)
 62 TIGR02792 PCA_ligA protocatech  20.8 1.3E+02  0.0028   17.8   2.5   20   47-66     20-39  (117)
 63 PF00375 SDF:  Sodium:dicarboxy  20.6 3.3E+02  0.0071   19.4   5.3   66    4-70    175-248 (390)
 64 PF14752 RBP_receptor:  Retinol  20.4 1.6E+02  0.0035   22.8   3.5   19    3-21    170-188 (617)

No 1  
>PHA03234 DNA packaging protein UL33; Provisional
Probab=99.81  E-value=5.3e-20  Score=125.28  Aligned_cols=76  Identities=14%  Similarity=0.162  Sum_probs=58.7

Q ss_pred             chhhhhHhhchhhHHHHHHHHHhCC----CCc----cchhHHHHHHHHhhcccchhHHHHHHhcHHHHHHHHHHHHhhhh
Q psy11836          2 ALLVLINFACWAPVTFFALTAALGY----PLI----SVTKSKILLVFFYPINSCFNPYLYALLTKHYRRDLVLTLARIGI   73 (112)
Q Consensus         2 ~~iv~~F~icw~Py~i~~l~~~~~~----~~~----~~~~~~~~~~~l~~~ns~~NPiiY~~~~~~fR~~~~~~~~~~~~   73 (112)
                      ++++++|++||+||+++.++..+..    ...    .......++.+++++|||+||+||++.+++||+++++.+++..+
T Consensus       240 ~~vv~vF~iCWlPy~iv~l~~~~~~~~~~~~c~~~~~~~~~~~v~~~La~~nsclNPiIY~f~~~~FR~~~~~~~~~~~~  319 (338)
T PHA03234        240 RILILSFLCIQIPNIAILICEIAFLYIANNSCFGLAQREILQIIIRLMPEIHCFSNPLVYAFTGGDFRLRFTACFQDFFK  319 (338)
T ss_pred             HHHHHHHHHHHhHHHHHHHHHHHHHhcccCcchHHHHHHHHHHHHHHHHHhhhhhhHHHHHHhhHHHHHHHHHHHHHHhh
Confidence            5789999999999999987654311    111    12234567888999999999999999999999999999987655


Q ss_pred             hhhc
Q psy11836         74 CQER   77 (112)
Q Consensus        74 ~~~~   77 (112)
                      |...
T Consensus       320 ~~~~  323 (338)
T PHA03234        320 CNLC  323 (338)
T ss_pred             hhhc
Confidence            5533


No 2  
>KOG4219|consensus
Probab=99.79  E-value=7.3e-20  Score=124.19  Aligned_cols=77  Identities=17%  Similarity=0.440  Sum_probs=63.1

Q ss_pred             CchhhhhHhhchhhHHHHHHHHHhCCCCc---cchhHHHHHHHHhhcccchhHHHHHHhcHHHHHHHHHHHHhhhhhhhc
Q psy11836          1 MALLVLINFACWAPVTFFALTAALGYPLI---SVTKSKILLVFFYPINSCFNPYLYALLTKHYRRDLVLTLARIGICQER   77 (112)
Q Consensus         1 l~~iv~~F~icw~Py~i~~l~~~~~~~~~---~~~~~~~~~~~l~~~ns~~NPiiY~~~~~~fR~~~~~~~~~~~~~~~~   77 (112)
                      +++||+.|.+||+|||++.+......+..   -....+....||+++|+|+||+||+++|++||.++++.++++......
T Consensus       263 liiVV~~FaicWlPyh~y~il~~~~~~i~~~k~i~~vyl~~~WLaMSst~yNPiIY~~lN~Rfr~gf~~~fr~cp~v~~~  342 (423)
T KOG4219|consen  263 LIIVVVIFAICWLPYHIYFILNATNPEINRKKFIQQVYLAIYWLAMSSTCYNPIIYCFLNKRFRGGFRRAFRWCPFVKGT  342 (423)
T ss_pred             HHHHHHHHHHhccChhHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHhhhccHhhhhhHHHHHHHHhhhhheeeeeccc
Confidence            46789999999999999999876544322   235567788999999999999999999999999999999876533333


No 3  
>PHA03235 DNA packaging protein UL33; Provisional
Probab=99.79  E-value=5.9e-19  Score=122.71  Aligned_cols=70  Identities=14%  Similarity=0.163  Sum_probs=55.0

Q ss_pred             chhhhhHhhchhhHHHHHHHHHhCCC----Cc----cchhHHHHHHHHhhcccchhHHHHHHhcHHHHHHHHHHHHhh
Q psy11836          2 ALLVLINFACWAPVTFFALTAALGYP----LI----SVTKSKILLVFFYPINSCFNPYLYALLTKHYRRDLVLTLARI   71 (112)
Q Consensus         2 ~~iv~~F~icw~Py~i~~l~~~~~~~----~~----~~~~~~~~~~~l~~~ns~~NPiiY~~~~~~fR~~~~~~~~~~   71 (112)
                      ++++++|++||+||+++.++..+...    ..    .......+..+++++|||+||+||++++++||+++++.+++.
T Consensus       247 ~iivv~F~iCWlPy~v~~l~~~~~~~~~~~~~~~~~~~~~~~~i~~~La~~ns~lNPiIY~~~~~~FRk~~~~~l~~~  324 (409)
T PHA03235        247 CILLLSFLCLQTPFVAIMIFDSYATLIWPSDCEHINLRDAVSTLSRLVPNLHCLLNPILYAFLGNDFLKRFRQCFRGE  324 (409)
T ss_pred             HHHHHHHHHHHhHHHHHHHHHHHHHhcCCCCchhhhHHHHHHHHHHHHHHHHHhHhHHHHHHhhHHHHHHHHHHHhhh
Confidence            45677899999999999887654221    10    122345678889999999999999999999999999988754


No 4  
>PHA02834 chemokine receptor-like protein; Provisional
Probab=99.73  E-value=6.9e-18  Score=114.27  Aligned_cols=69  Identities=17%  Similarity=0.376  Sum_probs=54.1

Q ss_pred             chhhhhHhhchhhHHHHHHHHHhCCCCc---c------chhHHHHHHHHhhcccchhHHHHHHhcHHHHHHHHHHHHh
Q psy11836          2 ALLVLINFACWAPVTFFALTAALGYPLI---S------VTKSKILLVFFYPINSCFNPYLYALLTKHYRRDLVLTLAR   70 (112)
Q Consensus         2 ~~iv~~F~icw~Py~i~~l~~~~~~~~~---~------~~~~~~~~~~l~~~ns~~NPiiY~~~~~~fR~~~~~~~~~   70 (112)
                      ++++++|++||+||+++.++..+.....   .      ......+..+++++|||+||+||++++++||+++++++++
T Consensus       232 ~~vv~~F~icWlPy~i~~~l~~~~~~~~~~~~~~~~~~~~~~~~i~~~l~~~ns~iNPiIY~~~~~~fR~~~~~~~~~  309 (323)
T PHA02834        232 LTVVTFTVVFWVPFNIVLFINSLQSVGLIDIGCYHFKKIVYSIDIAELISFVHCCVNPIIYAFVGKNFKKVFKNMFCR  309 (323)
T ss_pred             hHHHHHHHHHHhhHHHHHHHHHHHHhcCCCccchHHHHHHHHHHHHHHHHHhhccccHHHHHHhcHHHHHHHHHHHHh
Confidence            5688999999999999988765532110   0      0112346778999999999999999999999999998864


No 5  
>PHA02638 CC chemokine receptor-like protein; Provisional
Probab=99.67  E-value=1.3e-16  Score=111.29  Aligned_cols=71  Identities=21%  Similarity=0.552  Sum_probs=56.2

Q ss_pred             CchhhhhHhhchhhHHHHHHHHHhCCC----------C---ccchhHHHHHHHHhhcccchhHHHHHHhcHHHHHHHHHH
Q psy11836          1 MALLVLINFACWAPVTFFALTAALGYP----------L---ISVTKSKILLVFFYPINSCFNPYLYALLTKHYRRDLVLT   67 (112)
Q Consensus         1 l~~iv~~F~icw~Py~i~~l~~~~~~~----------~---~~~~~~~~~~~~l~~~ns~~NPiiY~~~~~~fR~~~~~~   67 (112)
                      +++++++|++||+||+++.++..+...          .   ........+...++++|||+||+||++.+++||++++++
T Consensus       315 i~~ivi~f~lcW~Py~i~~ll~~~~~~~~~~~~~~~~~c~~~~l~~~~~vt~~la~~~sclNPiIY~f~~~~FR~~l~~~  394 (417)
T PHA02638        315 VSIIIICSLICWIPLNIVILFATMYSFKGFNSIISEHICGFIKLGYAMMLAEAISLTHCCINPLIYTLIGENFRMHLLMI  394 (417)
T ss_pred             HHHHHHHHHHHHhhHHHHHHHHHHHHhhccccccccccccHHHHHHHHHHHHHHHHHHHhhhHHHHHHhCHHHHHHHHHH
Confidence            357899999999999999888765311          0   012334556778999999999999999999999999998


Q ss_pred             HHhh
Q psy11836         68 LARI   71 (112)
Q Consensus        68 ~~~~   71 (112)
                      +++.
T Consensus       395 ~~~~  398 (417)
T PHA02638        395 FRNI  398 (417)
T ss_pred             HHHh
Confidence            8653


No 6  
>KOG4220|consensus
Probab=99.66  E-value=2.7e-17  Score=112.30  Aligned_cols=68  Identities=21%  Similarity=0.294  Sum_probs=61.4

Q ss_pred             chhhhhHhhchhhHHHHHHHHHhCCCCccchhHHHHHHHHhhcccchhHHHHHHhcHHHHHHHHHHHHh
Q psy11836          2 ALLVLINFACWAPVTFFALTAALGYPLISVTKSKILLVFFYPINSCFNPYLYALLTKHYRRDLVLTLAR   70 (112)
Q Consensus         2 ~~iv~~F~icw~Py~i~~l~~~~~~~~~~~~~~~~~~~~l~~~ns~~NPiiY~~~~~~fR~~~~~~~~~   70 (112)
                      ..|+++|++||+||.|+.++..|-..- -+..++.+.++|.|+||-+||++|++.|+.||+.+++++.|
T Consensus       420 sAILlAFIiTWtPYNImVlv~tFC~~C-iP~tlW~~gYwLCYINSTiNP~CYALCNatFrkTfk~lL~C  487 (503)
T KOG4220|consen  420 SAILLAFILTWTPYNIMVLVNTFCKNC-IPETLWTFGYWLCYINSTINPLCYALCNATFRKTFKRLLLC  487 (503)
T ss_pred             HHHHHHHHHHcccceeeeehHhhcccc-cchhHhhhhhheeeecccccHHHHHHHhHHHHHHHHHhhee
Confidence            568999999999999999998775544 45788899999999999999999999999999999999964


No 7  
>PHA03087 G protein-coupled chemokine receptor-like protein; Provisional
Probab=99.54  E-value=9.7e-15  Score=99.13  Aligned_cols=69  Identities=14%  Similarity=0.319  Sum_probs=53.9

Q ss_pred             chhhhhHhhchhhHHHHHHHHHhCC----CCc----cchhHHHHHHHHhhcccchhHHHHHHhcHHHHHHHHHHHHh
Q psy11836          2 ALLVLINFACWAPVTFFALTAALGY----PLI----SVTKSKILLVFFYPINSCFNPYLYALLTKHYRRDLVLTLAR   70 (112)
Q Consensus         2 ~~iv~~F~icw~Py~i~~l~~~~~~----~~~----~~~~~~~~~~~l~~~ns~~NPiiY~~~~~~fR~~~~~~~~~   70 (112)
                      ++++++|++||+||++..++.....    ...    ..+....+..+++.+||++||+||++++++||+++++.++.
T Consensus       247 ~~iv~~f~i~w~P~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~l~~~ns~~NPiIY~~~~~~fr~~~~~~~~~  323 (335)
T PHA03087        247 LIIVILFVIFWLPFNVSVFVYSLHILHFKSGCKAVKYIQYALHVTEIISLSHCCINPLIYAFVSEFFNKHKKKSLKL  323 (335)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhccCCCCcHHHHHHHHHHHHHHHHHHHHhhhhhHHHHcCHHHHHHHHHHHHH
Confidence            5788999999999999887654321    110    12334456778899999999999999999999999999964


No 8  
>KOG2087|consensus
Probab=99.12  E-value=4.2e-12  Score=85.79  Aligned_cols=81  Identities=51%  Similarity=1.062  Sum_probs=66.0

Q ss_pred             chhhhhHhhchhhHHHHHHHHHhCCCCccchhHHHHHHHHhhcccchhHHHHHHhcHHHHHHHHHHHHhhhhhhhccccc
Q psy11836          2 ALLVLINFACWAPVTFFALTAALGYPLISVTKSKILLVFFYPINSCFNPYLYALLTKHYRRDLVLTLARIGICQERAHKY   81 (112)
Q Consensus         2 ~~iv~~F~icw~Py~i~~l~~~~~~~~~~~~~~~~~~~~l~~~ns~~NPiiY~~~~~~fR~~~~~~~~~~~~~~~~~~~~   81 (112)
                      ..++..=++||.|.+.+.+...++.+.........+..++.-+|||+||++|++.++.||+.++.++.+...++.+.+..
T Consensus       238 a~LvfTd~icw~Pi~f~~~~al~~~~li~~~~sk~llv~flPlns~~NP~LYa~fT~~fk~d~~~l~~k~~~~k~~~~~~  317 (363)
T KOG2087|consen  238 AFLVFTDCICWCPIAFFKFSALIGVELISVSYSKWLLVFFLPLNSCLNPFLYAFFTPVFKEDLFLLLSKVGLCKNRASKY  317 (363)
T ss_pred             eEEEEccccccCchheeeeHHhcCCcccChhhceeEEEEEEEcccccCchhHHHcCHHHHHHHHHHHhhcchhhhHHHHh
Confidence            34556667999999999999999988877777766777777799999999999999999999999998766555554444


Q ss_pred             c
Q psy11836         82 R   82 (112)
Q Consensus        82 ~   82 (112)
                      +
T Consensus       318 ~  318 (363)
T KOG2087|consen  318 K  318 (363)
T ss_pred             c
Confidence            3


No 9  
>PF00001 7tm_1:  7 transmembrane receptor (rhodopsin family) Rhodopsin-like GPCR superfamily signature 5-hydroxytryptamine 7 receptor signature bradykinin receptor signature gastrin receptor signature melatonin receptor signature olfactory receptor signature;  InterPro: IPR000276 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The rhodopsin-like GPCRs themselves represent a widespread protein family that includes hormone, neurotransmitter and light receptors, all of which transduce extracellular signals through interaction with guanine nucleotide-binding (G) proteins. Although their activating ligands vary widely in structure and character, the amino acid sequences of the receptors are very similar and are believed to adopt a common structural framework comprising 7 transmembrane (TM) helices [, , ].; GO: 0007186 G-protein coupled receptor protein signaling pathway, 0016021 integral to membrane; PDB: 2KI9_A 3QAK_A 2YDV_A 3VGA_A 3PWH_A 3RFM_A 3EML_A 3VG9_A 3REY_A 3UZA_A ....
Probab=98.97  E-value=9.5e-10  Score=70.82  Aligned_cols=52  Identities=25%  Similarity=0.526  Sum_probs=44.2

Q ss_pred             chhhhhHhhchhhHHHHHHHHHhCCCCc-cchhHHHHHHHHhhcccchhHHHH
Q psy11836          2 ALLVLINFACWAPVTFFALTAALGYPLI-SVTKSKILLVFFYPINSCFNPYLY   53 (112)
Q Consensus         2 ~~iv~~F~icw~Py~i~~l~~~~~~~~~-~~~~~~~~~~~l~~~ns~~NPiiY   53 (112)
                      ++++++|++||+|+.+..++........ .......+..+++++||++||+||
T Consensus       205 ~~i~~~f~~~~~P~~i~~~~~~~~~~~~~~~~~~~~~~~~l~~~~s~~nP~iY  257 (257)
T PF00001_consen  205 LIIVLVFLLCWLPYFILSLLSVFSPSSSLISSILFYISYFLAFLNSCLNPIIY  257 (257)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHSSTSTCSHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ccccccccccCCceeHHHHHHHHcCccchhhHHHHHHHHHHHHHHHhhCcEEC
Confidence            4678899999999999999988866552 356667888899999999999999


No 10 
>PF10324 7TM_GPCR_Srw:  Serpentine type 7TM GPCR chemoreceptor Srw;  InterPro: IPR019427 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The nematode Caenorhabditis elegans has only 14 types of chemosensory neuron, yet is able to sense and respond to several hundred different chemicals because each neuron detects several stimuli []. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. Chemoreception in C. elegans is mediated by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs). More than 1300 potential chemoreceptor genes have been identified in C. elegans, which are generally prefixed sr for serpentine receptor. The receptor superfamilies include Sra (Sra, Srb, Srab, Sre), Str (Srh, Str, Sri, Srd, Srj, Srm, Srn) and Srg (Srx, Srt, Srg, Sru, Srv, Srxa), as well as the families Srw, Srz, Srbc, Srsx and Srr [, , ]. Many of these proteins have homologues in Caenorhabditis briggsae. This entry represents serpentine receptor class w (Srw), which is a solo family amongst the superfamilies of chemoreceptors. The genes encoding Srw do not appear to be under as strong an adaptive evolutionary pressure as those of Srz []. 
Probab=98.35  E-value=9.3e-07  Score=59.87  Aligned_cols=69  Identities=12%  Similarity=0.204  Sum_probs=55.2

Q ss_pred             chhhhhHhhchhhHHHHHHHHHhCCCC----ccchhHHHHHHHHhhcccchhHHHHHHhcHHHHHHHHHHHHh
Q psy11836          2 ALLVLINFACWAPVTFFALTAALGYPL----ISVTKSKILLVFFYPINSCFNPYLYALLTKHYRRDLVLTLAR   70 (112)
Q Consensus         2 ~~iv~~F~icw~Py~i~~l~~~~~~~~----~~~~~~~~~~~~l~~~ns~~NPiiY~~~~~~fR~~~~~~~~~   70 (112)
                      +++++.|+++=+|+-+..++.......    ........+...+..+|++.|++||.+++.+||+++++++++
T Consensus       245 ~~~ti~f~i~e~p~gi~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~ns~~h~~ic~~mSsqYR~t~~~~f~~  317 (318)
T PF10324_consen  245 LFMTISFLISELPQGIIFLLESFFEEDSGLIFIIIQLSIIFNILITINSSIHFFICCFMSSQYRKTVKKLFGC  317 (318)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhhhcchhHHHHHHHHHHHHHHHHHhhhHHHhhhhhhHHHHHHHHHHhcc
Confidence            467789999999999999997752221    112344556777888999999999999999999999999964


No 11 
>PF10320 7TM_GPCR_Srsx:  Serpentine type 7TM GPCR chemoreceptor Srsx;  InterPro: IPR019424 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The nematode Caenorhabditis elegans has only 14 types of chemosensory neuron, yet is able to sense and respond to several hundred different chemicals because each neuron detects several stimuli []. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. Chemoreception in C. elegans is mediated by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs). More than 1300 potential chemoreceptor genes have been identified in C. elegans, which are generally prefixed sr for serpentine receptor. The receptor superfamilies include Sra (Sra, Srb, Srab, Sre), Str (Srh, Str, Sri, Srd, Srj, Srm, Srn) and Srg (Srx, Srt, Srg, Sru, Srv, Srxa), as well as the families Srw, Srz, Srbc, Srsx and Srr [, , ]. Many of these proteins have homologues in Caenorhabditis briggsae. This entry represents serpentine receptor class sx (Srsx), which is a solo family amongst the superfamilies of chemoreceptors. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. 
Probab=97.45  E-value=5.4e-05  Score=50.13  Aligned_cols=67  Identities=15%  Similarity=0.222  Sum_probs=48.8

Q ss_pred             chhhhhHhhchhhHHHHHHHHHh-CCCCccchhHHHHHHHHhhcccchhHHHHHHhcHHHHHHHHHHH
Q psy11836          2 ALLVLINFACWAPVTFFALTAAL-GYPLISVTKSKILLVFFYPINSCFNPYLYALLTKHYRRDLVLTL   68 (112)
Q Consensus         2 ~~iv~~F~icw~Py~i~~l~~~~-~~~~~~~~~~~~~~~~l~~~ns~~NPiiY~~~~~~fR~~~~~~~   68 (112)
                      .+++++|+..|.=-.+...+... +.+.........-..++...|.+.|-++|.+.|+|||+++++++
T Consensus       190 ~v~v~i~i~~w~~s~~~~~v~~~~~~~~~~~~~i~~~~~i~v~~~~s~~ffV~~~~S~EYR~af~~~~  257 (257)
T PF10320_consen  190 KVTVIIFIFSWFLSQIINTVSLALGLDGETIAIIQMYAGIFVNISYSQNFFVYYWRSSEYRKAFRELF  257 (257)
T ss_pred             hhheeeeeHHHHHHHHHHHHHHHhCCcHHHHHHHHHHHHHHHHHHHHHHheEEEEcCHHHHHHHHHhC
Confidence            46788889999877777665443 32221122234445678899999999999999999999999863


No 12 
>PF05462 Dicty_CAR:  Slime mold cyclic AMP receptor
Probab=97.06  E-value=0.0045  Score=42.19  Aligned_cols=63  Identities=24%  Similarity=0.283  Sum_probs=47.7

Q ss_pred             hhhHhhchhhHHHHHHHHHhCCCCccchhHHHHHHHHhhcccchhHHHHHHhcHHHHHHHHHHHHh
Q psy11836          5 VLINFACWAPVTFFALTAALGYPLISVTKSKILLVFFYPINSCFNPYLYALLTKHYRRDLVLTLAR   70 (112)
Q Consensus         5 v~~F~icw~Py~i~~l~~~~~~~~~~~~~~~~~~~~l~~~ns~~NPiiY~~~~~~fR~~~~~~~~~   70 (112)
                      .++|++||.|-.+-.+....+..   +.....+-..++-+.=.+|.++|++-++-.++.+...+.+
T Consensus       208 p~ifiicw~fa~INRI~~~~~~~---~~~l~~Lh~~~s~lqGf~nsivy~~n~~~~~~~~~~~~~~  270 (303)
T PF05462_consen  208 PLIFIICWIFATINRIYNFIGKN---PFWLSVLHVGFSPLQGFFNSIVYGYNNSLMWRYLGSKILC  270 (303)
T ss_pred             HHHHHHHHHHHHHHHHHHHhcCC---chHHHHHHHHHHHHHHHHHHHHHHhCCHHHHHHHHHHHHH
Confidence            47899999999999998877532   2344444445666677899999999999999988776643


No 13 
>PF11970 Git3_C:  G protein-coupled glucose receptor regulating Gpa2 C-term;  InterPro: IPR022596 This entry contains a functionally uncharacterised region belonging to the Git3 G-protein coupled receptor. Git3 is one of six proteins required for glucose-triggered adenylate cyclase activation, and is a G protein-coupled receptor responsible for the activation of adenylate cyclase through Gpa2 - heterotrimeric G protein alpha subunit, part of the glucose-detection pathway. Git3 contains seven predicted transmembrane domains, a third cytoplasmic loop and a cytoplasmic tail []. This family is the conserved C-terminal domain of the member proteins. 
Probab=97.04  E-value=0.001  Score=36.12  Aligned_cols=53  Identities=11%  Similarity=0.150  Sum_probs=39.6

Q ss_pred             hhHhhchh-hHHHHHHHHHhCCCCccchhHHHHHHHHhhcccchhHHHHHHhcH
Q psy11836          6 LINFACWA-PVTFFALTAALGYPLISVTKSKILLVFFYPINSCFNPYLYALLTK   58 (112)
Q Consensus         6 ~~F~icw~-Py~i~~l~~~~~~~~~~~~~~~~~~~~l~~~ns~~NPiiY~~~~~   58 (112)
                      ++|+++|+ |+.+-.+....+....+..+...++.++..+|..+|-++|++.-+
T Consensus        19 ~~Yi~lwlfP~~~~~~~~~~~~~~~p~~~l~~i~~~~~~~~G~VD~lvf~~~er   72 (76)
T PF11970_consen   19 LVYIVLWLFPFAAHRMQYMYEIGHGPSFWLFCIAGFMQPSQGFVDCLVFTLRER   72 (76)
T ss_pred             HHHHHHHHHHHHHHHHHHHhccCCCCchHHHHHHHHHHHccCHHHhhheeeecc
Confidence            57999999 988887776644333344566667777777999999999987654


No 14 
>PF10323 7TM_GPCR_Srv:  Serpentine type 7TM GPCR chemoreceptor Srv;  InterPro: IPR019426 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The nematode Caenorhabditis elegans has only 14 types of chemosensory neuron, yet is able to sense and respond to several hundred different chemicals because each neuron detects several stimuli []. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. Chemoreception in C. elegans is mediated by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs). More than 1300 potential chemoreceptor genes have been identified in C. elegans, which are generally prefixed sr for serpentine receptor. The receptor superfamilies include Sra (Sra, Srb, Srab, Sre), Str (Srh, Str, Sri, Srd, Srj, Srm, Srn) and Srg (Srx, Srt, Srg, Sru, Srv, Srxa), as well as the families Srw, Srz, Srbc, Srsx and Srr [, , ]. Many of these proteins have homologues in Caenorhabditis briggsae.  This entry represents serpentine receptor class v (Srv) from the Srg superfamily [, ]. Srg receptors contain seven hydrophobic, putative transmembrane, regions and can be distinguished from other 7TM GPCR receptors by their own characteristic TM signatures. 
Probab=96.49  E-value=0.011  Score=39.72  Aligned_cols=37  Identities=16%  Similarity=0.316  Sum_probs=30.7

Q ss_pred             HHHHHHHHhhcccchhHHHHHHhcHHHHHHHHHHHHh
Q psy11836         34 SKILLVFFYPINSCFNPYLYALLTKHYRRDLVLTLAR   70 (112)
Q Consensus        34 ~~~~~~~l~~~ns~~NPiiY~~~~~~fR~~~~~~~~~   70 (112)
                      .+.+-.++.-..|.+||+.--+.|+++|+++++.++|
T Consensus       247 ~r~~y~~~~~~~s~inP~~LLi~n~~lr~~~~~~~~~  283 (283)
T PF10323_consen  247 LRAFYPILNGLLSFINPWMLLIFNKDLRKQVRRMLKC  283 (283)
T ss_pred             HHHHHHHHHHHHHhhhhHHhhhccHHHHHHHHHHcCC
Confidence            3335556777889999999999999999999998863


No 15 
>PF05296 TAS2R:  Mammalian taste receptor protein (TAS2R);  InterPro: IPR007960 This family consists of several forms of mammalian taste receptor proteins (TAS2Rs). TAS2Rs are G protein-coupled receptors expressed in subsets of taste receptor cells of the tongue and palate epithelia and are organised in the genome in clusters. The proteins are genetically linked to loci that influence bitter perception in mice and humans [].; GO: 0004930 G-protein coupled receptor activity, 0007186 G-protein coupled receptor protein signaling pathway, 0050909 sensory perception of taste, 0016021 integral to membrane
Probab=96.32  E-value=0.016  Score=39.44  Aligned_cols=67  Identities=7%  Similarity=-0.024  Sum_probs=50.0

Q ss_pred             hhhhHhhchhhHHHHHHHHHhCCCCccchhHHHHHHHHhhcccchhHHHHHHhcHHHHHHHHHHHHh
Q psy11836          4 LVLINFACWAPVTFFALTAALGYPLISVTKSKILLVFFYPINSCFNPYLYALLTKHYRRDLVLTLAR   70 (112)
Q Consensus         4 iv~~F~icw~Py~i~~l~~~~~~~~~~~~~~~~~~~~l~~~ns~~NPiiY~~~~~~fR~~~~~~~~~   70 (112)
                      +++.|++-+..|.+..++...............+...+.++.++..|+|-.+.|+++|+++++.+.+
T Consensus       235 ~~~sfl~ly~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~yps~hs~iLIlgn~KLr~~~~~il~~  301 (303)
T PF05296_consen  235 TMISFLILYIIYFLSLILSFLSFFFPENSIWFWVCEIIIALYPSGHSIILILGNPKLRQALLKILWC  301 (303)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhccccHHHHHHHHHHHHHHHHHHHHHhcCchHHHHHHHHHHhh
Confidence            4567778888888776664332221122445567777888999999999999999999999999864


No 16 
>PF10321 7TM_GPCR_Srt:  Serpentine type 7TM GPCR chemoreceptor Srt;  InterPro: IPR019425  Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type []. Srt is a member of the Srg superfamily of chemoreceptors. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. 
Probab=95.42  E-value=0.02  Score=39.28  Aligned_cols=39  Identities=15%  Similarity=0.220  Sum_probs=32.9

Q ss_pred             chhHHHHHHHHhhcccchhHHHHHHhcHHHHHHHHHHHH
Q psy11836         31 VTKSKILLVFFYPINSCFNPYLYALLTKHYRRDLVLTLA   69 (112)
Q Consensus        31 ~~~~~~~~~~l~~~ns~~NPiiY~~~~~~fR~~~~~~~~   69 (112)
                      +++...+..+.=-.++..+|+||-.+|+..|+++++.++
T Consensus       268 p~~~i~~~~~~Wql~~g~~~iIYl~lNrtIR~~~~k~~~  306 (313)
T PF10321_consen  268 PPWLIIIGQISWQLSHGCPPIIYLTLNRTIRNSVLKMLG  306 (313)
T ss_pred             cHHHHHHHHHHHhccCCccceEEEEECHHHHHHHHHHHc
Confidence            355556666666789999999999999999999999995


No 17 
>PF02101 Ocular_alb:  Ocular albinism type 1 protein;  InterPro: IPR001414 Ocular albinism type 1 (OA1) is an X-linked disorder characterised by severe impairment of visual acuity, retinal hypopigmentation and the presence of macromelanosomes. A novel transcript from the OA1 critical region is expressed in high levels in RNA samples from retina and from melanoma and encodes a potential integral membrane protein []. This protein is of unknown function but is known to bind heterotrimeric G proteins.; GO: 0016020 membrane
Probab=93.86  E-value=0.1  Score=36.64  Aligned_cols=20  Identities=20%  Similarity=0.544  Sum_probs=16.4

Q ss_pred             chhhhhHhhchhhHHHHHHH
Q psy11836          2 ALLVLINFACWAPVTFFALT   21 (112)
Q Consensus         2 ~~iv~~F~icw~Py~i~~l~   21 (112)
                      +.|+++|.+||+|..+=-++
T Consensus       247 f~I~lVF~iCWlpNIINg~L  266 (405)
T PF02101_consen  247 FKIMLVFYICWLPNIINGSL  266 (405)
T ss_pred             HHHHHHHHHHhhhhhHhHHH
Confidence            45899999999999886554


No 18 
>PF10317 7TM_GPCR_Srd:  Serpentine type 7TM GPCR chemoreceptor Srd;  InterPro: IPR019421 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The nematode Caenorhabditis elegans has only 14 types of chemosensory neuron, yet is able to sense and respond to several hundred different chemicals because each neuron detects several stimuli []. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. Chemoreception in C. elegans is mediated by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs). More than 1300 potential chemoreceptor genes have been identified in C. elegans, which are generally prefixed sr for serpentine receptor. The receptor superfamilies include Sra (Sra, Srb, Srab, Sre), Str (Srh, Str, Sri, Srd, Srj, Srm, Srn) and Srg (Srx, Srt, Srg, Sru, Srv, Srxa), as well as the families Srw, Srz, Srbc, Srsx and Srr [, , ]. Many of these proteins have homologues in Caenorhabditis briggsae. This entry represents the chemoreceptor Srd []. 
Probab=90.64  E-value=0.45  Score=32.15  Aligned_cols=55  Identities=9%  Similarity=0.190  Sum_probs=38.3

Q ss_pred             hchhhHHHHHHHHHhCCCCccchhHHHHHHHHhhcccchhHHHHHHhcHHHHHHHHH
Q psy11836         10 ACWAPVTFFALTAALGYPLISVTKSKILLVFFYPINSCFNPYLYALLTKHYRRDLVL   66 (112)
Q Consensus        10 icw~Py~i~~l~~~~~~~~~~~~~~~~~~~~l~~~ns~~NPiiY~~~~~~fR~~~~~   66 (112)
                      ++..|-.+..++..++...  ......+...++.+-+.+||+++.+.=+.||++++|
T Consensus       238 ~~~~p~~~~~~~~~~~~~~--~~~~e~~~~~~~~~~~~~~P~itl~fv~PYR~~i~r  292 (292)
T PF10317_consen  238 FFYIPGVIIYFLSQFTGYE--HPFLEYLIFMLASLPPLIDPLITLYFVRPYRKAILR  292 (292)
T ss_pred             HHHHHHHHHHHHHHHhccc--cHHHHHHHHHHHHHHHHhchHhheeeeHhHHHHhcC
Confidence            3444444444544444432  355566666677788999999999999999999864


No 19 
>PF10318 7TM_GPCR_Srh:  Serpentine type 7TM GPCR chemoreceptor Srh;  InterPro: IPR019422 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The nematode Caenorhabditis elegans has only 14 types of chemosensory neuron, yet is able to sense and respond to several hundred different chemicals because each neuron detects several stimuli []. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. Chemoreception in C. elegans is mediated by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs). More than 1300 potential chemoreceptor genes have been identified in C. elegans, which are generally prefixed sr for serpentine receptor. The receptor superfamilies include Sra (Sra, Srb, Srab, Sre), Str (Srh, Str, Sri, Srd, Srj, Srm, Srn) and Srg (Srx, Srt, Srg, Sru, Srv, Srxa), as well as the families Srw, Srz, Srbc, Srsx and Srr [, , ]. Many of these proteins have homologues in Caenorhabditis briggsae.  Srh is part of the Str superfamily of chemoreceptors []. 
Probab=89.74  E-value=1.4  Score=29.71  Aligned_cols=60  Identities=15%  Similarity=0.279  Sum_probs=44.5

Q ss_pred             HhhchhhHHHHHHHHHhCCCCccchhHHHHHHHHhhcccchhHHHHHHhcHHHHHHHHHHHHh
Q psy11836          8 NFACWAPVTFFALTAALGYPLISVTKSKILLVFFYPINSCFNPYLYALLTKHYRRDLVLTLAR   70 (112)
Q Consensus         8 F~icw~Py~i~~l~~~~~~~~~~~~~~~~~~~~l~~~ns~~NPiiY~~~~~~fR~~~~~~~~~   70 (112)
                      +++.-.|..++.+....+...   +....+..++...+..+.-++..+.++.+|+.++++++|
T Consensus       243 ~~~l~~P~~~~~~~~~~~~~~---q~~~n~~~~~~~~HG~~sti~mi~~~~pYR~~~~~~~~~  302 (302)
T PF10318_consen  243 FIFLFIPLIYFIISIIFGYYN---QALNNISFIIISLHGIASTIVMILVHKPYRKFLLSLFRC  302 (302)
T ss_pred             HHHHhhhHHHHHHHHhccccc---cccchHHHHHHHhccHHHHHHHhhccHHHHHHHHHHhcC
Confidence            345566888887766655433   334445556666899999999999999999999999864


No 20 
>KOG4564|consensus
Probab=87.74  E-value=0.95  Score=32.95  Aligned_cols=31  Identities=19%  Similarity=0.297  Sum_probs=24.5

Q ss_pred             HhhcccchhHHHHHHhcHHHHHHHHHHHHhh
Q psy11836         41 FYPINSCFNPYLYALLTKHYRRDLVLTLARI   71 (112)
Q Consensus        41 l~~~ns~~NPiiY~~~~~~fR~~~~~~~~~~   71 (112)
                      |..+.-.+=-++|+|.|.++|.++||.+.+.
T Consensus       390 L~SfQGf~VAvlYCFlN~EVq~elrr~W~r~  420 (473)
T KOG4564|consen  390 LGSFQGFFVAVLYCFLNGEVQAELRRKWSRW  420 (473)
T ss_pred             HHhccchheehheeecCHHHHHHHHHHHHhc
Confidence            4444445567899999999999999999764


No 21 
>PF10328 7TM_GPCR_Srx:  Serpentine type 7TM GPCR chemoreceptor Srx;  InterPro: IPR019430 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The nematode Caenorhabditis elegans has only 14 types of chemosensory neuron, yet is able to sense and respond to several hundred different chemicals because each neuron detects several stimuli []. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. Chemoreception in C. elegans is mediated by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs). More than 1300 potential chemoreceptor genes have been identified in C. elegans, which are generally prefixed sr for serpentine receptor. The receptor superfamilies include Sra (Sra, Srb, Srab, Sre), Str (Srh, Str, Sri, Srd, Srj, Srm, Srn) and Srg (Srx, Srt, Srg, Sru, Srv, Srxa), as well as the families Srw, Srz, Srbc, Srsx and Srr [, , ]. Many of these proteins have homologues in Caenorhabditis briggsae. This entry represents serpentine receptor class x (Srx) from the Srg superfamily [, ]. Srg receptors contain seven hydrophobic, putative transmembrane, regions and can be distinguished from other 7TM GPCR receptors by their own characteristic TM signatures. 
Probab=80.81  E-value=1  Score=30.00  Aligned_cols=24  Identities=8%  Similarity=0.261  Sum_probs=20.1

Q ss_pred             cccchhHHHHHHhcHHHHHHHHHH
Q psy11836         44 INSCFNPYLYALLTKHYRRDLVLT   67 (112)
Q Consensus        44 ~ns~~NPiiY~~~~~~fR~~~~~~   67 (112)
                      +.=++|++|+...|+|+|+.+++.
T Consensus       249 ~~h~~DG~i~l~fN~~~r~~~~~~  272 (274)
T PF10328_consen  249 LVHALDGLIMLIFNSEIRRKIRKK  272 (274)
T ss_pred             HHHHhcceeEeEEcHHHHHHHHhc
Confidence            334579999999999999998764


No 22 
>PF10326 7TM_GPCR_Str:  Serpentine type 7TM GPCR chemoreceptor Str;  InterPro: IPR019428 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The nematode Caenorhabditis elegans has only 14 types of chemosensory neuron, yet is able to sense and respond to several hundred different chemicals because each neuron detects several stimuli []. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. Chemoreception in C. elegans is mediated by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs). More than 1300 potential chemoreceptor genes have been identified in C. elegans, which are generally prefixed sr for serpentine receptor. The receptor superfamilies include Sra (Sra, Srb, Srab, Sre), Str (Srh, Str, Sri, Srd, Srj, Srm, Srn) and Srg (Srx, Srt, Srg, Sru, Srv, Srxa), as well as the families Srw, Srz, Srbc, Srsx and Srr [, , ]. Many of these proteins have homologues in Caenorhabditis briggsae. This entry represents serpentine receptor class r (Str) from the Str superfamily [, ]. Almost a quarter (22.5%) of str and srj family genes and pseudogenes in C. elegans appear to have been newly formed by gene duplications since the species split []. 
Probab=77.25  E-value=0.26  Score=33.37  Aligned_cols=55  Identities=15%  Similarity=0.283  Sum_probs=37.3

Q ss_pred             HhhchhhHHHHHHHHHhCCCCccchhHHHHHHHHhhcccchhHHHHHHhcHHHHHHHH
Q psy11836          8 NFACWAPVTFFALTAALGYPLISVTKSKILLVFFYPINSCFNPYLYALLTKHYRRDLV   65 (112)
Q Consensus         8 F~icw~Py~i~~l~~~~~~~~~~~~~~~~~~~~l~~~ns~~NPiiY~~~~~~fR~~~~   65 (112)
                      ++..+.|..++.+.-.++-+.   .....+...+..+..++||++-.+.-+|||++++
T Consensus       253 ~i~~~~P~~~~~~~p~~~i~~---~~~~~~~~~~~~~yP~iDpl~~i~~ik~yR~~i~  307 (307)
T PF10326_consen  253 FIFMYIPVFIVFILPFFGIDL---GFFSNIISILISLYPAIDPLPVIFIIKDYRKAIK  307 (307)
T ss_pred             heeeecchhheeeeeccCCCC---CccccHhhhhEEEEeehhhheeeEeeHHHHHhhC
Confidence            345677877776665554332   2222233344448999999999999999999874


No 23 
>PF10327 7TM_GPCR_Sri:  Serpentine type 7TM GPCR chemoreceptor Sri;  InterPro: IPR019429 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The nematode Caenorhabditis elegans has only 14 types of chemosensory neuron, yet is able to sense and respond to several hundred different chemicals because each neuron detects several stimuli []. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. Chemoreception in C. elegans is mediated by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs). More than 1300 potential chemoreceptor genes have been identified in C. elegans, which are generally prefixed sr for serpentine receptor. The receptor superfamilies include Sra (Sra, Srb, Srab, Sre), Str (Srh, Str, Sri, Srd, Srj, Srm, Srn) and Srg (Srx, Srt, Srg, Sru, Srv, Srxa), as well as the families Srw, Srz, Srbc, Srsx and Srr [, , ]. Many of these proteins have homologues in Caenorhabditis briggsae. This entry represents Sri, which is part of the Str superfamily of chemoreceptors.
Probab=75.33  E-value=3  Score=28.49  Aligned_cols=55  Identities=15%  Similarity=0.224  Sum_probs=38.7

Q ss_pred             hHhhchhhHHHHHHHHHhCCCCccchhHHHHHHHHhhcccchhHHHHHHhcHHHHHH
Q psy11836          7 INFACWAPVTFFALTAALGYPLISVTKSKILLVFFYPINSCFNPYLYALLTKHYRRD   63 (112)
Q Consensus         7 ~F~icw~Py~i~~l~~~~~~~~~~~~~~~~~~~~l~~~ns~~NPiiY~~~~~~fR~~   63 (112)
                      +-.+|-+|-.++.+....+.+..  +.......+...++|.+|-++-.+.++.||+-
T Consensus       248 ~~~i~~~P~~~~~~~~~~~~~~~--q~i~~~~~~~f~~HS~~n~ivli~t~ppYR~f  302 (303)
T PF10327_consen  248 TSSICILPPFIFVVVVIFEFEDA--QVISEICLAIFSSHSSVNMIVLIITTPPYRKF  302 (303)
T ss_pred             HHHHHHHHHHHhhhhheecCCCc--HHHHHHHHHHHHHhhHhhheeeeEcCcchhhc
Confidence            34566689888877766654432  33334444455589999999999999999984


No 24 
>KOG2575|consensus
Probab=67.23  E-value=3.2  Score=29.91  Aligned_cols=17  Identities=18%  Similarity=0.227  Sum_probs=14.3

Q ss_pred             chhhhhHhhchhhHHHH
Q psy11836          2 ALLVLINFACWAPVTFF   18 (112)
Q Consensus         2 ~~iv~~F~icw~Py~i~   18 (112)
                      +++++.|+++|.|+...
T Consensus       262 ~~Vv~TF~iiw~P~~~~  278 (510)
T KOG2575|consen  262 LAVVGTFVIIWLPFLLS  278 (510)
T ss_pred             HHHHHHHHHHHHHHHhc
Confidence            36889999999999765


No 25 
>PF03125 Sre:  C. elegans Sre G protein-coupled chemoreceptor;  InterPro: IPR004151 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The nematode Caenorhabditis elegans has only 14 types of chemosensory neuron, yet is able to sense and respond to several hundred different chemicals because each neuron detects several stimuli []. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. Chemoreception in C. elegans is mediated by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs). More than 1300 potential chemoreceptor genes have been identified in C. elegans, which are generally prefixed sr for serpentine receptor. The receptor superfamilies include Sra (Sra, Srb, Srab, Sre), Str (Srh, Str, Sri, Srd, Srj, Srm, Srn) and Srg (Srx, Srt, Srg, Sru, Srv, Srxa), as well as the families Srw, Srz, Srbc, Srsx and Srr [, , ]. Many of these proteins have homologues in Caenorhabditis briggsae. This entry represents serpentine receptor class e (Sre) from the Sra superfamily []. ; GO: 0004888 transmembrane signaling receptor activity, 0007606 sensory perception of chemical stimulus, 0016021 integral to membrane
Probab=66.83  E-value=42  Score=23.60  Aligned_cols=39  Identities=10%  Similarity=0.130  Sum_probs=28.6

Q ss_pred             hHHHHHHHHhhcccchhHHHHHHhcHHHHHHHHHHHHhh
Q psy11836         33 KSKILLVFFYPINSCFNPYLYALLTKHYRRDLVLTLARI   71 (112)
Q Consensus        33 ~~~~~~~~l~~~ns~~NPiiY~~~~~~fR~~~~~~~~~~   71 (112)
                      ....+......+++.+=|.+-.+..+..|+++++.++..
T Consensus       284 ~~~~~~e~~i~l~~~~i~~~~i~s~~~wrk~f~~~~~~~  322 (365)
T PF03125_consen  284 ILNHIFENCIFLNPIFICPVIIFSVPSWRKEFKRSFPKI  322 (365)
T ss_pred             HHHHHHHHHHHHhhHHHHHHHHHcCHHHHHHHHHhhhhh
Confidence            334444455667777777777888999999999988753


No 26 
>PF03402 V1R:  Vomeronasal organ pheromone receptor family, V1R;  InterPro: IPR004072 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The rhodopsin-like GPCRs themselves represent a widespread protein family that includes hormone, neurotransmitter and light receptors, all of which transduce extracellular signals through interaction with guanine nucleotide-binding (G) proteins. Although their activating ligands vary widely in structure and character, the amino acid sequences of the receptors are very similar and are believed to adopt a common structural framework comprising 7 transmembrane (TM) helices [, , ]. Pheromones have evolved in all animal phyla, to signal sex and dominance status, and are responsible for stereotypical social and sexual behaviour among members of the same species. In mammals, these chemical signals are believed to be detected primarily by the vomeronasal organ (VNO), a chemosensory organ located at the base of the nasal septum []. The VNO is present in most amphibia, reptiles and non-primate mammals but is absent in birds, adult catarrhine monkeys and apes []. An active role for the human VNO in the detection of pheromones is disputed; the VNO is clearly present in the foetus but appears to be atrophied or absent in adults. Three distinct families of putative pheromone receptors have been identified in the vomeronasal organ (V1Rs, V2Rs and V3Rs). All are G protein-coupled receptors but are only distantly related to the receptors of the main olfactory system, highlighting their different role []. The V1 receptors share between 50 and 90% sequence identity but have little similarity to other families of G protein-coupled receptors. They appear to be distantly related to the mammalian T2R bitter taste receptors and the rhodopsin-like GPCRs []. In rat, the family comprises 30-40 genes. These are expressed in the apical regions of the VNO, in neurons expressing Gi2. Coupling of the receptors to this protein mediates inositol trisphosphate signalling []. A number of human V1 receptor homologues have also been found. The majority of these human sequences are pseudogenes [] but an apparently functional receptor has been identified that is expressed in the human olfactory system [].; GO: 0016503 pheromone receptor activity, 0007186 G-protein coupled receptor protein signaling pathway, 0016021 integral to membrane
Probab=54.76  E-value=19  Score=24.35  Aligned_cols=60  Identities=13%  Similarity=0.050  Sum_probs=40.0

Q ss_pred             chhhhhHhhchhhHHHHHHHHHhCCCCccchhHHHHHHHHhhcccchhHHHHHHhcHHHHHHH
Q psy11836          2 ALLVLINFACWAPVTFFALTAALGYPLISVTKSKILLVFFYPINSCFNPYLYALLTKHYRRDL   64 (112)
Q Consensus         2 ~~iv~~F~icw~Py~i~~l~~~~~~~~~~~~~~~~~~~~l~~~ns~~NPiiY~~~~~~fR~~~   64 (112)
                      ++.|..|+..+.--.++.++......   .+....+..+++..-+.+-|++-.-.+++..+-+
T Consensus       204 LlLVs~FV~fY~l~si~~~~~~~~~~---~~~~~~~~~~ls~cfptisPfvLI~~d~~i~~~~  263 (265)
T PF03402_consen  204 LLLVSTFVSFYGLSSILFIYLTSFKN---SPWLLNISVFLSSCFPTISPFVLISSDKRIIKFL  263 (265)
T ss_pred             eeHHHHHHHHHhHHHHHHHHHHHhcC---CcceeEHHHHHhHHhHhhChHHhhccCchHHHHh
Confidence            45677788888777776554332222   1233345667787889999999998888777654


No 27 
>PHA02849 putative transmembrane protein; Provisional
Probab=49.22  E-value=22  Score=19.38  Aligned_cols=22  Identities=14%  Similarity=0.232  Sum_probs=14.9

Q ss_pred             chhhhhHhhchhhHHHHHHHHH
Q psy11836          2 ALLVLINFACWAPVTFFALTAA   23 (112)
Q Consensus         2 ~~iv~~F~icw~Py~i~~l~~~   23 (112)
                      ++.+.++++|.+-|.++.+..+
T Consensus        19 vi~v~v~vI~i~~flLlyLvkw   40 (82)
T PHA02849         19 VILVFVLVISFLAFMLLYLIKW   40 (82)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            3456667778877777777654


No 28 
>KOG4686|consensus
Probab=44.30  E-value=26  Score=24.72  Aligned_cols=20  Identities=10%  Similarity=0.517  Sum_probs=15.9

Q ss_pred             chhhhhHhhchhhHHHHHHH
Q psy11836          2 ALLVLINFACWAPVTFFALT   21 (112)
Q Consensus         2 ~~iv~~F~icw~Py~i~~l~   21 (112)
                      .+|.+.|.+.|.|+..+.=+
T Consensus       270 ~iicv~yyva~fPFi~lg~~  289 (459)
T KOG4686|consen  270 VIICVLYYVAWFPFITLGPM  289 (459)
T ss_pred             HHHHHHHHHHHHHHhhhhHH
Confidence            46788899999999887443


No 29 
>PF10624 TraS:  Plasmid conjugative transfer entry exclusion protein TraS;  InterPro: IPR018898  Entry exclusion (Eex) is a process which prevents redundant transfer of DNA between donor cells. TraS is a protein involved in Eex. It blocks redundant conjugative DNA synthesis and transport between donor cells, and it is suggested that TraS interferes with a signalling pathway that is required to trigger DNA transfer []. TraS on the recipient cell is known to form an interaction with TraG on the donor cell []. 
Probab=43.51  E-value=16  Score=22.13  Aligned_cols=49  Identities=18%  Similarity=0.285  Sum_probs=23.4

Q ss_pred             hhhhHhhchhhHHHHHHHHHhCCCCccchh--HHHHHHHHhhcccchhHHH
Q psy11836          4 LVLINFACWAPVTFFALTAALGYPLISVTK--SKILLVFFYPINSCFNPYL   52 (112)
Q Consensus         4 iv~~F~icw~Py~i~~l~~~~~~~~~~~~~--~~~~~~~l~~~ns~~NPii   52 (112)
                      .++.|.+.|.-.++..+...-.+...+.+.  ..-+-++++-+.|.+||++
T Consensus        30 fil~f~~lWqglFiwlF~qIrkKr~v~defkfsk~vwyi~mpVcsllsPll   80 (164)
T PF10624_consen   30 FILLFIVLWQGLFIWLFIQIRKKRNVSDEFKFSKGVWYILMPVCSLLSPLL   80 (164)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhcCCCcchhccccceEEeeecHHHHHhHHH
Confidence            455666677666666555543332221110  0111123444667777765


No 30 
>PF05391 Lsm_interact:  Lsm interaction motif;  InterPro: IPR008669 This short motif is found at the C terminus of Prp24 proteins and probably interacts with the Lsm proteins to promote U4/U6 formation [].
Probab=43.46  E-value=13  Score=14.92  Aligned_cols=9  Identities=11%  Similarity=0.401  Sum_probs=6.1

Q ss_pred             hcHHHHHHH
Q psy11836         56 LTKHYRRDL   64 (112)
Q Consensus        56 ~~~~fR~~~   64 (112)
                      .|.|||+-|
T Consensus        11 SNddFrkmf   19 (21)
T PF05391_consen   11 SNDDFRKMF   19 (21)
T ss_pred             chHHHHHHH
Confidence            467888755


No 31 
>PHA02657 hypothetical protein; Provisional
Probab=43.15  E-value=31  Score=19.17  Aligned_cols=21  Identities=14%  Similarity=0.181  Sum_probs=13.6

Q ss_pred             hhhhhHhhchhhHHHHHHHHH
Q psy11836          3 LLVLINFACWAPVTFFALTAA   23 (112)
Q Consensus         3 ~iv~~F~icw~Py~i~~l~~~   23 (112)
                      +.+.+|++|.+-|.++.+..+
T Consensus        30 itvfv~vI~il~flLLYLvkW   50 (95)
T PHA02657         30 FTIFIFVVCILIYLLIYLVDW   50 (95)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            345566677777777766654


No 32 
>PF05393 Hum_adeno_E3A:  Human adenovirus early E3A glycoprotein;  InterPro: IPR008652 This family consists of several early glycoproteins (E3A), from human adenovirus type 2.; GO: 0016021 integral to membrane
Probab=42.95  E-value=13  Score=20.78  Aligned_cols=10  Identities=40%  Similarity=0.886  Sum_probs=4.8

Q ss_pred             hhhhHhhchh
Q psy11836          4 LVLINFACWA   13 (112)
Q Consensus         4 iv~~F~icw~   13 (112)
                      +|+.+++||.
T Consensus        47 ~VilwfvCC~   56 (94)
T PF05393_consen   47 LVILWFVCCK   56 (94)
T ss_pred             HHHHHHHHHH
Confidence            4444555554


No 33 
>KOG4193|consensus
Probab=42.16  E-value=46  Score=25.49  Aligned_cols=19  Identities=26%  Similarity=0.301  Sum_probs=16.6

Q ss_pred             HHHHHhcHHHHHHHHHHHH
Q psy11836         51 YLYALLTKHYRRDLVLTLA   69 (112)
Q Consensus        51 iiY~~~~~~fR~~~~~~~~   69 (112)
                      +.|++++++.|++.++.++
T Consensus       562 i~~cll~~kvr~~~~k~~~  580 (610)
T KOG4193|consen  562 IFHCLLRKKVRKEYRKWLC  580 (610)
T ss_pred             HhhhhhhHHHHHHHHHHhc
Confidence            5678889999999999986


No 34 
>PHA02754 hypothetical protein; Provisional
Probab=40.48  E-value=30  Score=17.73  Aligned_cols=17  Identities=12%  Similarity=0.229  Sum_probs=12.4

Q ss_pred             HHHhcHHHHHHHHHHHH
Q psy11836         53 YALLTKHYRRDLVLTLA   69 (112)
Q Consensus        53 Y~~~~~~fR~~~~~~~~   69 (112)
                      -++++++|.++++++--
T Consensus         9 k~i~eK~Fke~MRelkD   25 (67)
T PHA02754          9 KAIMEKDFKEAMRELKD   25 (67)
T ss_pred             HHHHHhHHHHHHHHHHH
Confidence            35788999888776553


No 35 
>COG3821 Predicted membrane protein [Function unknown]
Probab=38.86  E-value=16  Score=23.76  Aligned_cols=17  Identities=24%  Similarity=0.448  Sum_probs=11.7

Q ss_pred             hhhhhHhhchhhHHHHH
Q psy11836          3 LLVLINFACWAPVTFFA   19 (112)
Q Consensus         3 ~iv~~F~icw~Py~i~~   19 (112)
                      +-+++|++||+-|.-..
T Consensus         8 lA~~~F~~~W~~yt~~~   24 (234)
T COG3821           8 LALAVFLLCWLLYTPAS   24 (234)
T ss_pred             HHHHHHHHHHHhhhHHh
Confidence            34678889998665443


No 36 
>PF11036 YqgB:  Virulence promoting factor;  InterPro: IPR020196 The yqgB and yqfZ genes are associated with the genomes of bacteria with distinct pathogenic properties and consequently fall into the category of being virulence genes []. However, yqgB and yqfZ genes are not true virulence factors but instead are probably lifestyle determinant genes where the gene products act in concert, enabling the bacteria to cope with its suboptimal physical environment and thus facilitating host colonization [].
Probab=36.46  E-value=14  Score=17.35  Aligned_cols=10  Identities=50%  Similarity=1.009  Sum_probs=7.8

Q ss_pred             hHHHHHHhcH
Q psy11836         49 NPYLYALLTK   58 (112)
Q Consensus        49 NPiiY~~~~~   58 (112)
                      ||.+|+++++
T Consensus        18 ~~~vyGLLS~   27 (43)
T PF11036_consen   18 NPAVYGLLSQ   27 (43)
T ss_pred             CchhhhhHhh
Confidence            7888888764


No 37 
>PF02118 Srg:  Srg family chemoreceptor;  InterPro: IPR000609 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The nematode Caenorhabditis elegans has only 14 types of chemosensory neuron, yet is able to sense and respond to several hundred different chemicals because each neuron detects several stimuli []. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. Chemoreception in C. elegans is mediated by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs). More than 1300 potential chemoreceptor genes have been identified in C. elegans, which are generally prefixed sr for serpentine receptor. The receptor superfamilies include Sra (Sra, Srb, Srab, Sre), Str (Srh, Str, Sri, Srd, Srj, Srm, Srn) and Srg (Srx, Srt, Srg, Sru, Srv, Srxa), as well as the families Srw, Srz, Srbc, Srsx and Srr [, , ]. Many of these proteins have homologues in Caenorhabditis briggsae. This entry represents serpentine receptor class g (Srg) from the Srg superfamily [, ]. Srg receptors contain seven hydrophobic, putative transmembrane, regions and can be distinguished from other 7TM GPCR receptors by their own characteristic TM signatures. ; GO: 0004888 transmembrane signaling receptor activity, 0007606 sensory perception of chemical stimulus, 0016020 membrane
Probab=35.58  E-value=80  Score=20.79  Aligned_cols=29  Identities=28%  Similarity=0.462  Sum_probs=20.1

Q ss_pred             HHHHHHHhhcccchhHHHHHHhcHHHHHH
Q psy11836         35 KILLVFFYPINSCFNPYLYALLTKHYRRD   63 (112)
Q Consensus        35 ~~~~~~l~~~ns~~NPiiY~~~~~~fR~~   63 (112)
                      ..+.....-.-+...|++-.+.+++.|++
T Consensus       246 ~~~~~f~sD~ltl~~P~iLl~fs~~vR~~  274 (275)
T PF02118_consen  246 YYLLPFASDLLTLSQPYILLIFSKNVRRQ  274 (275)
T ss_pred             HHHHHHHHHHHHHHHHHHHheECHhhhcc
Confidence            33344444455667899999999999985


No 38 
>PF04505 Dispanin:  Interferon-induced transmembrane protein;  InterPro: IPR007593 This family includes the human leukocyte antigen CD225, which is an interferon inducible transmembrane protein, and is associated with interferon induced cell growth suppression [].; GO: 0009607 response to biotic stimulus, 0016021 integral to membrane
Probab=35.27  E-value=24  Score=19.26  Aligned_cols=22  Identities=14%  Similarity=0.326  Sum_probs=15.3

Q ss_pred             hhhhHhhchhhHHHHHHHHHhC
Q psy11836          4 LVLINFACWAPVTFFALTAALG   25 (112)
Q Consensus         4 iv~~F~icw~Py~i~~l~~~~~   25 (112)
                      .++..+.|+.|.-++.+++...
T Consensus        22 sI~s~l~Cc~PlGi~Ai~~s~k   43 (82)
T PF04505_consen   22 SIFSTLCCCWPLGIVAIVYSSK   43 (82)
T ss_pred             HHHHHHHHHhhHHHHHheechh
Confidence            3444557777999888887663


No 39 
>PF03155 Alg6_Alg8:  ALG6, ALG8 glycosyltransferase family;  InterPro: IPR004856 N-linked (asparagine-linked) glycosylation of proteins is mediated by a highly conserved pathway in eukaryotes, in which a lipid (dolichol phosphate)-linked oligosaccharide is assembled at the endoplasmic reticulum membrane prior to the transfer of the oligosaccharide moiety to the target asparagine residues. This oligosaccharide is composed of Glc(3)Man(9)GlcNAc(2). The addition of the three glucose residues is the final series of steps in the synthesis of the oligosaccharide precursor. Alg6 transfers the first glucose residue, and Alg8 transfers the second one []. In the human alg6 gene, a C-T transition, which causes Ala333 to be replaced with Val, has been identified as the cause of a congenital disorder of glycosylation, designated as type Ic OMIM:603147 []. ; GO: 0016758 transferase activity, transferring hexosyl groups, 0005789 endoplasmic reticulum membrane
Probab=32.60  E-value=29  Score=25.58  Aligned_cols=15  Identities=7%  Similarity=0.182  Sum_probs=13.2

Q ss_pred             chhhhhHhhchhhHH
Q psy11836          2 ALLVLINFACWAPVT   16 (112)
Q Consensus         2 ~~iv~~F~icw~Py~   16 (112)
                      +++++.|.++|+|+.
T Consensus       228 ~~Vi~~f~~~~~PF~  242 (469)
T PF03155_consen  228 IVVIATFALSFGPFL  242 (469)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            468899999999996


No 40 
>PF10319 7TM_GPCR_Srj:  Serpentine type 7TM GPCR chemoreceptor Srj;  InterPro: IPR019423 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The nematode Caenorhabditis elegans has only 14 types of chemosensory neuron, yet is able to sense and respond to several hundred different chemicals because each neuron detects several stimuli []. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. Chemoreception in C. elegans is mediated by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs). More than 1300 potential chemoreceptor genes have been identified in C. elegans, which are generally prefixed sr for serpentine receptor. The receptor superfamilies include Sra (Sra, Srb, Srab, Sre), Str (Srh, Str, Sri, Srd, Srj, Srm, Srn) and Srg (Srx, Srt, Srg, Sru, Srv, Srxa), as well as the families Srw, Srz, Srbc, Srsx and Srr [, , ]. Many of these proteins have homologues in Caenorhabditis briggsae.  This entry represents serpentine receptor class j (Srj) from the Str superfamily [, ]. The Srj family is designated as the out-group based on its location in preliminary phylogenetic analyses of the entire superfamily []. 
Probab=31.29  E-value=78  Score=22.09  Aligned_cols=53  Identities=11%  Similarity=0.192  Sum_probs=33.8

Q ss_pred             hhchhhHHHHHHHHHhCCCCccchhHHHHHHHHhhcccchhHHHHHHhcHHHHHH
Q psy11836          9 FACWAPVTFFALTAALGYPLISVTKSKILLVFFYPINSCFNPYLYALLTKHYRRD   63 (112)
Q Consensus         9 ~icw~Py~i~~l~~~~~~~~~~~~~~~~~~~~l~~~ns~~NPiiY~~~~~~fR~~   63 (112)
                      ++|+.|=.+......++-+ .. .+...+.......=+++||+.-.+.-|.||+.
T Consensus       257 ~vsf~Pc~~~wy~pif~i~-~~-~~~n~~~~iAls~FPf~DPlAii~~lP~~R~r  309 (310)
T PF10319_consen  257 CVSFSPCVLSWYGPIFGID-LG-RWNNYFSVIALSAFPFLDPLAIILCLPAFRNR  309 (310)
T ss_pred             HHhhccHHHHHhHHHHcCC-hh-HHHHHHHHHHHHHccccCchHhheecHHhhcc
Confidence            5677777766544444422 22 33333333333377899999999999999985


No 41 
>PF10842 DUF2642:  Protein of unknown function (DUF2642);  InterPro: IPR020139 This entry contains proteins with no known function.
Probab=31.19  E-value=28  Score=18.32  Aligned_cols=11  Identities=36%  Similarity=0.851  Sum_probs=9.0

Q ss_pred             cccchhHHHHH
Q psy11836         44 INSCFNPYLYA   54 (112)
Q Consensus        44 ~ns~~NPiiY~   54 (112)
                      ..|++||.+|-
T Consensus         4 ~vs~vdpyvyq   14 (66)
T PF10842_consen    4 MVSLVDPYVYQ   14 (66)
T ss_pred             ceeccCHHHHH
Confidence            46889999985


No 42 
>PF05399 EVI2A:  Ectropic viral integration site 2A protein (EVI2A);  InterPro: IPR008608 This family contains several mammalian ectropic viral integration site 2A (EVI2A) proteins. The function of this protein is unknown although it is thought to be a membrane protein and may function as an oncogene in retrovirus induced myeloid tumours [, ].; GO: 0016021 integral to membrane
Probab=29.89  E-value=20  Score=23.50  Aligned_cols=10  Identities=10%  Similarity=0.637  Sum_probs=5.0

Q ss_pred             chhhhhHhhc
Q psy11836          2 ALLVLINFAC   11 (112)
Q Consensus         2 ~~iv~~F~ic   11 (112)
                      ++|.++|+||
T Consensus       135 IIIAVLfLIC  144 (227)
T PF05399_consen  135 IIIAVLFLIC  144 (227)
T ss_pred             HHHHHHHHHH
Confidence            3445555555


No 43 
>PHA03169 hypothetical protein; Provisional
Probab=28.84  E-value=19  Score=25.67  Aligned_cols=59  Identities=14%  Similarity=0.339  Sum_probs=29.4

Q ss_pred             hhchh-hHHHHHHHHHhCCCCccchhHHHHHHHHhhcccchhHHHHHHh----cHHHHHHHHHHHHhh
Q psy11836          9 FACWA-PVTFFALTAALGYPLISVTKSKILLVFFYPINSCFNPYLYALL----TKHYRRDLVLTLARI   71 (112)
Q Consensus         9 ~icw~-Py~i~~l~~~~~~~~~~~~~~~~~~~~l~~~ns~~NPiiY~~~----~~~fR~~~~~~~~~~   71 (112)
                      ++||. ||.++.|-..+........    -...|-..+-.--|++|++.    +++--|++++.-+..
T Consensus       326 v~fWgdP~~LyrLsraLqfpG~~ss----gvq~lP~~p~~p~~~~y~ItVyCqsk~TaK~V~kaq~~y  389 (413)
T PHA03169        326 VFCWGDPYSLYRLSRCLQFPGAVSS----GVQTFPDAPGSPVIWAYCITVFCQSRGTAKAVIKAQKKY  389 (413)
T ss_pred             EEecCCcHHHHHHHHHhccCCeecc----ceeecCCCCCCCCCceeEEEEEecCcccHHHHHHHHHHH
Confidence            57888 7888888766633221000    01122223333344555443    556666666655543


No 44 
>PF11014 DUF2852:  Protein of unknown function (DUF2852);  InterPro: IPR021273  This bacterial family of proteins has no known function. 
Probab=28.80  E-value=62  Score=19.09  Aligned_cols=8  Identities=25%  Similarity=0.106  Sum_probs=3.7

Q ss_pred             hhhhhHhh
Q psy11836          3 LLVLINFA   10 (112)
Q Consensus         3 ~iv~~F~i   10 (112)
                      +||+-|++
T Consensus        14 ~mVlGFi~   21 (115)
T PF11014_consen   14 AMVLGFIV   21 (115)
T ss_pred             HHHHHHHH
Confidence            34444444


No 45 
>TIGR01096 3A0103s03R lysine-arginine-ornithine-binding periplasmic protein.
Probab=26.25  E-value=39  Score=21.69  Aligned_cols=19  Identities=16%  Similarity=-0.015  Sum_probs=15.0

Q ss_pred             hhhhhHhhchhhHHHHHHH
Q psy11836          3 LLVLINFACWAPVTFFALT   21 (112)
Q Consensus         3 ~iv~~F~icw~Py~i~~l~   21 (112)
                      +.++++++||+|+-+..=.
T Consensus         3 ~~~~~~~~~~~~~~~~~~~   21 (250)
T TIGR01096         3 VLLAALVAGASSAATAAAA   21 (250)
T ss_pred             hhHHHHHHhccchhhHHHh
Confidence            5678999999998777643


No 46 
>KOG3827|consensus
Probab=25.27  E-value=16  Score=26.19  Aligned_cols=20  Identities=10%  Similarity=0.076  Sum_probs=14.8

Q ss_pred             chhhhhHhhchhhHHHHHHH
Q psy11836          2 ALLVLINFACWAPVTFFALT   21 (112)
Q Consensus         2 ~~iv~~F~icw~Py~i~~l~   21 (112)
                      ++-.+.|++.|+=|-++.-+
T Consensus        67 liF~~sf~~SWl~Fg~iwwl   86 (400)
T KOG3827|consen   67 LIFSLSFVLSWLFFGVIWWL   86 (400)
T ss_pred             HHHHHHHHHHHHHHHHHHHH
Confidence            45567899999988777444


No 47 
>PF11587 Prion_bPrPp:  Major prion protein bPrPp - N terminal; PDB: 1SKH_A.
Probab=24.40  E-value=46  Score=14.46  Aligned_cols=13  Identities=38%  Similarity=0.795  Sum_probs=5.8

Q ss_pred             hchhhHHHHHHHH
Q psy11836         10 ACWAPVTFFALTA   22 (112)
Q Consensus        10 icw~Py~i~~l~~   22 (112)
                      -||+=...+..|.
T Consensus         7 gcWilvLfvatws   19 (29)
T PF11587_consen    7 GCWILVLFVATWS   19 (29)
T ss_dssp             TTHHHHHHHHHHH
T ss_pred             cHHHHHHHHHHHh
Confidence            3555444444443


No 48 
>KOG1735|consensus
Probab=24.32  E-value=8  Score=23.72  Aligned_cols=12  Identities=42%  Similarity=0.667  Sum_probs=8.1

Q ss_pred             hHhhchhhHHHH
Q psy11836          7 INFACWAPVTFF   18 (112)
Q Consensus         7 ~F~icw~Py~i~   18 (112)
                      +|++||.|...-
T Consensus        87 i~f~~wsPd~a~   98 (146)
T KOG1735|consen   87 IFFIAWSPDTAP   98 (146)
T ss_pred             EEEEEECCCccc
Confidence            467788876553


No 49 
>COG4818 Predicted membrane protein [Function unknown]
Probab=24.22  E-value=1e+02  Score=17.62  Aligned_cols=12  Identities=25%  Similarity=0.473  Sum_probs=8.1

Q ss_pred             hhhHhhchhhHH
Q psy11836          5 VLINFACWAPVT   16 (112)
Q Consensus         5 v~~F~icw~Py~   16 (112)
                      ++++++.|.|+-
T Consensus        47 ~l~ill~~iP~I   58 (105)
T COG4818          47 LLIILLAFIPYI   58 (105)
T ss_pred             HHHHHHHHhhhh
Confidence            456677777774


No 50 
>PF02295 z-alpha:  Adenosine deaminase z-alpha domain;  InterPro: IPR000607 Double-stranded RNA-specific adenosine deaminase (3.5 from EC) converts multiple adenosines to inosines and creates I/U mismatched base pairs in double-helical RNA substrates without apparent sequence specificity. DRADA has been found to modify adenosines in AU-rich regions more frequently, probably due to the relative ease of melting A/U base pairs compared to G/C base pairs. The protein functions to modify viral RNA genomes, and may be responsible for hypermutation of certain negative-stranded viruses. DRADA edits the mRNAs for the glutamate receptor subunits by site-selective adenosine deamination. The DRADA repeat is also found in viral E3 proteins, which contain a double-stranded RNA-binding domain.; GO: 0003723 RNA binding, 0003726 double-stranded RNA adenosine deaminase activity; PDB: 1OYI_A 3EYI_A 2L4M_A 2HEO_D 1J75_A 1SFU_B 3IRR_B 2ACJ_C 3F22_B 2L54_A ....
Probab=24.13  E-value=51  Score=17.17  Aligned_cols=13  Identities=31%  Similarity=0.317  Sum_probs=10.5

Q ss_pred             ccchhHHHHHHhc
Q psy11836         45 NSCFNPYLYALLT   57 (112)
Q Consensus        45 ns~~NPiiY~~~~   57 (112)
                      -.-+|+++|.+..
T Consensus        34 kk~VN~~LY~L~k   46 (66)
T PF02295_consen   34 KKEVNRVLYRLEK   46 (66)
T ss_dssp             HHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHH
Confidence            5789999998654


No 51 
>PF04628 Sedlin_N:  Sedlin, N-terminal conserved region;  InterPro: IPR006722  Sedlin is a 140 amino-acid protein with a putative role in endoplasmic reticulum-to-Golgi transport. Several missense mutations and deletion mutations in the SEDL gene, which result in protein truncation by frame shift, are responsible for spondyloepiphyseal dysplasia tarda, a progressive skeletal disorder (OMIM:313400). [].; GO: 0006888 ER to Golgi vesicle-mediated transport, 0005622 intracellular; PDB: 3PR6_A 2J3W_A 1H3Q_A.
Probab=24.08  E-value=44  Score=19.82  Aligned_cols=29  Identities=7%  Similarity=0.149  Sum_probs=20.0

Q ss_pred             HhhcccchhHHH---HHHhcHHHHHHHHHHHH
Q psy11836         41 FYPINSCFNPYL---YALLTKHYRRDLVLTLA   69 (112)
Q Consensus        41 l~~~ns~~NPii---Y~~~~~~fR~~~~~~~~   69 (112)
                      =+|+....||+-   =-+.++.|.+.++++.+
T Consensus       100 ~~Y~~~~~NPF~~~~~~I~S~~Fd~~v~~l~~  131 (132)
T PF04628_consen  100 ELYVKALCNPFYQPGTPIKSPKFDSRVRALAK  131 (132)
T ss_dssp             HHHHHHHTSTTCGCT-HHHHHHHHHHHHHHHH
T ss_pred             HHHHHHccCCCCCCCCCcCCHHHHHHHHHHhc
Confidence            445667777775   35668888888887764


No 52 
>PHA02132 hypothetical protein
Probab=23.75  E-value=1.2e+02  Score=16.19  Aligned_cols=20  Identities=10%  Similarity=0.323  Sum_probs=15.2

Q ss_pred             hhHhhchhhHHHHHHHHHhC
Q psy11836          6 LINFACWAPVTFFALTAALG   25 (112)
Q Consensus         6 ~~F~icw~Py~i~~l~~~~~   25 (112)
                      +.-...|+|..++.++....
T Consensus        55 g~ia~awlp~~~~l~~kl~e   74 (86)
T PHA02132         55 GMIAGAWLPLAIYLVCKLCE   74 (86)
T ss_pred             HHHHHHHHHHHHHHHHHHHH
Confidence            44456899999998887653


No 53 
>PF07746 LigA:  Aromatic-ring-opening dioxygenase LigAB, LigA subunit;  InterPro: IPR011986  Dioxygenases catalyse the incorporation of both atoms of molecular oxygen into substrates using a variety of reaction mechanisms. Cleavage of aromatic rings is one of the most important functions of dioxygenases, which play key roles in the degradation of aromatic compounds. The substrates of ring-cleavage dioxygenases can be classified into two groups according to the mode of scission of the aromatic ring. Intradiol enzymes (IPR000627 from INTERPRO) use a non-haem Fe(III) to cleave the aromatic ring between two hydroxyl groups (ortho-cleavage), whereas extradiol enzymes use a non-haem Fe(II) to cleave the aromatic ring between a hydroxylated carbon and an adjacent non-hydroxylated carbon (meta-cleavage) [, ]. These two subfamilies differ in sequence, structural fold, iron ligands, and the orientation of second sphere active site amino acid residues. Extradiol dioxygenases are usually homo-multimeric, bind one atom of ferrous ion per subunit and have a subunit size of about 33 kDa. Extradiol dioxygenases can be divided into three classes. Class I and II enzymes (IPR000486 from INTERPRO) show sequence similarity, with the two-domain class II enzymes having evolved from a class I enzyme through gene duplication. Class III enzymes are different in sequence and structure, but they do share several common active-site characteristics with the class II enzymes, in particular the coordination sphere and the disposition of the putative catalytic base are very similar. Class III enzymes usually have two subunits, designated A (IPR004183 from INTERPRO) and B (IPR004183 from INTERPRO). LigAB is a protocatechuate 4,5-dioxygenase (1.13.11.8 from EC) that belongs to the extradiol class III enzyme family. The LigA subunit of this enzyme is multi-helical, containing a compact array of 6 short helices [].; PDB: 1BOU_A 1B4U_A.
Probab=23.02  E-value=1.1e+02  Score=17.01  Aligned_cols=20  Identities=15%  Similarity=0.348  Sum_probs=15.9

Q ss_pred             hhHHHHHHhcHHHHHHHHHH
Q psy11836         48 FNPYLYALLTKHYRRDLVLT   67 (112)
Q Consensus        48 ~NPiiY~~~~~~fR~~~~~~   67 (112)
                      +|=+++.+..++.|++|++-
T Consensus         1 lNkf~~~L~~~~~r~~F~~D   20 (88)
T PF07746_consen    1 LNKFCWSLNDPENRERFLAD   20 (88)
T ss_dssp             HHHHHHGGGSHHHHHHHHH-
T ss_pred             ChHHHHHHcCHHHHHHHHHC
Confidence            47788889999999988763


No 54 
>PF13153 DUF3985:  Protein of unknown function (DUF3985)
Probab=22.43  E-value=1e+02  Score=14.42  Aligned_cols=19  Identities=16%  Similarity=0.139  Sum_probs=11.3

Q ss_pred             hhhhhHhhchhhHHHHHHH
Q psy11836          3 LLVLINFACWAPVTFFALT   21 (112)
Q Consensus         3 ~iv~~F~icw~Py~i~~l~   21 (112)
                      ++.++|++|=..|..+.+.
T Consensus         9 lvlliyv~~kvayvalkil   27 (44)
T PF13153_consen    9 LVLLIYVFFKVAYVALKIL   27 (44)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            4556666666666655443


No 55 
>PRK13378 protocatechuate 4,5-dioxygenase subunit alpha; Provisional
Probab=22.37  E-value=1.2e+02  Score=17.95  Aligned_cols=20  Identities=10%  Similarity=0.218  Sum_probs=17.3

Q ss_pred             chhHHHHHHhcHHHHHHHHH
Q psy11836         47 CFNPYLYALLTKHYRRDLVL   66 (112)
Q Consensus        47 ~~NPiiY~~~~~~fR~~~~~   66 (112)
                      -+|=+++.+..++.|++|+.
T Consensus        26 ~LN~fc~sl~~~~nRe~F~a   45 (117)
T PRK13378         26 ALNKMCFSFNDAANRAAFLA   45 (117)
T ss_pred             HHHHHHHHhCCHHHHHHHHh
Confidence            36889999999999999965


No 56 
>PF11601 Shal-type:  Shal-type voltage-gated potassium channels ;  InterPro: IPR021645  This family of proteins represents Shal-type voltage-gated potassium channels which interact with Kv channel-interacting proteins to modulate cell surface expression and function of Kv4 channels. The interaction of the Shal-type protein Kv4.2 and the Kv interacting protein KChiP1 forms a structure which is like the structure between calmodulin and its target peptides when they interact. Interactions of an N-terminal alpha helix in Kv4.2 and a C-terminal alpha helix in KChIP1 are essential for the modulation of Kv4.2 by KChIPs []. ; PDB: 2NZ0_B 2I2R_B 1S6C_B.
Probab=22.18  E-value=44  Score=14.31  Aligned_cols=13  Identities=31%  Similarity=0.508  Sum_probs=8.1

Q ss_pred             hchhhHHHHHHHH
Q psy11836         10 ACWAPVTFFALTA   22 (112)
Q Consensus        10 icw~Py~i~~l~~   22 (112)
                      ..|+||.=..-+.
T Consensus         4 aaWlPfaraaAIG   16 (28)
T PF11601_consen    4 AAWLPFARAAAIG   16 (28)
T ss_dssp             HTTHHHHHHHHTT
T ss_pred             hhhhhHHHHHhhc
Confidence            4688886554443


No 57 
>PF04654 DUF599:  Protein of unknown function, DUF599;  InterPro: IPR006747 This family includes several uncharacterised proteins.
Probab=22.06  E-value=82  Score=20.56  Aligned_cols=24  Identities=13%  Similarity=0.326  Sum_probs=18.3

Q ss_pred             hhhhhHhhchhhHHHHHHHHHhCC
Q psy11836          3 LLVLINFACWAPVTFFALTAALGY   26 (112)
Q Consensus         3 ~iv~~F~icw~Py~i~~l~~~~~~   26 (112)
                      +.+..|++||.=|+.+........
T Consensus         2 ~av~~~l~~~~gY~~~l~~~~~~~   25 (216)
T PF04654_consen    2 IAVPLFLLCWVGYHLYLERRVRRR   25 (216)
T ss_pred             cHHHHHHHHHHHHHHHHhhhccCC
Confidence            467889999999998876655433


No 58 
>cd07925 LigA_like_1 The A subunit of Uncharacterized proteins with similarity to Protocatechuate 4,5-dioxygenase (LigAB). The proteins of unknown function in this subfamily are similar to the A subunit of the Protocatechuate (PCA) 4,5-dioxygenase (LigAB). LigAB belongs to the class III extradiol dioxygenase family, composed of enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. Dioxygenases play key roles in the degradation of aromatic compounds. PCA 4,5-dioxygenase catalyzes the oxidization and subsequent ring-opening of PCA (or 3,4-dihydroxybenzoic acid), which is an intermediate in the breakdown of lignin and other compounds.
Probab=21.90  E-value=1.3e+02  Score=17.53  Aligned_cols=20  Identities=10%  Similarity=0.235  Sum_probs=17.1

Q ss_pred             chhHHHHHHhcHHHHHHHHH
Q psy11836         47 CFNPYLYALLTKHYRRDLVL   66 (112)
Q Consensus        47 ~~NPiiY~~~~~~fR~~~~~   66 (112)
                      -+|=+++.+..++.|++|+.
T Consensus        15 ~LN~fc~sl~~~~nRe~F~a   34 (106)
T cd07925          15 ALNKMCFSFNDAANREAFLA   34 (106)
T ss_pred             HHHHHHHHHCCHHHHHHHHh
Confidence            36889999999999999865


No 59 
>PRK06099 F0F1 ATP synthase subunit I; Validated
Probab=21.31  E-value=1.1e+02  Score=18.30  Aligned_cols=19  Identities=16%  Similarity=0.249  Sum_probs=14.7

Q ss_pred             hhHhhchhhHHHHHHHHHh
Q psy11836          6 LINFACWAPVTFFALTAAL   24 (112)
Q Consensus         6 ~~F~icw~Py~i~~l~~~~   24 (112)
                      .-.++||+|+.++.....+
T Consensus        43 ~Ggli~~LPn~~Fa~~aF~   61 (126)
T PRK06099         43 LGFLSAFLPFCLFVYWIFF   61 (126)
T ss_pred             HhhHHHHHhHHHHHHHHHH
Confidence            3457899999999887644


No 60 
>PRK06761 hypothetical protein; Provisional
Probab=21.26  E-value=15  Score=25.04  Aligned_cols=32  Identities=19%  Similarity=0.208  Sum_probs=24.5

Q ss_pred             HHHHhhcccchhHHHHHHhcHHHHHHHHHHHHh
Q psy11836         38 LVFFYPINSCFNPYLYALLTKHYRRDLVLTLAR   70 (112)
Q Consensus        38 ~~~l~~~ns~~NPiiY~~~~~~fR~~~~~~~~~   70 (112)
                      ..+.+.+ .-+||+|+.+...|..+++++.+..
T Consensus       172 ~~l~~~i-~~l~p~l~yl~~~dv~~~~~~~~~e  203 (282)
T PRK06761        172 MKLAKII-ENLNPMLFYLEQDDVEFSFRKALKE  203 (282)
T ss_pred             HHHHHHH-hccCcEEEEecccCHHHHHHHHHHh
Confidence            3344433 3789999999999999999998853


No 61 
>PF07325 Curto_V2:  Curtovirus V2 protein;  InterPro: IPR009931 This family consists of several Curtovirus V2 proteins. The exact function of V2 is unclear but it is known that the protein is required for a successful host infection process [].
Probab=21.07  E-value=93  Score=18.13  Aligned_cols=12  Identities=17%  Similarity=0.506  Sum_probs=10.5

Q ss_pred             HHHHHHHHHHHh
Q psy11836         59 HYRRDLVLTLAR   70 (112)
Q Consensus        59 ~fR~~~~~~~~~   70 (112)
                      +|++++++++++
T Consensus        52 qFQKevKKLLk~   63 (126)
T PF07325_consen   52 QFQKEVKKLLKR   63 (126)
T ss_pred             HHHHHHHHHHHH
Confidence            699999999975


No 62 
>TIGR02792 PCA_ligA protocatechuate 4,5-dioxygenase, alpha subunit. Protocatechuate (PCA) 4,5-dioxygenase is the first enzyme in the PCA 4,5-cleavage pathway that is an alternative to PCA 3,4-cleavage and PCA 2,3 cleavage pathways. PCA is an intermediate in the breakdown of lignin (hence the gene symbol ligA) and other compounds. Members of this family are the alpha chain of PCA 4,5-dioxygenase, or the equivalent domain of a fusion protein.
Probab=20.81  E-value=1.3e+02  Score=17.80  Aligned_cols=20  Identities=15%  Similarity=0.296  Sum_probs=17.1

Q ss_pred             chhHHHHHHhcHHHHHHHHH
Q psy11836         47 CFNPYLYALLTKHYRRDLVL   66 (112)
Q Consensus        47 ~~NPiiY~~~~~~fR~~~~~   66 (112)
                      -+|=+.+.+..++.|++|+.
T Consensus        20 ~LN~fc~sl~~~~nRerF~a   39 (117)
T TIGR02792        20 NLNQFCMSLMKAENRERFKA   39 (117)
T ss_pred             HHHHHHHHhcCHHHHHHHHh
Confidence            36889999999999999965


No 63 
>PF00375 SDF:  Sodium:dicarboxylate symporter family;  InterPro: IPR001991 It has been shown [] that integral membrane proteins that mediate the uptake of a wide variety of molecules with the concomitant uptake of sodium ions (sodium symporters) can be grouped, on the basis of sequence and functional similarities into a number of distinct families. One of these families [] is known as the sodium:dicarboxylate symporter family (SDF). Such re-uptake of neurotransmitters from the synapses, is thought to be an important mechanism for terminating their action, by removing these chemicals from the synaptic cleft, and transporting them into presynaptic nerve terminals, and surrounding neuroglia. this removal is also believed to prevent them accumulating to the point of reaching neurotoxic [, ]. The structure of these transporter proteins has been variously reported to contain from 8 to 10 transmembrane (TM) regions, although 10 now seems to be the accepted value. Members of the family include: several mammalian excitatory amino acid transporters, and a number of bacterial transporters. They vary with regars to their dependence on transport of sodium, and other ions.; GO: 0017153 sodium:dicarboxylate symporter activity, 0006835 dicarboxylic acid transport, 0016020 membrane; PDB: 3V8G_B 1XFH_A 3KBC_B 2NWX_B 3V8F_B 2NWL_B 2NWW_A.
Probab=20.59  E-value=3.3e+02  Score=19.42  Aligned_cols=66  Identities=20%  Similarity=0.102  Sum_probs=37.3

Q ss_pred             hhhhHhhchhhHHHHHHHHHhCCCCccchhHHH-----HHHHHh-hc-ccchhHHHHH-HhcHHHHHHHHHHHHh
Q psy11836          4 LVLINFACWAPVTFFALTAALGYPLISVTKSKI-----LLVFFY-PI-NSCFNPYLYA-LLTKHYRRDLVLTLAR   70 (112)
Q Consensus         4 iv~~F~icw~Py~i~~l~~~~~~~~~~~~~~~~-----~~~~l~-~~-ns~~NPiiY~-~~~~~fR~~~~~~~~~   70 (112)
                      -++-++++.+|+-+..++....... ..+....     +..+++ .. -..+.|+++. +..++..+-++++.+-
T Consensus       175 ~ii~~i~~~~Pigv~~l~a~~~~~~-~~~~l~~l~~~v~~~~~~~~i~~~v~~pl~~~~~~~~np~~~~~~~~~~  248 (390)
T PF00375_consen  175 KIINWIMKLAPIGVFGLIANSIATQ-GLSILGALGKFVLTVYVALLIHLFVVLPLILFVLTRKNPFKFLKAMLPA  248 (390)
T ss_dssp             HHHHHHTTTHHHHHHHHHHHHHHSS-CCGHHHHHHHHHHHHHHHHHHHHHHTHHHHHH-TTT--HHHHHHHTHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhc-ChhhHHHHHHHHHHHHHHHHHHHHHHhhHHHhhhcCCCHHHHHHHHHHH
Confidence            4566788999999998886542221 1222211     111111 12 3467899999 5566777777776653


No 64 
>PF14752 RBP_receptor:  Retinol binding protein receptor
Probab=20.42  E-value=1.6e+02  Score=22.75  Aligned_cols=19  Identities=26%  Similarity=0.425  Sum_probs=12.5

Q ss_pred             hhhhhHhhchhhHHHHHHH
Q psy11836          3 LLVLINFACWAPVTFFALT   21 (112)
Q Consensus         3 ~iv~~F~icw~Py~i~~l~   21 (112)
                      ++.++|+.+|.|+.++.-.
T Consensus       170 llCL~fL~~~f~~~lvk~~  188 (617)
T PF14752_consen  170 LLCLAFLSLWFPYLLVKSF  188 (617)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            3566777777777766433


Done!