Query         psy11901
Match_columns 100
No_of_seqs    101 out of 106
Neff          3.7 
Searched_HMMs 46136
Date          Fri Aug 16 21:52:08 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy11901.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/11901hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3476|consensus              100.0 2.5E-58 5.4E-63  320.5   3.0  100    1-100     1-100 (100)
  2 PF10235 Cript:  Microtubule-as 100.0 1.5E-49 3.3E-54  273.6   3.8   88   11-100     1-90  (90)
  3 PF10217 DUF2039:  Uncharacteri  94.8  0.0037 8.1E-08   43.6  -1.6   35   54-88     55-90  (92)
  4 COG5152 Uncharacterized conser  90.9   0.062 1.3E-06   43.2  -0.3   49   35-89    183-240 (259)
  5 PF12773 DZR:  Double zinc ribb  90.4    0.18 3.8E-06   29.8   1.5   33   57-90      1-40  (50)
  6 KOG3241|consensus               89.6    0.03 6.6E-07   44.2  -2.9   46   46-92     60-106 (227)
  7 PF13248 zf-ribbon_3:  zinc-rib  79.2    0.87 1.9E-05   24.3   0.6   22   55-77      3-24  (26)
  8 PRK14559 putative protein seri  78.2     1.2 2.6E-05   39.7   1.6   35   55-90      2-38  (645)
  9 PF14634 zf-RING_5:  zinc-RING   74.7    0.79 1.7E-05   26.6  -0.4   20   68-87     21-44  (44)
 10 PF13240 zinc_ribbon_2:  zinc-r  72.3     1.6 3.4E-05   23.1   0.4   20   56-76      1-20  (23)
 11 TIGR00570 cdk7 CDK-activating   68.3     2.1 4.6E-05   35.4   0.6   36   56-91      5-55  (309)
 12 PF13920 zf-C3HC4_3:  Zinc fing  63.7     1.5 3.3E-05   25.8  -0.8   25   68-92     21-50  (50)
 13 KOG1813|consensus               61.8     3.8 8.3E-05   34.2   0.9   36   56-91    243-287 (313)
 14 PRK12496 hypothetical protein;  54.1     5.7 0.00012   29.4   0.7   22   69-90    127-154 (164)
 15 KOG2272|consensus               51.4     9.3  0.0002   31.9   1.6   52   36-90    148-206 (332)
 16 smart00504 Ubox Modified RING   50.5     6.3 0.00014   23.4   0.4   23   68-90     20-46  (63)
 17 PF07191 zinc-ribbons_6:  zinc-  48.0     4.2 9.1E-05   27.2  -0.8   36   56-91      3-42  (70)
 18 PF14471 DUF4428:  Domain of un  45.8     9.9 0.00022   23.4   0.7   16   81-96      1-16  (51)
 19 TIGR00599 rad18 DNA repair pro  45.3     9.4  0.0002   32.5   0.7   36   55-90     27-71  (397)
 20 PF10571 UPF0547:  Uncharacteri  44.5      10 0.00022   20.6   0.6   22   56-78      2-23  (26)
 21 PF03660 PHF5:  PHF5-like prote  41.7     6.3 0.00014   28.4  -0.7   26   50-75     51-76  (106)
 22 cd00162 RING RING-finger (Real  40.9      12 0.00025   19.8   0.4   21   68-88     19-44  (45)
 23 PF01258 zf-dskA_traR:  Prokary  40.0      12 0.00026   20.9   0.4   12   80-91      4-15  (36)
 24 PF14446 Prok-RING_1:  Prokaryo  39.9      13 0.00029   23.6   0.7   14   77-90      3-16  (54)
 25 PF06906 DUF1272:  Protein of u  39.2      13 0.00028   24.2   0.5   36   55-90      6-52  (57)
 26 PF13894 zf-C2H2_4:  C2H2-type   39.0     7.7 0.00017   18.4  -0.4   15   81-95      2-16  (24)
 27 PRK11595 DNA utilization prote  37.9      17 0.00038   27.5   1.1   33   56-88      7-43  (227)
 28 PF10764 Gin:  Inhibitor of sig  37.8      21 0.00046   21.7   1.3   17    2-18     20-36  (46)
 29 PF13923 zf-C3HC4_2:  Zinc fing  37.1       5 0.00011   22.4  -1.5   10   68-77     18-27  (39)
 30 cd04476 RPA1_DBD_C RPA1_DBD_C:  35.2      14 0.00031   26.3   0.3   22   54-75     34-57  (166)
 31 KOG3799|consensus               34.6      18 0.00039   27.7   0.8   36   54-91     65-101 (169)
 32 KOG0320|consensus               33.1      11 0.00024   29.5  -0.6   37   55-91    132-179 (187)
 33 PLN03208 E3 ubiquitin-protein   33.0      15 0.00033   28.6   0.1   36   56-91     20-80  (193)
 34 TIGR02420 dksA RNA polymerase-  29.3      23 0.00049   24.3   0.5   11   80-90     81-91  (110)
 35 PF05715 zf-piccolo:  Piccolo Z  28.8      23  0.0005   23.3   0.4    8   81-88     32-39  (61)
 36 smart00746 TRASH metallochaper  26.8      30 0.00066   16.7   0.6    9   82-90      1-9   (39)
 37 PRK00420 hypothetical protein;  26.2      30 0.00065   24.7   0.7   22   54-75     23-46  (112)
 38 KOG4458|consensus               26.2      24 0.00052   23.9   0.2   33   44-83      4-36  (78)
 39 KOG1734|consensus               25.8      23 0.00049   29.8  -0.0   15   79-93    224-238 (328)
 40 PHA03096 p28-like protein; Pro  25.1      19 0.00042   29.2  -0.5   25   73-97    135-160 (284)
 41 PF11532 HnRNP_M:  Heterogeneou  24.4      29 0.00064   19.9   0.3    8   45-52     19-26  (30)
 42 COG1996 RPC10 DNA-directed RNA  24.4      29 0.00063   21.7   0.3   28   56-90      8-35  (49)
 43 PHA02929 N1R/p28-like protein;  23.9      34 0.00073   27.2   0.6   40   54-93    174-230 (238)
 44 PF09706 Cas_CXXC_CXXC:  CRISPR  23.8      41 0.00088   21.7   0.9   11   78-88      4-14  (69)
 45 PF10367 Vps39_2:  Vacuolar sor  23.6      39 0.00084   21.6   0.8   11   81-91     80-90  (109)
 46 PF10621 FpoO:  F420H2 dehydrog  23.4      36 0.00077   25.0   0.6   35   49-89     29-70  (119)
 47 PF11571 Med27:  Mediator compl  23.2      43 0.00093   22.3   1.0   20    2-21     56-76  (90)
 48 TIGR03826 YvyF flagellar opero  23.0      36 0.00077   25.0   0.6   24   52-77     79-102 (137)
 49 PHA02094 hypothetical protein   23.0      42  0.0009   22.9   0.9   11   13-23     65-75  (81)
 50 PHA02565 49 recombination endo  22.8      38 0.00083   25.8   0.7   14   77-90     18-31  (157)
 51 COG0266 Nei Formamidopyrimidin  22.0      42 0.00092   27.3   0.9   32   45-76    236-272 (273)
 52 TIGR00375 conserved hypothetic  22.0      42 0.00091   28.3   0.9   38   46-90    230-269 (374)
 53 PF10146 zf-C4H2:  Zinc finger-  21.4      50  0.0011   26.0   1.1   21   54-75    194-214 (230)
 54 PF10417 1-cysPrx_C:  C-termina  20.9      59  0.0013   18.9   1.1   12   12-23      9-20  (40)
 55 PF12874 zf-met:  Zinc-finger o  20.5      26 0.00055   17.4  -0.5   14   82-95      3-16  (25)
 56 PF02945 Endonuclease_7:  Recom  20.4      37 0.00081   22.7   0.2   14   77-90     20-33  (81)
 57 PRK06393 rpoE DNA-directed RNA  20.3      45 0.00098   21.9   0.6   22   54-88      5-26  (64)

No 1  
>KOG3476|consensus
Probab=100.00  E-value=2.5e-58  Score=320.50  Aligned_cols=100  Identities=68%  Similarity=1.234  Sum_probs=97.9

Q ss_pred             CcchHHHhhhcCccCCCCCCCCCcccccCCCeeccccchhhhhhhhcCCCcccCccchhhhhhhccCCCccCcccccccc
Q psy11901          1 MVCSKCEKKLGKVITPDNWKSGSRNTIESGGRRIGENKALTASKARFNPYTQKFESCKICRQKVHQVGSHYCQACAYKKG   80 (100)
Q Consensus         1 MVC~KCeKKL~kl~tPd~~k~gs~~~~~~g~rkv~eNKlLs~~k~r~~Py~~~~~~C~~CK~~v~q~g~~YCq~CAYkkG   80 (100)
                      |||++|||||++|++|||||+|+||++++|+|+|+|||.|.+.++||+||+..+.+|+|||+.|||+|+||||.|||+||
T Consensus         1 MVC~kCEkKLskvi~pd~wr~garn~~~sGgrkinenkaL~s~k~r~~p~gt~~~kC~iCk~~vHQ~GshYC~tCAY~Kg   80 (100)
T KOG3476|consen    1 MVCEKCEKKLSKVIGPDPWRDGARNTTESGGRKINENKALISKKKRATPYGTALAKCRICKQLVHQPGSHYCQTCAYKKG   80 (100)
T ss_pred             CchhHHHHHhccccccCcccccccccCCCCCeecchhhhhhhhhhhcCccccccchhHHHHHHhcCCcchhHhHhhhhhh
Confidence            99999999999999999999999999999999999999888889999999999999999999999999999999999999


Q ss_pred             cccccCcccccccccccccC
Q psy11901         81 ICAMCGKKLLDVKNYKQSAA  100 (100)
Q Consensus        81 iCamCGKki~dt~~ykqS~~  100 (100)
                      |||||||+|+||++|+||++
T Consensus        81 iCAMCGKki~nTK~ykQsst  100 (100)
T KOG3476|consen   81 ICAMCGKKILNTKNYKQSST  100 (100)
T ss_pred             HHHHhhhHhhccccccccCC
Confidence            99999999999999999986


No 2  
>PF10235 Cript:  Microtubule-associated protein CRIPT;  InterPro: IPR019367  The CRIPT protein is a cytoskeletal protein involved in microtubule production. This C-terminal domain is essential for binding to the PDZ3 domain of the SAP90 protein, one of a super-family of PDZ-containing proteins that play an important role in coupling the membrane ion channels with their signalling partners []. 
Probab=100.00  E-value=1.5e-49  Score=273.60  Aligned_cols=88  Identities=66%  Similarity=1.194  Sum_probs=84.0

Q ss_pred             cCccCCCCCCCCC--cccccCCCeeccccchhhhhhhhcCCCcccCccchhhhhhhccCCCccCcccccccccccccCcc
Q psy11901         11 GKVITPDNWKSGS--RNTIESGGRRIGENKALTASKARFNPYTQKFESCKICRQKVHQVGSHYCQACAYKKGICAMCGKK   88 (100)
Q Consensus        11 ~kl~tPd~~k~gs--~~~~~~g~rkv~eNKlLs~~k~r~~Py~~~~~~C~~CK~~v~q~g~~YCq~CAYkkGiCamCGKk   88 (100)
                      ++||||||||+|+  +++.++|+|+||||||||+. ++ |||++++++|+|||++|||+|+||||.|||++||||||||+
T Consensus         1 tklatPd~~k~~~~~~~~~~~g~r~i~eNKlLs~~-~~-nPy~~~~~~C~~CK~~v~q~g~~YCq~CAYkkGiCamCGKk   78 (90)
T PF10235_consen    1 TKLATPDPWKKGAMYRNTAESGGRKIGENKLLSKK-KK-NPYAPYSSKCKICKTKVHQPGAKYCQTCAYKKGICAMCGKK   78 (90)
T ss_pred             CccccCCccccCcccccccCCCCccccceeeeccc-cc-CcccccCccccccccccccCCCccChhhhcccCcccccCCe
Confidence            4799999999999  99999999999999999884 34 99999999999999999999999999999999999999999


Q ss_pred             cccccccccccC
Q psy11901         89 LLDVKNYKQSAA  100 (100)
Q Consensus        89 i~dt~~ykqS~~  100 (100)
                      |+||++|+||+|
T Consensus        79 i~dtk~ykqs~v   90 (90)
T PF10235_consen   79 ILDTKNYKQSSV   90 (90)
T ss_pred             ecccccccccCC
Confidence            999999999987


No 3  
>PF10217 DUF2039:  Uncharacterized conserved protein (DUF2039);  InterPro: IPR019351  This entry is a region of approximately 100 residues containing three pairs of cysteine residues. The region is conserved from plants to humans but its function is unknown. 
Probab=94.79  E-value=0.0037  Score=43.60  Aligned_cols=35  Identities=34%  Similarity=0.768  Sum_probs=31.0

Q ss_pred             Cccchhhhh-hhccCCCccCcccccccccccccCcc
Q psy11901         54 FESCKICRQ-KVHQVGSHYCQACAYKKGICAMCGKK   88 (100)
Q Consensus        54 ~~~C~~CK~-~v~q~g~~YCq~CAYkkGiCamCGKk   88 (100)
                      ..+|-.|.+ .|.+.=|..|+.||-..++||.||++
T Consensus        55 p~kC~~C~qktVk~AYh~iC~~Ca~~~~vCaKC~k~   90 (92)
T PF10217_consen   55 PKKCNKCQQKTVKHAYHVICDPCAKELKVCAKCGKP   90 (92)
T ss_pred             CccccccccchHHHHHHHHHHHHHHhhccCcccCCC
Confidence            579999997 66776788999999999999999986


No 4  
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=90.87  E-value=0.062  Score=43.15  Aligned_cols=49  Identities=33%  Similarity=0.876  Sum_probs=34.5

Q ss_pred             cccchhhhhhhhcCCCcccCccchhhhhhh-----ccCCCccCcccc---cccc-cccccCccc
Q psy11901         35 GENKALTASKARFNPYTQKFESCKICRQKV-----HQVGSHYCQACA---YKKG-ICAMCGKKL   89 (100)
Q Consensus        35 ~eNKlLs~~k~r~~Py~~~~~~C~~CK~~v-----~q~g~~YCq~CA---YkkG-iCamCGKki   89 (100)
                      .|.++++-. .-.-||     .|.|||...     ..-||++|..||   |++| .|-.||+..
T Consensus       183 Ee~~v~~~~-~e~IPF-----~C~iCKkdy~spvvt~CGH~FC~~Cai~~y~kg~~C~~Cgk~t  240 (259)
T COG5152         183 EEAPVISGP-GEKIPF-----LCGICKKDYESPVVTECGHSFCSLCAIRKYQKGDECGVCGKAT  240 (259)
T ss_pred             hhcccccCC-CCCCce-----eehhchhhccchhhhhcchhHHHHHHHHHhccCCcceecchhh
Confidence            345555432 233466     899999743     344999999999   6676 799999864


No 5  
>PF12773 DZR:  Double zinc ribbon
Probab=90.37  E-value=0.18  Score=29.76  Aligned_cols=33  Identities=24%  Similarity=0.673  Sum_probs=18.7

Q ss_pred             chhhhhhhccCCCccCcccccccc-------cccccCcccc
Q psy11901         57 CKICRQKVHQVGSHYCQACAYKKG-------ICAMCGKKLL   90 (100)
Q Consensus        57 C~~CK~~v~q~g~~YCq~CAYkkG-------iCamCGKki~   90 (100)
                      |..|.+.+.. ++.||..|-..-.       +|.-||..+.
T Consensus         1 Cp~Cg~~~~~-~~~fC~~CG~~l~~~~~~~~~C~~Cg~~~~   40 (50)
T PF12773_consen    1 CPHCGTPNPD-DAKFCPHCGTPLPPPDQSKKICPNCGAENP   40 (50)
T ss_pred             CCCcCCcCCc-cccCChhhcCChhhccCCCCCCcCCcCCCc
Confidence            4445555555 4566666655444       5666666654


No 6  
>KOG3241|consensus
Probab=89.60  E-value=0.03  Score=44.20  Aligned_cols=46  Identities=28%  Similarity=0.755  Sum_probs=37.4

Q ss_pred             hcCCCcccCccchhhhh-hhccCCCccCcccccccccccccCcccccc
Q psy11901         46 RFNPYTQKFESCKICRQ-KVHQVGSHYCQACAYKKGICAMCGKKLLDV   92 (100)
Q Consensus        46 r~~Py~~~~~~C~~CK~-~v~q~g~~YCq~CAYkkGiCamCGKki~dt   92 (100)
                      .|-|.+. ..+|..|+. .|.|.-|..|..||-...+||-|+|.+.++
T Consensus        60 KYKpLt~-akkC~kC~~r~Vk~aYH~~Cr~CA~e~~vCAKC~ks~~~i  106 (227)
T KOG3241|consen   60 KYKPLTE-AKKCQKCTKRNVKQAYHKLCRGCAKEQKVCAKCCKSVDQI  106 (227)
T ss_pred             cccccch-hHHHHHHHHHHHHHHHHHhcccHHHHHHHHHHHhccHHHh
Confidence            3555554 569999987 778888899999999999999999976543


No 7  
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=79.20  E-value=0.87  Score=24.32  Aligned_cols=22  Identities=18%  Similarity=0.694  Sum_probs=16.3

Q ss_pred             ccchhhhhhhccCCCccCccccc
Q psy11901         55 ESCKICRQKVHQVGSHYCQACAY   77 (100)
Q Consensus        55 ~~C~~CK~~v~q~g~~YCq~CAY   77 (100)
                      ..|..|...+.. ++.||..|-.
T Consensus         3 ~~Cp~Cg~~~~~-~~~fC~~CG~   24 (26)
T PF13248_consen    3 MFCPNCGAEIDP-DAKFCPNCGA   24 (26)
T ss_pred             CCCcccCCcCCc-ccccChhhCC
Confidence            478889886554 7888887743


No 8  
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=78.21  E-value=1.2  Score=39.67  Aligned_cols=35  Identities=23%  Similarity=0.651  Sum_probs=27.6

Q ss_pred             ccchhhhhhhccCCCccCccccccc--ccccccCcccc
Q psy11901         55 ESCKICRQKVHQVGSHYCQACAYKK--GICAMCGKKLL   90 (100)
Q Consensus        55 ~~C~~CK~~v~q~g~~YCq~CAYkk--GiCamCGKki~   90 (100)
                      ..|..|...+.. +++||+.|-.+-  ..|+-||..+.
T Consensus         2 ~~Cp~Cg~~n~~-~akFC~~CG~~l~~~~Cp~CG~~~~   38 (645)
T PRK14559          2 LICPQCQFENPN-NNRFCQKCGTSLTHKPCPQCGTEVP   38 (645)
T ss_pred             CcCCCCCCcCCC-CCccccccCCCCCCCcCCCCCCCCC
Confidence            368889888866 889999998774  36888888765


No 9  
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=74.65  E-value=0.79  Score=26.59  Aligned_cols=20  Identities=35%  Similarity=0.936  Sum_probs=16.5

Q ss_pred             CCccCcccccccc----cccccCc
Q psy11901         68 GSHYCQACAYKKG----ICAMCGK   87 (100)
Q Consensus        68 g~~YCq~CAYkkG----iCamCGK   87 (100)
                      ||.+|+.|+.+.-    .|..|++
T Consensus        21 gH~~C~~C~~~~~~~~~~CP~C~k   44 (44)
T PF14634_consen   21 GHIFCEKCLKKLKGKSVKCPICRK   44 (44)
T ss_pred             CCHHHHHHHHhhcCCCCCCcCCCC
Confidence            7889999988776    8888875


No 10 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=72.29  E-value=1.6  Score=23.07  Aligned_cols=20  Identities=20%  Similarity=0.866  Sum_probs=14.2

Q ss_pred             cchhhhhhhccCCCccCcccc
Q psy11901         56 SCKICRQKVHQVGSHYCQACA   76 (100)
Q Consensus        56 ~C~~CK~~v~q~g~~YCq~CA   76 (100)
                      .|..|...+.. ++.+|+.|-
T Consensus         1 ~Cp~CG~~~~~-~~~fC~~CG   20 (23)
T PF13240_consen    1 YCPNCGAEIED-DAKFCPNCG   20 (23)
T ss_pred             CCcccCCCCCC-cCcchhhhC
Confidence            37778888865 678776654


No 11 
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1. All proteins in this family for which functions are known are cyclin dependent protein kinases that are components of TFIIH, a complex that is involved in nucleotide excision repair and transcription initiation. Also known as MAT1 (menage a trois 1). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=68.34  E-value=2.1  Score=35.39  Aligned_cols=36  Identities=28%  Similarity=0.755  Sum_probs=25.3

Q ss_pred             cchhhhhh----------hccCCCccCcccccc-----cccccccCccccc
Q psy11901         56 SCKICRQK----------VHQVGSHYCQACAYK-----KGICAMCGKKLLD   91 (100)
Q Consensus        56 ~C~~CK~~----------v~q~g~~YCq~CAYk-----kGiCamCGKki~d   91 (100)
                      .|.+|++.          |+.=||.+|.+|.-.     .+.|+.|++.+..
T Consensus         5 ~CP~Ck~~~y~np~~kl~i~~CGH~~C~sCv~~l~~~~~~~CP~C~~~lrk   55 (309)
T TIGR00570         5 GCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGSGSCPECDTPLRK   55 (309)
T ss_pred             CCCcCCCCCccCcccccccCCCCCcccHHHHHHHhcCCCCCCCCCCCccch
Confidence            57777772          223489999999743     3489999987753


No 12 
>PF13920 zf-C3HC4_3:  Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A ....
Probab=63.73  E-value=1.5  Score=25.77  Aligned_cols=25  Identities=28%  Similarity=0.813  Sum_probs=19.0

Q ss_pred             CCc-cCccccccc----ccccccCcccccc
Q psy11901         68 GSH-YCQACAYKK----GICAMCGKKLLDV   92 (100)
Q Consensus        68 g~~-YCq~CAYkk----GiCamCGKki~dt   92 (100)
                      ||. +|..|+..-    ..|++|-..|.++
T Consensus        21 gH~~~C~~C~~~~~~~~~~CP~Cr~~i~~V   50 (50)
T PF13920_consen   21 GHLCFCEECAERLLKRKKKCPICRQPIESV   50 (50)
T ss_dssp             CEEEEEHHHHHHHHHTTSBBTTTTBB-SEE
T ss_pred             CChHHHHHHhHHhcccCCCCCcCChhhcCC
Confidence            566 788888766    8999999988754


No 13 
>KOG1813|consensus
Probab=61.78  E-value=3.8  Score=34.20  Aligned_cols=36  Identities=33%  Similarity=0.907  Sum_probs=29.2

Q ss_pred             cchhhhhhh-----ccCCCccCcccc---ccc-ccccccCccccc
Q psy11901         56 SCKICRQKV-----HQVGSHYCQACA---YKK-GICAMCGKKLLD   91 (100)
Q Consensus        56 ~C~~CK~~v-----~q~g~~YCq~CA---Ykk-GiCamCGKki~d   91 (100)
                      .|.||+...     ..-||++|-.||   |++ -.|-+|++++.-
T Consensus       243 ~c~icr~~f~~pVvt~c~h~fc~~ca~~~~qk~~~c~vC~~~t~g  287 (313)
T KOG1813|consen  243 KCFICRKYFYRPVVTKCGHYFCEVCALKPYQKGEKCYVCSQQTHG  287 (313)
T ss_pred             cccccccccccchhhcCCceeehhhhccccccCCcceeccccccc
Confidence            899999853     344899999999   677 589999998864


No 14 
>PRK12496 hypothetical protein; Provisional
Probab=54.08  E-value=5.7  Score=29.42  Aligned_cols=22  Identities=27%  Similarity=1.001  Sum_probs=16.7

Q ss_pred             CccCcccc--c----ccccccccCcccc
Q psy11901         69 SHYCQACA--Y----KKGICAMCGKKLL   90 (100)
Q Consensus        69 ~~YCq~CA--Y----kkGiCamCGKki~   90 (100)
                      .++|++|-  |    ....|.+||-++.
T Consensus       127 ~~~C~gC~~~~~~~~~~~~C~~CG~~~~  154 (164)
T PRK12496        127 RKVCKGCKKKYPEDYPDDVCEICGSPVK  154 (164)
T ss_pred             eEECCCCCccccCCCCCCcCCCCCChhh
Confidence            35688887  5    4467999998774


No 15 
>KOG2272|consensus
Probab=51.44  E-value=9.3  Score=31.90  Aligned_cols=52  Identities=31%  Similarity=0.709  Sum_probs=38.5

Q ss_pred             ccchhhhhhhhcCCCcccCccchhhhhhhcc-----CCCccCcccccccc--cccccCcccc
Q psy11901         36 ENKALTASKARFNPYTQKFESCKICRQKVHQ-----VGSHYCQACAYKKG--ICAMCGKKLL   90 (100)
Q Consensus        36 eNKlLs~~k~r~~Py~~~~~~C~~CK~~v~q-----~g~~YCq~CAYkkG--iCamCGKki~   90 (100)
                      .|-+|.-   |-|||-.|.-+|..|+.-+..     .|.-||..|--+-|  ||.-|-+.|-
T Consensus       148 D~~~l~f---r~d~yH~yHFkCt~C~keL~sdaRevk~eLyClrChD~mgipiCgaC~rpIe  206 (332)
T KOG2272|consen  148 DEQPLTF---RGDPYHPYHFKCTTCGKELTSDAREVKGELYCLRCHDKMGIPICGACRRPIE  206 (332)
T ss_pred             ccccccc---cCCCCCccceecccccccccchhhhhccceeccccccccCCcccccccCchH
Confidence            3477743   568888888899999987743     46789999987655  6766666664


No 16 
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=50.52  E-value=6.3  Score=23.35  Aligned_cols=23  Identities=22%  Similarity=0.353  Sum_probs=17.5

Q ss_pred             CCccCccccc----ccccccccCcccc
Q psy11901         68 GSHYCQACAY----KKGICAMCGKKLL   90 (100)
Q Consensus        68 g~~YCq~CAY----kkGiCamCGKki~   90 (100)
                      |+.||..|..    ..+.|.+||..+.
T Consensus        20 G~v~~~~~i~~~~~~~~~cP~~~~~~~   46 (63)
T smart00504       20 GQTYERRAIEKWLLSHGTDPVTGQPLT   46 (63)
T ss_pred             CCEEeHHHHHHHHHHCCCCCCCcCCCC
Confidence            7778877764    3578999998873


No 17 
>PF07191 zinc-ribbons_6:  zinc-ribbons;  InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length. Members of this family 8 highly conserved cysteine residues. The function of the family is unknown.; PDB: 2JRP_A 2JNE_A.
Probab=47.99  E-value=4.2  Score=27.18  Aligned_cols=36  Identities=33%  Similarity=0.778  Sum_probs=21.3

Q ss_pred             cchhhhhhhccCC-CccCcccc---cccccccccCccccc
Q psy11901         56 SCKICRQKVHQVG-SHYCQACA---YKKGICAMCGKKLLD   91 (100)
Q Consensus        56 ~C~~CK~~v~q~g-~~YCq~CA---YkkGiCamCGKki~d   91 (100)
                      .|..|.+.+...+ ..+|..|.   -+.+.|+-||..+--
T Consensus         3 ~CP~C~~~L~~~~~~~~C~~C~~~~~~~a~CPdC~~~Le~   42 (70)
T PF07191_consen    3 TCPKCQQELEWQGGHYHCEACQKDYKKEAFCPDCGQPLEV   42 (70)
T ss_dssp             B-SSS-SBEEEETTEEEETTT--EEEEEEE-TTT-SB-EE
T ss_pred             cCCCCCCccEEeCCEEECccccccceecccCCCcccHHHH
Confidence            6888888885555 66777776   356788888887753


No 18 
>PF14471 DUF4428:  Domain of unknown function (DUF4428)
Probab=45.75  E-value=9.9  Score=23.39  Aligned_cols=16  Identities=50%  Similarity=0.939  Sum_probs=11.3

Q ss_pred             cccccCcccccccccc
Q psy11901         81 ICAMCGKKLLDVKNYK   96 (100)
Q Consensus        81 iCamCGKki~dt~~yk   96 (100)
                      +|++||++|--.+.++
T Consensus         1 ~C~iCg~kigl~~~~k   16 (51)
T PF14471_consen    1 KCAICGKKIGLFKRFK   16 (51)
T ss_pred             CCCcccccccccccee
Confidence            5899999886555433


No 19 
>TIGR00599 rad18 DNA repair protein rad18. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=45.31  E-value=9.4  Score=32.48  Aligned_cols=36  Identities=19%  Similarity=0.606  Sum_probs=27.4

Q ss_pred             ccchhhhhhhccC-----CCccCccccc----ccccccccCcccc
Q psy11901         55 ESCKICRQKVHQV-----GSHYCQACAY----KKGICAMCGKKLL   90 (100)
Q Consensus        55 ~~C~~CK~~v~q~-----g~~YCq~CAY----kkGiCamCGKki~   90 (100)
                      -.|.||...+..+     ||.||..|..    ..+.|.+|...+.
T Consensus        27 l~C~IC~d~~~~PvitpCgH~FCs~CI~~~l~~~~~CP~Cr~~~~   71 (397)
T TIGR00599        27 LRCHICKDFFDVPVLTSCSHTFCSLCIRRCLSNQPKCPLCRAEDQ   71 (397)
T ss_pred             cCCCcCchhhhCccCCCCCCchhHHHHHHHHhCCCCCCCCCCccc
Confidence            3788887655433     9999999986    3468999998765


No 20 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=44.50  E-value=10  Score=20.58  Aligned_cols=22  Identities=27%  Similarity=0.957  Sum_probs=16.4

Q ss_pred             cchhhhhhhccCCCccCcccccc
Q psy11901         56 SCKICRQKVHQVGSHYCQACAYK   78 (100)
Q Consensus        56 ~C~~CK~~v~q~g~~YCq~CAYk   78 (100)
                      .|..|.+.|.. .++.|..|-|.
T Consensus         2 ~CP~C~~~V~~-~~~~Cp~CG~~   23 (26)
T PF10571_consen    2 TCPECGAEVPE-SAKFCPHCGYD   23 (26)
T ss_pred             cCCCCcCCchh-hcCcCCCCCCC
Confidence            58888888876 57777777653


No 21 
>PF03660 PHF5:  PHF5-like protein;  InterPro: IPR005345 Phf5 is a member of a novel murine multigene family that is highly conserved during evolution and belongs to the superfamily of PHD-finger proteins. At least one example, from Mus musculus (Mouse), may act as a chromatin-associated protein []. The Schizosaccharomyces pombe (Fission yeast) ini1 gene is essential, required for splicing []. It is localised in the nucleus, but not detected in the nucleolus and can be complemented by human ini1 []. The proteins of this family contain five CXXC motifs.; PDB: 2K0A_A.
Probab=41.66  E-value=6.3  Score=28.38  Aligned_cols=26  Identities=23%  Similarity=0.551  Sum_probs=14.3

Q ss_pred             CcccCccchhhhhhhccCCCccCccc
Q psy11901         50 YTQKFESCKICRQKVHQVGSHYCQAC   75 (100)
Q Consensus        50 y~~~~~~C~~CK~~v~q~g~~YCq~C   75 (100)
                      |+.+..+|.||........+.||..|
T Consensus        51 ~G~~~~rCIiCg~~~g~sdAYYC~eC   76 (106)
T PF03660_consen   51 FGSLQGRCIICGSGPGVSDAYYCWEC   76 (106)
T ss_dssp             TSSTTSB-TTTSSSB--EE-EE-HHH
T ss_pred             CCCcCceEEEecCCCCcccceehhhh
Confidence            33445789999854433468899888


No 22 
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)
Probab=40.91  E-value=12  Score=19.76  Aligned_cols=21  Identities=29%  Similarity=0.920  Sum_probs=13.9

Q ss_pred             CCccCccccc-----ccccccccCcc
Q psy11901         68 GSHYCQACAY-----KKGICAMCGKK   88 (100)
Q Consensus        68 g~~YCq~CAY-----kkGiCamCGKk   88 (100)
                      ||.||..|..     ....|.+|...
T Consensus        19 ~H~~c~~C~~~~~~~~~~~Cp~C~~~   44 (45)
T cd00162          19 GHVFCRSCIDKWLKSGKNTCPLCRTP   44 (45)
T ss_pred             CChhcHHHHHHHHHhCcCCCCCCCCc
Confidence            6677777763     24568888764


No 23 
>PF01258 zf-dskA_traR:  Prokaryotic dksA/traR C4-type zinc finger;  InterPro: IPR000962 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents domains identified in zinc finger-containing members of the DksA/TraR family. DksA is a critical component of the rRNA transcription initiation machinery that potentiates the regulation of rRNA promoters by ppGpp and the initiating NTP. In delta-dksA mutants, rRNA promoters are unresponsive to changes in amino acid availability, growth rate, or growth phase. In vitro, DksA binds to RNAP, reduces open complex lifetime, inhibits rRNA promoter activity, and amplifies effects of ppGpp and the initiating NTP on rRNA transcription [, ]. The dksA gene product suppresses the temperature-sensitive growth and filamentation of a dnaK deletion mutant of Escherichia coli. Gene knockout [] and deletion [] experiments have shown the gene to be non-essential, mutations causing a mild sensitivity to UV light, but not affecting DNA recombination []. In Pseudomonas aeruginosa, dksA is a novel regulator involved in the post-transcriptional control of extracellular virulence factor production [].  The proteins contain a C-terminal region thought to fold into a 4-cysteine zinc finger. Other proteins found to contain a similar zinc finger domain include:  the traR gene products encoded on the E. coli F and R100 plasmids [, ]  the traR gene products encoded on Salmonella spp. plasmids pED208 and pSLT  the dnaK suppressor  hypothetical proteins from bacteria and bacteriophage  FHL4, LIM proteins from Homo sapiens (Human) and Mus musculus (Mouse) []  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2GVI_A 2KQ9_A 2KGO_A 1TJL_I.
Probab=39.96  E-value=12  Score=20.95  Aligned_cols=12  Identities=42%  Similarity=1.137  Sum_probs=9.1

Q ss_pred             ccccccCccccc
Q psy11901         80 GICAMCGKKLLD   91 (100)
Q Consensus        80 GiCamCGKki~d   91 (100)
                      |+|..||..|.+
T Consensus         4 g~C~~CGe~I~~   15 (36)
T PF01258_consen    4 GICEDCGEPIPE   15 (36)
T ss_dssp             SB-TTTSSBEEH
T ss_pred             CCccccCChHHH
Confidence            679999998874


No 24 
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=39.87  E-value=13  Score=23.64  Aligned_cols=14  Identities=43%  Similarity=0.990  Sum_probs=10.7

Q ss_pred             cccccccccCcccc
Q psy11901         77 YKKGICAMCGKKLL   90 (100)
Q Consensus        77 YkkGiCamCGKki~   90 (100)
                      |...+|..||+++.
T Consensus         3 ~~~~~C~~Cg~~~~   16 (54)
T PF14446_consen    3 YEGCKCPVCGKKFK   16 (54)
T ss_pred             ccCccChhhCCccc
Confidence            56678888888885


No 25 
>PF06906 DUF1272:  Protein of unknown function (DUF1272);  InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length. This family contains a number of conserved cysteine residues and its function is unknown.
Probab=39.20  E-value=13  Score=24.17  Aligned_cols=36  Identities=28%  Similarity=0.854  Sum_probs=25.9

Q ss_pred             ccchhhhhhhccCC---------CccCccccccc--ccccccCcccc
Q psy11901         55 ESCKICRQKVHQVG---------SHYCQACAYKK--GICAMCGKKLL   90 (100)
Q Consensus        55 ~~C~~CK~~v~q~g---------~~YCq~CAYkk--GiCamCGKki~   90 (100)
                      ..|..|.+.+.++.         -.||..||-..  ++|.-||=-+.
T Consensus         6 pnCE~C~~dLp~~s~~A~ICSfECTFC~~C~e~~l~~~CPNCgGelv   52 (57)
T PF06906_consen    6 PNCECCDKDLPPDSPEAYICSFECTFCADCAETMLNGVCPNCGGELV   52 (57)
T ss_pred             CCccccCCCCCCCCCcceEEeEeCcccHHHHHHHhcCcCcCCCCccc
Confidence            36777877777643         25788888665  99999996543


No 26 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=39.03  E-value=7.7  Score=18.37  Aligned_cols=15  Identities=27%  Similarity=0.742  Sum_probs=8.3

Q ss_pred             cccccCccccccccc
Q psy11901         81 ICAMCGKKLLDVKNY   95 (100)
Q Consensus        81 iCamCGKki~dt~~y   95 (100)
                      .|.+||+...+-..+
T Consensus         2 ~C~~C~~~~~~~~~l   16 (24)
T PF13894_consen    2 QCPICGKSFRSKSEL   16 (24)
T ss_dssp             E-SSTS-EESSHHHH
T ss_pred             CCcCCCCcCCcHHHH
Confidence            477888877655444


No 27 
>PRK11595 DNA utilization protein GntX; Provisional
Probab=37.94  E-value=17  Score=27.49  Aligned_cols=33  Identities=27%  Similarity=0.650  Sum_probs=14.4

Q ss_pred             cchhhhhhhccCCCccCcccccc----cccccccCcc
Q psy11901         56 SCKICRQKVHQVGSHYCQACAYK----KGICAMCGKK   88 (100)
Q Consensus        56 ~C~~CK~~v~q~g~~YCq~CAYk----kGiCamCGKk   88 (100)
                      .|-.|...++......|..|.-.    ...|..||+.
T Consensus         7 ~C~~C~~~~~~~~~~lC~~C~~~l~~~~~~C~~Cg~~   43 (227)
T PRK11595          7 LCWLCRMPLALSHWGICSVCSRALRTLKTCCPQCGLP   43 (227)
T ss_pred             cCccCCCccCCCCCcccHHHHhhCCcccCcCccCCCc
Confidence            45555554433222345555311    2345555554


No 28 
>PF10764 Gin:  Inhibitor of sigma-G Gin;  InterPro: IPR019700  Gin allows sigma-F to delay late forespore transcription by preventing sigma-G to take over before the cell has reached a critical stage of development. Gin is also known as CsfB []. 
Probab=37.83  E-value=21  Score=21.68  Aligned_cols=17  Identities=41%  Similarity=0.784  Sum_probs=14.4

Q ss_pred             cchHHHhhhcCccCCCC
Q psy11901          2 VCSKCEKKLGKVITPDN   18 (100)
Q Consensus         2 VC~KCeKKL~kl~tPd~   18 (100)
                      .|..||++|-.+-+-||
T Consensus        20 IC~~CE~~iv~~~~~d~   36 (46)
T PF10764_consen   20 ICSDCEKEIVNTETDDP   36 (46)
T ss_pred             ehHHHHHHhccCCCCCC
Confidence            59999999998877776


No 29 
>PF13923 zf-C3HC4_2:  Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A.
Probab=37.15  E-value=5  Score=22.41  Aligned_cols=10  Identities=30%  Similarity=1.075  Sum_probs=6.4

Q ss_pred             CCccCccccc
Q psy11901         68 GSHYCQACAY   77 (100)
Q Consensus        68 g~~YCq~CAY   77 (100)
                      ||.||..|+.
T Consensus        18 GH~fC~~C~~   27 (39)
T PF13923_consen   18 GHSFCKECIE   27 (39)
T ss_dssp             SEEEEHHHHH
T ss_pred             CCchhHHHHH
Confidence            6666766654


No 30 
>cd04476 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds corresponding to the C-terminal OB fold, the ssDNA-binding domain (DBD)-C, of human RPA1 (also called RPA70). RPA1 is the large subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). In addition to DBD-C, RPA1 contains three other OB folds: DBD-A, DBD-B, and RPA1N. The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B. RPA1 DBD-C is involved in DNA binding and trimerization. It contains two structural insertions not found to date in other OB-folds: a zinc ribbon and a three-helix bundle. RPA1 DBD-C also contains a Cys4-type zinc-binding motif, which plays a role in the ssDNA binding fun
Probab=35.17  E-value=14  Score=26.28  Aligned_cols=22  Identities=32%  Similarity=0.881  Sum_probs=15.3

Q ss_pred             CccchhhhhhhccCC--CccCccc
Q psy11901         54 FESCKICRQKVHQVG--SHYCQAC   75 (100)
Q Consensus        54 ~~~C~~CK~~v~q~g--~~YCq~C   75 (100)
                      -..|..|+.+|.+.+  .-+|..|
T Consensus        34 Y~aC~~C~kkv~~~~~~~~~C~~C   57 (166)
T cd04476          34 YPACPGCNKKVVEEGNGTYRCEKC   57 (166)
T ss_pred             EccccccCcccEeCCCCcEECCCC
Confidence            359999999998753  3444443


No 31 
>KOG3799|consensus
Probab=34.63  E-value=18  Score=27.69  Aligned_cols=36  Identities=31%  Similarity=0.725  Sum_probs=24.3

Q ss_pred             Cccchhhhh-hhccCCCccCcccccccccccccCccccc
Q psy11901         54 FESCKICRQ-KVHQVGSHYCQACAYKKGICAMCGKKLLD   91 (100)
Q Consensus        54 ~~~C~~CK~-~v~q~g~~YCq~CAYkkGiCamCGKki~d   91 (100)
                      -..|-||-. +...--+|-|..|-.+  .||.||=++.-
T Consensus        65 datC~IC~KTKFADG~GH~C~YCq~r--~CARCGGrv~l  101 (169)
T KOG3799|consen   65 DATCGICHKTKFADGCGHNCSYCQTR--FCARCGGRVSL  101 (169)
T ss_pred             CcchhhhhhcccccccCcccchhhhh--HHHhcCCeeee
Confidence            468999954 5544334666666544  79999977653


No 32 
>KOG0320|consensus
Probab=33.14  E-value=11  Score=29.46  Aligned_cols=37  Identities=32%  Similarity=0.818  Sum_probs=27.4

Q ss_pred             ccchhhhhhhcc-------CCCccCcccc---cc-cccccccCccccc
Q psy11901         55 ESCKICRQKVHQ-------VGSHYCQACA---YK-KGICAMCGKKLLD   91 (100)
Q Consensus        55 ~~C~~CK~~v~q-------~g~~YCq~CA---Yk-kGiCamCGKki~d   91 (100)
                      -+|.||--.+.+       =||-||..|+   .+ -..|..|+|+|..
T Consensus       132 ~~CPiCl~~~sek~~vsTkCGHvFC~~Cik~alk~~~~CP~C~kkIt~  179 (187)
T KOG0320|consen  132 YKCPICLDSVSEKVPVSTKCGHVFCSQCIKDALKNTNKCPTCRKKITH  179 (187)
T ss_pred             cCCCceecchhhccccccccchhHHHHHHHHHHHhCCCCCCcccccch
Confidence            589999655432       3789999997   33 3489999998863


No 33 
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional
Probab=33.04  E-value=15  Score=28.58  Aligned_cols=36  Identities=28%  Similarity=0.799  Sum_probs=27.1

Q ss_pred             cchhhhhhhcc-----CCCccCcccccc--------------------cccccccCccccc
Q psy11901         56 SCKICRQKVHQ-----VGSHYCQACAYK--------------------KGICAMCGKKLLD   91 (100)
Q Consensus        56 ~C~~CK~~v~q-----~g~~YCq~CAYk--------------------kGiCamCGKki~d   91 (100)
                      .|.||...+..     =||.||..|.++                    ...|.+|...|..
T Consensus        20 ~CpICld~~~dPVvT~CGH~FC~~CI~~wl~~s~~s~~~~~~~~~~k~~~~CPvCR~~Is~   80 (193)
T PLN03208         20 DCNICLDQVRDPVVTLCGHLFCWPCIHKWTYASNNSRQRVDQYDHKREPPKCPVCKSDVSE   80 (193)
T ss_pred             CCccCCCcCCCcEEcCCCchhHHHHHHHHHHhccccccccccccccCCCCcCCCCCCcCCh
Confidence            78888664432     389999999963                    2479999998864


No 34 
>TIGR02420 dksA RNA polymerase-binding protein DksA. The model that is the basis for this family describes a small, pleiotropic protein, DksA (DnaK suppressor A), originally named as a multicopy suppressor of temperature sensitivity of dnaKJ mutants. DksA mutants are defective in quorum sensing, virulence, etc. DksA is now understood to bind RNA polymerase directly and modulate its response to small molecules to control the level of transcription of rRNA. Nearly all members of this family are in the Proteobacteria. Whether the closest homologs outside the Proteobacteria function equivalently is unknown. The low value set for the noise cutoff allows identification of possible DksA proteins from outside the proteobacteria. TIGR02419 describes a closely related family of short sequences usually found in prophage regions of proteobacterial genomes or in known phage.
Probab=29.27  E-value=23  Score=24.29  Aligned_cols=11  Identities=36%  Similarity=1.038  Sum_probs=9.0

Q ss_pred             ccccccCcccc
Q psy11901         80 GICAMCGKKLL   90 (100)
Q Consensus        80 GiCamCGKki~   90 (100)
                      |+|-.||..|-
T Consensus        81 G~C~~Cge~I~   91 (110)
T TIGR02420        81 GYCEECGEEIG   91 (110)
T ss_pred             CchhccCCccc
Confidence            68999998874


No 35 
>PF05715 zf-piccolo:  Piccolo Zn-finger;  InterPro: IPR008899 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This (predicted) zinc finger is found in the bassoon and piccolo proteins, both of which are components of the presynaptic cytoskeletal matrix (PCM) assembled at the active zone of neurotransmitter release, where Piccolo plays a role in the trafficking of synaptic vesicles (SVs) [, , ]. The Piccolo zinc fingers were found to interact with the dual prenylated rab3A and VAMP2/Synaptobrevin II receptor PRA1. There are eight conserved cysteines in Piccolo-type zinc fingers, suggesting that they coordinates two zinc ligands. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding, 0045202 synapse
Probab=28.76  E-value=23  Score=23.30  Aligned_cols=8  Identities=38%  Similarity=1.360  Sum_probs=5.0

Q ss_pred             cccccCcc
Q psy11901         81 ICAMCGKK   88 (100)
Q Consensus        81 iCamCGKk   88 (100)
                      +|.+||-.
T Consensus        32 VCnlCGFN   39 (61)
T PF05715_consen   32 VCNLCGFN   39 (61)
T ss_pred             hhcccCCC
Confidence            56677743


No 36 
>smart00746 TRASH metallochaperone-like domain.
Probab=26.79  E-value=30  Score=16.68  Aligned_cols=9  Identities=44%  Similarity=1.435  Sum_probs=7.6

Q ss_pred             ccccCcccc
Q psy11901         82 CAMCGKKLL   90 (100)
Q Consensus        82 CamCGKki~   90 (100)
                      |+.||..|.
T Consensus         1 c~~C~~~~~    9 (39)
T smart00746        1 CSFCGKDIY    9 (39)
T ss_pred             CCCCCCCcc
Confidence            788999886


No 37 
>PRK00420 hypothetical protein; Validated
Probab=26.22  E-value=30  Score=24.73  Aligned_cols=22  Identities=18%  Similarity=0.528  Sum_probs=15.6

Q ss_pred             Cccchhhhhhhcc--CCCccCccc
Q psy11901         54 FESCKICRQKVHQ--VGSHYCQAC   75 (100)
Q Consensus        54 ~~~C~~CK~~v~q--~g~~YCq~C   75 (100)
                      ...|..|...+-.  .|..||+.|
T Consensus        23 ~~~CP~Cg~pLf~lk~g~~~Cp~C   46 (112)
T PRK00420         23 SKHCPVCGLPLFELKDGEVVCPVH   46 (112)
T ss_pred             cCCCCCCCCcceecCCCceECCCC
Confidence            4689999997753  466666654


No 38 
>KOG4458|consensus
Probab=26.16  E-value=24  Score=23.94  Aligned_cols=33  Identities=30%  Similarity=0.634  Sum_probs=21.8

Q ss_pred             hhhcCCCcccCccchhhhhhhccCCCccCccccccccccc
Q psy11901         44 KARFNPYTQKFESCKICRQKVHQVGSHYCQACAYKKGICA   83 (100)
Q Consensus        44 k~r~~Py~~~~~~C~~CK~~v~q~g~~YCq~CAYkkGiCa   83 (100)
                      |.+++||.-...-=-.|+-.+|...       ||+.|||-
T Consensus         4 k~k~~pydii~dd~~d~riplhne~-------a~qhgi~f   36 (78)
T KOG4458|consen    4 KKKHGPYDIIADDGHDCRIPLHNED-------AFQHGICF   36 (78)
T ss_pred             ccccCCcceeecccccceeeccchh-------hhhccceE
Confidence            3567888732222335666888755       99999984


No 39 
>KOG1734|consensus
Probab=25.83  E-value=23  Score=29.79  Aligned_cols=15  Identities=27%  Similarity=0.751  Sum_probs=12.2

Q ss_pred             cccccccCccccccc
Q psy11901         79 KGICAMCGKKLLDVK   93 (100)
Q Consensus        79 kGiCamCGKki~dt~   93 (100)
                      .++||.||++|.++-
T Consensus       224 d~vCaVCg~~~~~s~  238 (328)
T KOG1734|consen  224 DSVCAVCGQQIDVSV  238 (328)
T ss_pred             cchhHhhcchheeec
Confidence            459999999998653


No 40 
>PHA03096 p28-like protein; Provisional
Probab=25.06  E-value=19  Score=29.20  Aligned_cols=25  Identities=44%  Similarity=0.897  Sum_probs=19.4

Q ss_pred             cccccccc-cccccCccccccccccc
Q psy11901         73 QACAYKKG-ICAMCGKKLLDVKNYKQ   97 (100)
Q Consensus        73 q~CAYkkG-iCamCGKki~dt~~ykq   97 (100)
                      ..|.|-.| +|.|||+..++...+.|
T Consensus       135 ~~c~~lHg~lC~~C~k~~Lhp~d~eq  160 (284)
T PHA03096        135 KYCEYLHGDICDICEKYLLHPTDIKQ  160 (284)
T ss_pred             cCcHHHHHHHHHhhcchhcCCcCHHH
Confidence            45667666 69999999998877655


No 41 
>PF11532 HnRNP_M:  Heterogeneous nuclear ribonucleoprotein M;  InterPro: IPR024666 Heterogeneous nuclear ribonucleoproteins (hnRNPs) bind directly to nascent RNA polymerase II transcripts and play an important role in both transcript-specific packaging and alternative splicing of pre-mRNAs []. hnRNP M proteins are an abundant group of hnRNPs that have been shown to bind avidly to poly(G) and poly(U) RNA homopolymers []. hnRNP M family members are able to induce exon skipping and promote exon inclusion, suggesting that the proteins may broadly contribute to the fidelity of splice site recognition and alternative splicing regulation []. This entry represents the N-terminal PY nuclear localisation signal of heterogeneous nuclear ribonucleoprotein M [].; PDB: 2OT8_C.
Probab=24.40  E-value=29  Score=19.91  Aligned_cols=8  Identities=50%  Similarity=1.207  Sum_probs=2.0

Q ss_pred             hhcCCCcc
Q psy11901         45 ARFNPYTQ   52 (100)
Q Consensus        45 ~r~~Py~~   52 (100)
                      +||.||++
T Consensus        19 ~rfEPY~N   26 (30)
T PF11532_consen   19 NRFEPYAN   26 (30)
T ss_dssp             ----SS--
T ss_pred             cccccccC
Confidence            79999985


No 42 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=24.36  E-value=29  Score=21.69  Aligned_cols=28  Identities=25%  Similarity=0.624  Sum_probs=17.4

Q ss_pred             cchhhhhhhccCCCccCcccccccccccccCcccc
Q psy11901         56 SCKICRQKVHQVGSHYCQACAYKKGICAMCGKKLL   90 (100)
Q Consensus        56 ~C~~CK~~v~q~g~~YCq~CAYkkGiCamCGKki~   90 (100)
                      +|..|...+....       ++.--.|.-||-+|+
T Consensus         8 ~C~~Cg~~~~~~~-------~~~~irCp~Cg~rIl   35 (49)
T COG1996           8 KCARCGREVELDQ-------ETRGIRCPYCGSRIL   35 (49)
T ss_pred             EhhhcCCeeehhh-------ccCceeCCCCCcEEE
Confidence            6888888776433       444455666666655


No 43 
>PHA02929 N1R/p28-like protein; Provisional
Probab=23.85  E-value=34  Score=27.22  Aligned_cols=40  Identities=28%  Similarity=0.697  Sum_probs=29.8

Q ss_pred             Cccchhhhhhhc-------------cCCCccCccccc----ccccccccCccccccc
Q psy11901         54 FESCKICRQKVH-------------QVGSHYCQACAY----KKGICAMCGKKLLDVK   93 (100)
Q Consensus        54 ~~~C~~CK~~v~-------------q~g~~YCq~CAY----kkGiCamCGKki~dt~   93 (100)
                      ...|.||-..+.             .=+|.||..|--    .+..|+||-..+.-+.
T Consensus       174 ~~eC~ICle~~~~~~~~~~~~~vl~~C~H~FC~~CI~~Wl~~~~tCPlCR~~~~~v~  230 (238)
T PHA02929        174 DKECAICMEKVYDKEIKNMYFGILSNCNHVFCIECIDIWKKEKNTCPVCRTPFISVI  230 (238)
T ss_pred             CCCCccCCcccccCccccccceecCCCCCcccHHHHHHHHhcCCCCCCCCCEeeEEe
Confidence            368999987643             237889999972    5678999998877543


No 44 
>PF09706 Cas_CXXC_CXXC:  CRISPR-associated protein (Cas_CXXC_CXXC);  InterPro: IPR019121 Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) are a family of DNA direct repeats separated by regularly sized non-repetitive spacer sequences that are found in most bacterial and archaeal genomes []. CRISPRs appear to provide acquired resistance against bacteriophages, possibly acting with an RNA interference-like mechanism to inhibit gene functions of invasive DNA elements [, ]. Differences in the number and type of spacers between CRISPR repeats correlate with phage sensitivity. It is thought that following phage infection, bacteria integrate new spacers derived from phage genomic sequences, and that the removal or addition of particular spacers modifies the phage-resistance phenotype of the cell. Therefore, the specificity of CRISPRs may be determined by spacer-phage sequence similarity. In addition, there are many protein families known as CRISPR-associated sequences (Cas), which are encoded in the vicinity of CRISPR loci []. CRISPR/cas gene regions can be quite large, with up to 20 different, tandem-arranged cas genes next to a CRISPR cluster or filling the region between two repeat clusters. Cas genes and CRISPRs are found on mobile genetic elements such as plasmids, and have undergone extensive horizontal transfer. Cas proteins are thought to be involved in the propagation and functioning of CRISPRs. Some Cas proteins show similarity to helicases and repair proteins, although the functions of most are unknown. Cas families can be divided into subtypes according to operon organisation and phylogeny.  This entry represents a conserved domain of about 65 amino acids found in otherwise highly divergent proteins encoded in CRISPR-associated regions. This domain features two CXXC motifs. 
Probab=23.78  E-value=41  Score=21.68  Aligned_cols=11  Identities=45%  Similarity=1.026  Sum_probs=8.3

Q ss_pred             ccccccccCcc
Q psy11901         78 KKGICAMCGKK   88 (100)
Q Consensus        78 kkGiCamCGKk   88 (100)
                      .+++|..||..
T Consensus         4 ~~~~C~~Cg~r   14 (69)
T PF09706_consen    4 KKYNCIFCGER   14 (69)
T ss_pred             CCCcCcCCCCc
Confidence            46789999944


No 45 
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=23.57  E-value=39  Score=21.62  Aligned_cols=11  Identities=45%  Similarity=1.047  Sum_probs=7.8

Q ss_pred             cccccCccccc
Q psy11901         81 ICAMCGKKLLD   91 (100)
Q Consensus        81 iCamCGKki~d   91 (100)
                      .|+.||++|.+
T Consensus        80 ~C~vC~k~l~~   90 (109)
T PF10367_consen   80 KCSVCGKPLGN   90 (109)
T ss_pred             CccCcCCcCCC
Confidence            57777777765


No 46 
>PF10621 FpoO:  F420H2 dehydrogenase subunit FpoO ;  InterPro: IPR018288 This entry represents the FpoO subunit of membrane-bound multi-subunit F420H2 dehydrogenase, which oxidises the reduced coenzyme F420H2 to coenzyme F420 and feeds the electrons via an FeS cluster into an energy-conserving electron transport chain [, ]. This enzyme plays a role in the methanogenic pathway in methanogenic archaea. Reduced coenzyme F420H2 is the major cytoplasmic electron carrier of methanogens and a reversible hydride donor, much like NADH []. F420H2 + COB-S-S-CoM = F420 + CoM-SH + CoB-SH  Where CoB-S-S-CoM (the heterosulphide of 2-mercaptoethanesulphonate and 7-mercaptoheptanoylthreonine phosphate) is the terminal electron acceptor of the methanogenic pathway, and is reduced with the concomitant generation of a transmembrane proton potential and ATP synthesis.  The FpoO subunit of F420H2 dehydrogenase probably participates in the reduction of methanophenazine, where it acts as a special mechanism for the reduction of the methanogenic cofactor []. 
Probab=23.35  E-value=36  Score=24.99  Aligned_cols=35  Identities=29%  Similarity=0.612  Sum_probs=22.4

Q ss_pred             CCcccCccchhhhhh-------hccCCCccCcccccccccccccCccc
Q psy11901         49 PYTQKFESCKICRQK-------VHQVGSHYCQACAYKKGICAMCGKKL   89 (100)
Q Consensus        49 Py~~~~~~C~~CK~~-------v~q~g~~YCq~CAYkkGiCamCGKki   89 (100)
                      |-|.+..-|.+|-..       +.++ ..     +-..|.|.|||++-
T Consensus        29 PeGvwKGLC~~CL~sa~~ty~e~~~~-~~-----s~~~gKC~LCG~kt   70 (119)
T PF10621_consen   29 PEGVWKGLCETCLDSAEKTYQEVNEN-ES-----SCRSGKCDLCGKKT   70 (119)
T ss_pred             cchHHHhhHHHHHHHHHHHHHHHhcc-cc-----cccccceeccCCcc
Confidence            666666677777532       3332 22     22789999999874


No 47 
>PF11571 Med27:  Mediator complex subunit 27;  InterPro: IPR021627  Mediator is a large complex of up to 33 proteins that is conserved from plants to fungi to humans - the number and representation of individual subunits varying with species. It is arranged into four different sections, a core, a head, a tail and a kinase-activity part, and the number of subunits within each of these is what varies with species. Overall, Mediator regulates the transcriptional activity of RNA polymerase II but it would appear that each of the four different sections has a slightly different function []. Mediator exists in two major forms in human cells: a smaller form that interacts strongly with pol II and activates transcription, and a large form that does not interact strongly with pol II and does not directly activate transcription. The ubiquitous expression of Med27 mRNA suggests a universal requirement for Med27 in transcriptional initiation. Loss of Crsp34/Med27 decreases amacrine cell number, but increases the number of rod photoreceptor cells []. 
Probab=23.20  E-value=43  Score=22.32  Aligned_cols=20  Identities=35%  Similarity=0.640  Sum_probs=16.9

Q ss_pred             cchHHHhhhc-CccCCCCCCC
Q psy11901          2 VCSKCEKKLG-KVITPDNWKS   21 (100)
Q Consensus         2 VC~KCeKKL~-kl~tPd~~k~   21 (100)
                      +|.+|.|-|+ ..--|-+||+
T Consensus        56 pC~~C~klL~~~~~LPP~~r~   76 (90)
T PF11571_consen   56 PCKKCGKLLSSKAFLPPVRRP   76 (90)
T ss_pred             hhhHHHhHhhhcccCCCeeec
Confidence            6999999996 5788889984


No 48 
>TIGR03826 YvyF flagellar operon protein TIGR03826. This gene is found in flagellar operons of Bacillus-related organisms. Its function has not been determined and an official gene symbol has not been assigned, although the gene is designated yvyF in B. subtilus. A tentative assignment as a regulator is suggested in the NCBI record GI:16080597.
Probab=22.99  E-value=36  Score=25.00  Aligned_cols=24  Identities=25%  Similarity=0.667  Sum_probs=20.0

Q ss_pred             ccCccchhhhhhhccCCCccCccccc
Q psy11901         52 QKFESCKICRQKVHQVGSHYCQACAY   77 (100)
Q Consensus        52 ~~~~~C~~CK~~v~q~g~~YCq~CAY   77 (100)
                      +..-.|..|.+.+.. | .||..|+-
T Consensus        79 nl~~~CE~CG~~I~~-G-r~C~~C~~  102 (137)
T TIGR03826        79 NLGYPCERCGTSIRE-G-RLCDSCAG  102 (137)
T ss_pred             CCcCcccccCCcCCC-C-CccHHHHH
Confidence            345699999999997 5 99999973


No 49 
>PHA02094 hypothetical protein
Probab=22.96  E-value=42  Score=22.94  Aligned_cols=11  Identities=27%  Similarity=0.727  Sum_probs=9.8

Q ss_pred             ccCCCCCCCCC
Q psy11901         13 VITPDNWKSGS   23 (100)
Q Consensus        13 l~tPd~~k~gs   23 (100)
                      ||-|+|||||-
T Consensus        65 vakpnpfrdgv   75 (81)
T PHA02094         65 VAKPNPFRDGV   75 (81)
T ss_pred             ccCCCCCccce
Confidence            88999999974


No 50 
>PHA02565 49 recombination endonuclease VII; Provisional
Probab=22.84  E-value=38  Score=25.79  Aligned_cols=14  Identities=36%  Similarity=0.942  Sum_probs=11.1

Q ss_pred             cccccccccCcccc
Q psy11901         77 YKKGICAMCGKKLL   90 (100)
Q Consensus        77 YkkGiCamCGKki~   90 (100)
                      -+.|.||+||..+.
T Consensus        18 ~Q~G~CaiC~~~l~   31 (157)
T PHA02565         18 AQNGICPLCKRELD   31 (157)
T ss_pred             HhCCcCCCCCCccC
Confidence            35679999999865


No 51 
>COG0266 Nei Formamidopyrimidine-DNA glycosylase [DNA replication, recombination, and repair]
Probab=21.99  E-value=42  Score=27.32  Aligned_cols=32  Identities=22%  Similarity=0.630  Sum_probs=24.4

Q ss_pred             hhcCCCcccCccchhhhhhh-----ccCCCccCcccc
Q psy11901         45 ARFNPYTQKFESCKICRQKV-----HQVGSHYCQACA   76 (100)
Q Consensus        45 ~r~~Py~~~~~~C~~CK~~v-----~q~g~~YCq~CA   76 (100)
                      .++.-|+.....|+.|.+.+     .+-+.+||..|-
T Consensus       236 ~~l~VYgR~GepC~~CGt~I~k~~~~gR~t~~CP~CQ  272 (273)
T COG0266         236 QELKVYGRAGEPCRRCGTPIEKIKLGGRSTFYCPVCQ  272 (273)
T ss_pred             eeEEEecCCCCCCCccCCEeEEEEEcCCcCEeCCCCC
Confidence            45667777788999997754     566889999983


No 52 
>TIGR00375 conserved hypothetical protein TIGR00375. The member of this family from Methanococcus jannaschii, MJ0043, is considerably longer and appears to contain an intein N-terminal to the region of homology.
Probab=21.98  E-value=42  Score=28.30  Aligned_cols=38  Identities=16%  Similarity=0.447  Sum_probs=23.0

Q ss_pred             hcCCCc-cc-CccchhhhhhhccCCCccCcccccccccccccCcccc
Q psy11901         46 RFNPYT-QK-FESCKICRQKVHQVGSHYCQACAYKKGICAMCGKKLL   90 (100)
Q Consensus        46 r~~Py~-~~-~~~C~~CK~~v~q~g~~YCq~CAYkkGiCamCGKki~   90 (100)
                      -|+|-- .| ...|+.|...+....+     =++ .++|+ ||+.|.
T Consensus       230 g~~P~~GKYh~~~c~~C~~~~~~~~~-----~~~-~~~Cp-CG~~i~  269 (374)
T TIGR00375       230 GLDPLLGKYHQTACEACGEPAVSEDA-----ETA-CANCP-CGGRIK  269 (374)
T ss_pred             eECcCCCccchhhhcccCCcCCchhh-----hhc-CCCCC-CCCcce
Confidence            366644 22 5678888776653211     022 58999 999964


No 53 
>PF10146 zf-C4H2:  Zinc finger-containing protein ;  InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a family of proteins which appears to have a highly conserved zinc finger domain at the C-terminal end, described as -C-X2-CH-X3-H-X5-C-X2-C-. The structure is predicted to contain a coiled coil. Members of this family are annotated as being tumour-associated antigen HCA127 in humans, but this could not be confirmed.
Probab=21.43  E-value=50  Score=26.02  Aligned_cols=21  Identities=29%  Similarity=1.010  Sum_probs=15.9

Q ss_pred             CccchhhhhhhccCCCccCccc
Q psy11901         54 FESCKICRQKVHQVGSHYCQAC   75 (100)
Q Consensus        54 ~~~C~~CK~~v~q~g~~YCq~C   75 (100)
                      ...|..|-|++|. .+-.|.-|
T Consensus       194 MK~C~sC~qqIHR-NAPiCPlC  214 (230)
T PF10146_consen  194 MKTCQSCHQQIHR-NAPICPLC  214 (230)
T ss_pred             cchhHhHHHHHhc-CCCCCccc
Confidence            4799999999999 45554444


No 54 
>PF10417 1-cysPrx_C:  C-terminal domain of 1-Cys peroxiredoxin;  InterPro: IPR019479  This entry represents the C-terminal domain of 1-Cys peroxiredoxin, a member of the peroxiredoxin superfamily which protect cells against membrane oxidation through glutathione (GSH)-dependent reduction of phospholipid hydroperoxides to corresponding alcohols []. The C-terminal domain is crucial for providing the extra cysteine necessary for dimerisation of the whole molecule. Loss of the enzyme's peroxidase activity is associated with oxidation of the catalytic cysteine found upstream of this domain. Glutathionylation, presumably through its disruption of protein structure, facilitates access for GSH, resulting in spontaneous reduction of the mixed disulphide to the sulphydryl and consequent activation of the enzyme []. The domain is associated with IPR000866 from INTERPRO, which carries the catalytic cysteine. ; GO: 0051920 peroxiredoxin activity, 0055114 oxidation-reduction process; PDB: 1ZOF_E 2H01_A 3EMP_D 1YF1_G 1YF0_D 1N8J_C 1YEP_D 1YEX_D 2V41_H 2V32_C ....
Probab=20.91  E-value=59  Score=18.89  Aligned_cols=12  Identities=58%  Similarity=1.110  Sum_probs=10.3

Q ss_pred             CccCCCCCCCCC
Q psy11901         12 KVITPDNWKSGS   23 (100)
Q Consensus        12 kl~tPd~~k~gs   23 (100)
                      .++||.-|+.|.
T Consensus         9 ~v~tPanW~pGd   20 (40)
T PF10417_consen    9 GVATPANWKPGD   20 (40)
T ss_dssp             SSBBCTTTCTTS
T ss_pred             CcccCcCCCCCC
Confidence            489999999875


No 55 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=20.48  E-value=26  Score=17.38  Aligned_cols=14  Identities=21%  Similarity=0.693  Sum_probs=8.1

Q ss_pred             ccccCccccccccc
Q psy11901         82 CAMCGKKLLDVKNY   95 (100)
Q Consensus        82 CamCGKki~dt~~y   95 (100)
                      |.+|++...+-..|
T Consensus         3 C~~C~~~f~s~~~~   16 (25)
T PF12874_consen    3 CDICNKSFSSENSL   16 (25)
T ss_dssp             ETTTTEEESSHHHH
T ss_pred             CCCCCCCcCCHHHH
Confidence            66666666554444


No 56 
>PF02945 Endonuclease_7:  Recombination endonuclease VII;  InterPro: IPR004211 This family of proteins which includes Bacteriophage T4 endonuclease VII, Mycobacteriophage D29 gene 59, and other as yet uncharacterised proteins. The T4 endonuclease VII (Endo VII) recognises a broad spectrum of DNA substrates ranging from branched DNAs to single base mismatches. The structure of this enzyme has been resolved and it was found that the monomers form an elongated, intertwined molecular dimer that exibits extreme domain swapping. Two pairs of antiparallel helices which form a novel 'four-helix cross' motif are the major dimerisation elements [].; PDB: 3GOX_A 3FC3_A 1EN7_B 1E7L_B 2QNF_A 2QNC_A 1E7D_A.
Probab=20.41  E-value=37  Score=22.72  Aligned_cols=14  Identities=50%  Similarity=0.968  Sum_probs=7.8

Q ss_pred             cccccccccCcccc
Q psy11901         77 YKKGICAMCGKKLL   90 (100)
Q Consensus        77 YkkGiCamCGKki~   90 (100)
                      .+.|.|++||....
T Consensus        20 ~q~~~C~iC~~~~~   33 (81)
T PF02945_consen   20 EQGGRCAICGKPLP   33 (81)
T ss_dssp             HTTTE-TTT-SEEE
T ss_pred             HhCCcCcCCCCCcc
Confidence            45568999998443


No 57 
>PRK06393 rpoE DNA-directed RNA polymerase subunit E''; Validated
Probab=20.33  E-value=45  Score=21.89  Aligned_cols=22  Identities=23%  Similarity=0.780  Sum_probs=16.3

Q ss_pred             CccchhhhhhhccCCCccCcccccccccccccCcc
Q psy11901         54 FESCKICRQKVHQVGSHYCQACAYKKGICAMCGKK   88 (100)
Q Consensus        54 ~~~C~~CK~~v~q~g~~YCq~CAYkkGiCamCGKk   88 (100)
                      +..|+.|+.-++..             .|.+||-.
T Consensus         5 ~~AC~~C~~i~~~~-------------~Cp~Cgs~   26 (64)
T PRK06393          5 YRACKKCKRLTPEK-------------TCPVHGDE   26 (64)
T ss_pred             hhhHhhCCcccCCC-------------cCCCCCCC
Confidence            35899999888531             78888875


Done!