Diaphorina citri psyllid: psy11874

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------
MFTDVRYSYIIDQQPIGRLLFRQFCAEAKPQYHKYNVLFLAMFTLALYVRYSYIIDQQPIGRLLFRQFCAEAKPQYHKYNVFLDSIENYELEMDENRRLSTKDIYNEIQPITYKTFRMYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKRKGESMVLIEKQILQKINSRFVVSLAYAYETKDALCLVLTIMNGGDLKFHIYNMGGEPGFDIARARFYAAEVLCGLEHLHYIGLVYRDCKPENILLDDYGHVRISDLGLAVEIPEGESVRGRVGTVGYMAPEVIDNEKYTYSPDWFSFGCLIFEMIEGQAPFRRRKEMVKRDEVDRRVKEDAEKYSCRFSDDAKALCKALLKKSPRSRLGCHCGRYGARELKQAEFFKSTNWKRLEAGLCDPPFVPDVKRDEVDRRVKEDAEKYSCRFSDDAKALCKALLKKSPRSRLGKSHCLSIGLVMMLKLSVLKKNVNLSVLNTVQIPLFFPQAPEAVDVLSLEIIEHCKESLDSGNRELFNDCMAAVKTFLAGAPFTEFQDSMFFYRYLQWKWLEHHFLYVEVFTHGVYCSQPHAVYAKDVLDIEQFSTVKGVTLDTTDDSFYSKFNTGSVSIPWQNEMIETECFKELNVFGENNTPSSDVMFTSVPPSETNPSCFPQPITYKTFRMYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKRKGESMVLIEKQILQKINSRFVVSLAYAYETKDALCLVLTIIDVMFTCVQPSETNPCCFPFRRKEVVVVAAFDFT
ccccccccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEEcccccEEEEEEEcccccEEEEEEcccccccccccHHHHHHHHHHHHHcccccEEcccccccccccEEEEEEEEccccHHHHHHcccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEECccccccccccccccccccccccccccHHccccccccccccHHHHHHHHHHHccccccccccccccHHHHHHHHHcccccccccccHHHHHHHHHHHccccccccccccccccHHHHHHccccccccHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccHHHHHHccccccccccHHHccccccccccccccccccccHHHHHHHHHccccccccHHHHHHHHHHHHHcccccccccccccccccccHHHccccccccccccccccccccccEEcHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccEEEEEEcccccEEEEEEEcccccEEEEEEEccccccccccHHHHHHHHHHHHHcccccEEcccccccccccEEEHHHHHHHHHHHHccccccccccccHHHHHHHHHccccc
MFTDVRYSYIIDQQPIGRLLFRQFCAEAKPQYHKYNVLFLAMFTLALYVRYSYIIDQQPIGRLLFRQFCAE********N**LDS**********************IQPITYKTFRMYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKRKGESMVLIEKQILQKINSRFVVSLAYAYETKDALCLVLTIMNGGDLKFHIYNMGGEPGFDIARARFYAAEVLCGLEHLHYIGLVYRDCKPENILLDDYGHVRISDLGLAVEIPEGESVRGRVGTVGYMAPEVIDNEKYTYSPDWFSFGCLIFEMIEGQAPFRRRKEMVKRDEVDRRVKEDAEKYSCRFSDDAKALCKALLKKSPRSRLGCHCGRYGARELKQAEFFKSTNWKRLEAGLCDPPFVPDVKRDEVDRRVKEDAEKYSCRFSDDAKALCKALLKKSPRSRLGKSHCLSIGLVMMLKLSVLKKNVNLSVLNTVQIPLFFPQAPEAVDVLSLEIIEHCKESLDSGNRELFNDCMAAVKTFLAGAPFTEFQDSMFFYRYLQWKWLEHHFLYVEVFTHGVYCSQPHAVYAKDVLDIEQFSTVKGVTLDTTDDSFYSKFNTGSVSIP***EMIETECFKELNVFGENNTPSSDVMFTSVPPSETNPSCFPQPITYKTFRMYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKRKGESMVLIEKQILQKINSRFVVSLAYAYETKDALCLVLTIIDVMFTCVQPSETNPCCFPFRRKEVVVVAAFDFT
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFTDVRYSYIIDQQPIGRLLFRQFCAEAKPQYHKYNVLFLAMFTLALYVRYSYIIDQQPIGRLLFRQFCAEAKPQYHKYNVFLDSIENYELEMDENRRLSTKDIYNEIQPITYKTFRMYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKRKGESMVLIEKQILQKINSRFVVSLAYAYETKDALCLVLTIMNGGDLKFHIYNMGGEPGFDIARARFYAAEVLCGLEHLHYIGLVYRDCKPENILLDDYGHVRISDLGLAVEIPEGESVRGRVGTVGYMAPEVIDNEKYTYSPDWFSFGCLIFEMIEGQAPFRRRKEMVKRDEVDRRVKEDAEKYSCRFSDDAKALCKALLKKSPRSRLGCHCGRYGARELKQAEFFKSTNWKRLEAGLCDPPFVPDVKRDEVDRRVKEDAEKYSCRFSDDAKALCKALLKKSPRSRLGKSHCLSIGLVMMLKLSVLKKNVNLSVLNTVQIPLFFPQAPEAVDVLSLEIIEHCKESLDSGNRELFNDCMAAVKTFLAGAPFTEFQDSMFFYRYLQWKWLEHHFLYVEVFTHGVYCSQPHAVYAKDVLDIEQFSTVKGVTLDTTDDSFYSKFNTGSVSIPWQNEMIETECFKELNVFGENNTPSSDVMFTSVPPSETNPSCFPQPITYKTFRMYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKRKGESMVLIEKQILQKINSRFVVSLAYAYETKDALCLVLTIIDVMFTCVQPSETNPCCFPFRRKEVVVVAAFDFT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
G protein-coupled receptor kinase 2 Specifically phosphorylates the activated forms of G protein-coupled receptors (By similarity). Required during oogenesis and embryogenesis; component of a signaling pathway that functions during egg chamber maturation.confidentP32866
G protein-coupled receptor kinase 1 Specifically phosphorylates the activated forms of G protein-coupled receptors.confidentQ09537
G protein-coupled receptor kinase 5 Serine/threonine kinase that phosphorylates preferentially the activated forms of a variety of G-protein-coupled receptors (GPCRs). Such receptor phosphorylation initiates beta-arrestin-mediated receptor desensitization, internalization, and signaling events leading to their down-regulation. Phosphorylates a variety of GPCRs, including adrenergic receptors, muscarinic acetylcholine receptors (more specifically Gi-coupled M2/M4 subtypes), dopamine receptors and opioid receptors. In addition to GPCRs, also phosphorylates various substrates: Hsc70-interacting protein/ST13, TP53/p53, HDAC5, and arrestin-1/ARRB1. Phosphorylation of ARRB1 by GRK5 inhibits G-protein independent MAPK1/MAPK3 signaling downstream of 5HT4-receptors. Phosphorylation of HDAC5, a repressor of myocyte enhancer factor 2 (MEF2) leading to nuclear export of HDAC5 and allowing MEF2-mediated transcription. Phosphorylation of TP53/p53, a crucial tumor suppressor, inhibits TP53/p53-mediated apoptosis. Phosphorylation of ST13 regulates internalization of the chemokine receptor. Phosphorylates rhodopsin (RHO) (in vitro) and a non G-protein-coupled receptor, LRP6 during Wnt signaling (in vitro).confidentP34947

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0050830 [BP]defense response to Gram-positive bacteriumprobableGO:0009607, GO:0050896, GO:0009617, GO:0006952, GO:0006950, GO:0008150, GO:0042742, GO:0051707, GO:0051704
GO:0035556 [BP]intracellular signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0018107 [BP]peptidyl-threonine phosphorylationprobableGO:0044267, GO:0006468, GO:0009987, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0018210, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:0018105 [BP]peptidyl-serine phosphorylationprobableGO:0044267, GO:0006468, GO:0018209, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:0019219 [BP]regulation of nucleobase-containing compound metabolic processprobableGO:0080090, GO:0019222, GO:0031323, GO:0050794, GO:0065007, GO:0051171, GO:0008150, GO:0050789
GO:0040017 [BP]positive regulation of locomotionprobableGO:0048518, GO:0008150, GO:0040012, GO:0065007, GO:0050789
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0050790 [BP]regulation of catalytic activityprobableGO:0008150, GO:0065009, GO:0065007, GO:0050789, GO:0019222
GO:0050254 [MF]rhodopsin kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0007217 [BP]tachykinin receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0007186, GO:0050789, GO:0044699
GO:0016572 [BP]histone phosphorylationprobableGO:0016310, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0016043, GO:0071704, GO:0016570, GO:0006468, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0019538, GO:0044237, GO:0043170, GO:0006796, GO:0006793, GO:0008150, GO:0016568, GO:0016569
GO:0045879 [BP]negative regulation of smoothened signaling pathwayprobableGO:0008589, GO:0009968, GO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0002031 [BP]G-protein coupled receptor internalizationprobableGO:0048585, GO:0023051, GO:0048583, GO:0023057, GO:0008277, GO:0010648, GO:0022401, GO:0010646, GO:0050789, GO:0023058, GO:0009968, GO:0009966, GO:0071704, GO:0045744, GO:0065007, GO:0044699, GO:0048519, GO:0002029, GO:0009987, GO:0006810, GO:0044260, GO:0044765, GO:0008150, GO:0008152, GO:0051234, GO:0051179, GO:0050794, GO:0016192, GO:0006897, GO:0031623, GO:0006898, GO:0044237, GO:0043170, GO:0043112, GO:0048523
GO:0045937 [BP]positive regulation of phosphate metabolic processprobableGO:0019220, GO:0009893, GO:0019222, GO:0010562, GO:0031323, GO:0050794, GO:0051174, GO:0050789, GO:0065007, GO:0048518, GO:0008150, GO:0031325, GO:0048522
GO:0051049 [BP]regulation of transportprobableGO:0008150, GO:0032879, GO:0065007, GO:0050789
GO:0043950 [BP]positive regulation of cAMP-mediated signalingprobableGO:0043949, GO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0010627 [BP]regulation of intracellular protein kinase cascadeprobableGO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0051239 [BP]regulation of multicellular organismal processprobableGO:0008150, GO:0065007, GO:0050789
GO:0007224 [BP]smoothened signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0002805 [BP]regulation of antimicrobial peptide biosynthetic processprobableGO:0002831, GO:0050776, GO:0009889, GO:0019222, GO:0008150, GO:0031326, GO:0002784, GO:0031323, GO:0002759, GO:0048583, GO:0034248, GO:0065007, GO:0043900, GO:0002920, GO:0002682, GO:0051171, GO:0002700, GO:0002697, GO:0050794, GO:0050789
GO:0080134 [BP]regulation of response to stressprobableGO:0008150, GO:0065007, GO:0048583, GO:0050789
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0065008 [BP]regulation of biological qualityprobableGO:0008150, GO:0065007
GO:0009790 [BP]embryo developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0007275, GO:0044699
GO:0015630 [CC]microtubule cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0044425 [CC]membrane partprobableGO:0005575, GO:0016020
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0004697 [MF]protein kinase C activityprobableGO:0003824, GO:0016773, GO:0016772, GO:0016301, GO:0004674, GO:0016740, GO:0003674, GO:0004672
GO:0007474 [BP]imaginal disc-derived wing vein specificationprobableGO:0048563, GO:0048569, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007389, GO:0007472, GO:0007552, GO:0007476, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035114, GO:0008150, GO:0003002, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:1901700 [BP]response to oxygen-containing compoundprobableGO:0042221, GO:0050896, GO:0008150
GO:0044092 [BP]negative regulation of molecular functionprobableGO:0008150, GO:0065009, GO:0065007
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0008592 [BP]regulation of Toll signaling pathwayprobableGO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0003006 [BP]developmental process involved in reproductionprobableGO:0032502, GO:0022414, GO:0008150, GO:0000003
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0030154 [BP]cell differentiationprobableGO:0032502, GO:0048869, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0046777 [BP]protein autophosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0007296 [BP]vitellogenesisprobableGO:0044702, GO:0048610, GO:0000003, GO:0032504, GO:0007028, GO:0071840, GO:0009987, GO:0019953, GO:0016043, GO:0007292, GO:0022414, GO:0032501, GO:0044763, GO:0044699, GO:0022412, GO:0008150, GO:0007276, GO:0048609
GO:0044463 [CC]cell projection partprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0043066 [BP]negative regulation of apoptotic processprobableGO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0005543 [MF]phospholipid bindingprobableGO:0043168, GO:0043167, GO:0003674, GO:0008289, GO:0005488
GO:0004703 [MF]G-protein coupled receptor kinase activityprobableGO:0003824, GO:0016773, GO:0016772, GO:0016301, GO:0004674, GO:0016740, GO:0003674, GO:0004672
GO:0032101 [BP]regulation of response to external stimulusprobableGO:0008150, GO:0065007, GO:0048583, GO:0050789
GO:0071310 [BP]cellular response to organic substanceprobableGO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0044763, GO:0070887, GO:0042221, GO:0010033, GO:0044699
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0060255 [BP]regulation of macromolecule metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ACX, chain A
Confidence level:very confident
Coverage over the Query: 43-401,562-567,585-625
View the alignment between query and template
View the model in PyMOL
Template: 2ACX, chain A
Confidence level:very confident
Coverage over the Query: 479-546,648-756
View the alignment between query and template
View the model in PyMOL
Template: 4DC2, chain A
Confidence level:very confident
Coverage over the Query: 111-422
View the alignment between query and template
View the model in PyMOL
Template: 3NYN, chain A
Confidence level:very confident
Coverage over the Query: 7-401
View the alignment between query and template
View the model in PyMOL
Template: 3PVU, chain A
Confidence level:probable
Coverage over the Query: 4-406
View the alignment between query and template
View the model in PyMOL