Query         psy11903
Match_columns 179
No_of_seqs    248 out of 1148
Neff          5.5 
Searched_HMMs 46136
Date          Fri Aug 16 21:54:30 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy11903.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/11903hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3476|consensus              100.0 4.7E-49   1E-53  286.3  -0.1  100   80-179     1-100 (100)
  2 PF10235 Cript:  Microtubule-as 100.0 4.9E-43 1.1E-47  257.1   4.3   88   90-179     1-90  (90)
  3 KOG1604|consensus               99.8 9.1E-19   2E-23  154.3   8.5  107   10-121     5-124 (353)
  4 PRK11055 galM galactose-1-epim  99.7 6.5E-17 1.4E-21  143.2   9.2   88   22-113     5-104 (342)
  5 PTZ00485 aldolase 1-epimerase;  99.7 2.9E-16 6.2E-21  141.1   9.2   85   27-114    12-110 (376)
  6 TIGR02636 galM_Leloir galactos  99.6   2E-15 4.4E-20  132.9   8.9   85   27-114     3-99  (335)
  7 PLN00194 aldose 1-epimerase; P  99.4 1.6E-12 3.5E-17  114.7   9.1   88   22-114     5-104 (337)
  8 cd09019 galactose_mutarotase_l  99.3 8.4E-12 1.8E-16  109.1   8.0   83   30-114     1-95  (326)
  9 COG2017 GalM Galactose mutarot  99.0 1.9E-09 4.1E-14   94.2   8.2   90   13-114     2-103 (308)
 10 PRK15172 putative aldose-1-epi  98.3 1.7E-06 3.6E-11   75.2   7.6   75   28-110    10-95  (300)
 11 PF01263 Aldose_epim:  Aldose 1  98.0 1.7E-05 3.8E-10   67.1   7.1   80   29-112     1-91  (300)
 12 cd09022 Aldose_epim_Ec_YihR Al  97.8 5.2E-05 1.1E-09   64.7   5.9   66   40-111     2-77  (284)
 13 cd09024 Aldose_epim_lacX Aldos  95.7   0.019 4.2E-07   49.3   5.2   55   31-90      1-55  (288)
 14 cd01081 Aldose_epim aldose 1-e  95.4   0.037 8.1E-07   46.0   5.7   65   40-110     2-79  (284)
 15 PF10217 DUF2039:  Uncharacteri  95.3  0.0023 4.9E-08   47.6  -1.8   41  126-167    49-90  (92)
 16 COG5152 Uncharacterized conser  93.1   0.023 4.9E-07   48.1  -0.4   34  135-168   198-240 (259)
 17 KOG3241|consensus               92.3  0.0096 2.1E-07   49.5  -3.6   46  125-171    60-106 (227)
 18 PF12773 DZR:  Double zinc ribb  89.1    0.26 5.6E-06   31.5   1.7   34  136-170     1-41  (50)
 19 PF13248 zf-ribbon_3:  zinc-rib  79.8    0.95 2.1E-05   25.6   0.9   22  134-156     3-24  (26)
 20 PF13240 zinc_ribbon_2:  zinc-r  79.8    0.85 1.8E-05   25.4   0.7   20  135-155     1-20  (23)
 21 PF14849 YidC_periplas:  YidC p  79.4     3.6 7.8E-05   34.5   4.7   37   30-67      1-41  (270)
 22 KOG1813|consensus               69.7     2.3 4.9E-05   37.9   1.1   36  135-170   243-287 (313)
 23 PF14634 zf-RING_5:  zinc-RING   68.4     1.3 2.7E-05   27.8  -0.5   20  147-166    21-44  (44)
 24 cd09021 Aldose_epim_Ec_YphB al  66.9      12 0.00025   31.6   4.9   66   42-111     4-80  (273)
 25 TIGR03593 yidC_nterm membrane   64.9     8.3 0.00018   34.2   3.8   29   28-57     73-101 (366)
 26 PF07191 zinc-ribbons_6:  zinc-  61.2     2.3 5.1E-05   30.1  -0.3   37  135-171     3-43  (70)
 27 smart00504 Ubox Modified RING   59.7     3.7   8E-05   26.7   0.5   23  147-169    20-46  (63)
 28 PF06750 DiS_P_DiS:  Bacterial   58.9     3.4 7.4E-05   30.3   0.2   37  133-169    33-69  (92)
 29 KOG2272|consensus               57.2     6.9 0.00015   34.5   1.8   51  116-169   149-206 (332)
 30 KOG0320|consensus               54.8     3.3 7.1E-05   34.5  -0.5   36  134-169   132-178 (187)
 31 PF10571 UPF0547:  Uncharacteri  54.6     6.5 0.00014   22.5   0.9   22  135-157     2-23  (26)
 32 PRK12496 hypothetical protein;  54.3     5.8 0.00013   32.0   0.8   21  149-169   128-154 (164)
 33 PF13920 zf-C3HC4_3:  Zinc fing  53.8     2.7 5.9E-05   26.7  -0.9   37  135-171     4-50  (50)
 34 TIGR00599 rad18 DNA repair pro  51.6       6 0.00013   36.5   0.6   36  134-169    27-71  (397)
 35 KOG3799|consensus               51.3     6.8 0.00015   31.5   0.8   36  133-170    65-101 (169)
 36 PF06906 DUF1272:  Protein of u  49.6     7.2 0.00016   26.6   0.6   36  134-169     6-52  (57)
 37 PF05715 zf-piccolo:  Piccolo Z  48.5     6.8 0.00015   27.0   0.3   32  134-167     3-39  (61)
 38 PRK01318 membrane protein inse  47.9      37 0.00079   32.4   5.2   27   30-57     40-66  (521)
 39 smart00132 LIM Zinc-binding do  45.2      17 0.00036   20.8   1.7    9  160-168    29-37  (39)
 40 PF03660 PHF5:  PHF5-like prote  45.2     5.7 0.00012   30.3  -0.5   26  130-155    52-77  (106)
 41 PLN03208 E3 ubiquitin-protein   44.4       8 0.00017   32.4   0.2   36  135-170    20-80  (193)
 42 cd04476 RPA1_DBD_C RPA1_DBD_C:  44.1     9.4  0.0002   30.0   0.5   22  133-154    34-57  (166)
 43 PF14471 DUF4428:  Domain of un  43.8      11 0.00024   24.8   0.8   16  160-175     1-16  (51)
 44 cd09020 D-hex-6-P-epi_like D-h  42.0      47   0.001   28.2   4.6   32   31-67      2-33  (269)
 45 PF14446 Prok-RING_1:  Prokaryo  37.5      15 0.00033   24.7   0.7   14  156-169     3-16  (54)
 46 TIGR00375 conserved hypothetic  37.0      14 0.00031   33.8   0.6   38  125-169   230-269 (374)
 47 KOG1594|consensus               36.1      89  0.0019   27.9   5.3   30   27-56     22-51  (305)
 48 PF13923 zf-C3HC4_2:  Zinc fing  36.0     5.9 0.00013   23.9  -1.4   10  147-156    18-27  (39)
 49 KOG1701|consensus               36.0     6.9 0.00015   36.6  -1.5   36  135-170   304-346 (468)
 50 PF14486 DUF4432:  Domain of un  35.7 1.1E+02  0.0023   26.9   5.9   41   27-74      3-44  (302)
 51 KOG0153|consensus               34.6      10 0.00023   34.6  -0.6   47  112-164    26-83  (377)
 52 PF10764 Gin:  Inhibitor of sig  34.2      10 0.00022   24.5  -0.6   32  135-172     1-32  (46)
 53 PF14315 DUF4380:  Domain of un  33.3 1.1E+02  0.0023   26.3   5.4   29   28-57      4-33  (274)
 54 cd00162 RING RING-finger (Real  33.1      17 0.00036   21.1   0.3   21  147-167    19-44  (45)
 55 PRK05580 primosome assembly pr  33.1      34 0.00074   33.4   2.6   22  148-169   408-432 (679)
 56 PHA02929 N1R/p28-like protein;  32.7      20 0.00042   30.9   0.8   41  133-173   174-231 (238)
 57 PF01258 zf-dskA_traR:  Prokary  32.6      19 0.00042   21.5   0.5   12  159-170     4-15  (36)
 58 KOG4458|consensus               32.5      19 0.00042   25.4   0.6   33  123-162     4-36  (78)
 59 PF13894 zf-C2H2_4:  C2H2-type   32.1      11 0.00024   19.2  -0.5   15  160-174     2-16  (24)
 60 COG1996 RPC10 DNA-directed RNA  31.8      20 0.00044   23.6   0.6   28  135-169     8-35  (49)
 61 COG0266 Nei Formamidopyrimidin  31.8      20 0.00043   31.5   0.7   32  124-155   236-272 (273)
 62 KOG3896|consensus               31.8      20 0.00044   32.9   0.7   41  124-165    16-71  (449)
 63 PRK00420 hypothetical protein;  31.6      24 0.00052   27.1   1.0   22  133-154    23-46  (112)
 64 PF10621 FpoO:  F420H2 dehydrog  30.7      22 0.00047   27.5   0.6   36  128-169    29-71  (119)
 65 cd09025 Aldose_epim_Slr1438 Al  30.7 2.2E+02  0.0047   24.0   6.9   55   30-90      3-65  (271)
 66 PF00412 LIM:  LIM domain;  Int  29.8      31 0.00067   21.8   1.2   11  135-145    28-38  (58)
 67 PF06827 zf-FPG_IleRS:  Zinc fi  29.4      16 0.00035   20.9  -0.2   21  135-155     3-28  (30)
 68 COG1439 Predicted nucleic acid  27.7      30 0.00064   28.7   1.0   25  134-169   140-164 (177)
 69 PRK14714 DNA polymerase II lar  26.8      34 0.00073   36.2   1.4   31  134-167   668-701 (1337)
 70 PRK01103 formamidopyrimidine/5  26.1      31 0.00067   29.7   0.9   31  125-155   237-272 (274)
 71 PRK14810 formamidopyrimidine-D  25.8      32 0.00069   29.7   0.9   30  125-154   236-270 (272)
 72 COG1645 Uncharacterized Zn-fin  24.9      32 0.00069   27.2   0.7   24  134-157    29-53  (131)
 73 PF00643 zf-B_box:  B-box zinc   24.6      17 0.00037   21.9  -0.7   29  134-167     4-32  (42)
 74 PRK14811 formamidopyrimidine-D  23.3      38 0.00082   29.3   0.9   33  125-157   227-264 (269)
 75 PF14835 zf-RING_6:  zf-RING of  23.0      57  0.0012   22.8   1.6   42  135-176     9-60  (65)
 76 PF09706 Cas_CXXC_CXXC:  CRISPR  22.8      43 0.00092   23.2   0.9   11  157-167     4-14  (69)
 77 PF07649 C1_3:  C1-like domain;  22.1      31 0.00067   19.7   0.1   22  135-156     2-23  (30)
 78 PRK06393 rpoE DNA-directed RNA  22.0      41 0.00088   23.4   0.7   22  133-167     5-26  (64)
 79 TIGR02420 dksA RNA polymerase-  21.9      37 0.00079   25.3   0.5   11  159-169    81-91  (110)
 80 TIGR03826 YvyF flagellar opero  21.9      38 0.00083   26.8   0.6   24  131-156    79-102 (137)
 81 TIGR00595 priA primosomal prot  21.7      87  0.0019   29.5   3.0   37  133-169   222-264 (505)
 82 COG2888 Predicted Zn-ribbon RN  21.1      50  0.0011   22.8   1.0   29  134-169    10-38  (61)
 83 KOG1734|consensus               20.9      32  0.0007   30.6  -0.0   15  158-172   224-238 (328)
 84 PF06045 Rhamnogal_lyase:  Rham  20.8 1.5E+02  0.0033   25.0   4.0   34   31-70     18-51  (203)
 85 KOG1705|consensus               20.4      31 0.00067   26.0  -0.2   33  129-162    51-86  (110)
 86 smart00746 TRASH metallochaper  20.2      47   0.001   17.6   0.6    9  161-169     1-9   (39)
 87 COG1545 Predicted nucleic-acid  20.2      56  0.0012   25.6   1.2   20  134-154    30-49  (140)

No 1  
>KOG3476|consensus
Probab=100.00  E-value=4.7e-49  Score=286.31  Aligned_cols=100  Identities=68%  Similarity=1.234  Sum_probs=97.5

Q ss_pred             hccccccceecceeccCccCCCCCccccCCceecccceeeeecccccCCCcccCcccchhhcccccCCCccCcccccccC
Q psy11903         80 MVCSKCEKKLGKVITPDNWKSGSRNTIESGGRRIGENKALTASKARFNPYTQKFESCKICRQKVHQVGSHYCQACAYKKG  159 (179)
Q Consensus        80 mvc~kc~~klg~va~pd~~k~~~~n~l~gG~~gi~~nk~l~~~k~~~~p~~~~~~~c~~ck~~~~~~~~~yc~~cay~~g  159 (179)
                      |||++||++|+++++||||+++.||+..+|++.|++||.|.+.|+||+||+..+.+|+|||+.|||+|+||||.|||+||
T Consensus         1 MVC~kCEkKLskvi~pd~wr~garn~~~sGgrkinenkaL~s~k~r~~p~gt~~~kC~iCk~~vHQ~GshYC~tCAY~Kg   80 (100)
T KOG3476|consen    1 MVCEKCEKKLSKVIGPDPWRDGARNTTESGGRKINENKALISKKKRATPYGTALAKCRICKQLVHQPGSHYCQTCAYKKG   80 (100)
T ss_pred             CchhHHHHHhccccccCcccccccccCCCCCeecchhhhhhhhhhhcCccccccchhHHHHHHhcCCcchhHhHhhhhhh
Confidence            89999999999999999999999999999999999999777778999999999999999999999999999999999999


Q ss_pred             cccccCcccccccccccccC
Q psy11903        160 ICAMCGKKLLDVKNYKQSAA  179 (179)
Q Consensus       160 ~c~mcgk~~~d~~~~~~s~~  179 (179)
                      |||||||+|+||++|+||++
T Consensus        81 iCAMCGKki~nTK~ykQsst  100 (100)
T KOG3476|consen   81 ICAMCGKKILNTKNYKQSST  100 (100)
T ss_pred             HHHHhhhHhhccccccccCC
Confidence            99999999999999999986


No 2  
>PF10235 Cript:  Microtubule-associated protein CRIPT;  InterPro: IPR019367  The CRIPT protein is a cytoskeletal protein involved in microtubule production. This C-terminal domain is essential for binding to the PDZ3 domain of the SAP90 protein, one of a super-family of PDZ-containing proteins that play an important role in coupling the membrane ion channels with their signalling partners []. 
Probab=100.00  E-value=4.9e-43  Score=257.09  Aligned_cols=88  Identities=66%  Similarity=1.194  Sum_probs=83.5

Q ss_pred             cceeccCccCCCC--CccccCCceecccceeeeecccccCCCcccCcccchhhcccccCCCccCcccccccCcccccCcc
Q psy11903         90 GKVITPDNWKSGS--RNTIESGGRRIGENKALTASKARFNPYTQKFESCKICRQKVHQVGSHYCQACAYKKGICAMCGKK  167 (179)
Q Consensus        90 g~va~pd~~k~~~--~n~l~gG~~gi~~nk~l~~~k~~~~p~~~~~~~c~~ck~~~~~~~~~yc~~cay~~g~c~mcgk~  167 (179)
                      ++||+||||++++  +|+..+|+++|+|||||+++ ++ |||++++++|++||++|||+|+||||.|||+|||||||||+
T Consensus         1 tklatPd~~k~~~~~~~~~~~g~r~i~eNKlLs~~-~~-nPy~~~~~~C~~CK~~v~q~g~~YCq~CAYkkGiCamCGKk   78 (90)
T PF10235_consen    1 TKLATPDPWKKGAMYRNTAESGGRKIGENKLLSKK-KK-NPYAPYSSKCKICKTKVHQPGAKYCQTCAYKKGICAMCGKK   78 (90)
T ss_pred             CccccCCccccCcccccccCCCCccccceeeeccc-cc-CcccccCccccccccccccCCCccChhhhcccCcccccCCe
Confidence            4689999999999  99999999999999999873 44 99999999999999999999999999999999999999999


Q ss_pred             cccccccccccC
Q psy11903        168 LLDVKNYKQSAA  179 (179)
Q Consensus       168 ~~d~~~~~~s~~  179 (179)
                      |+||++|+||+|
T Consensus        79 i~dtk~ykqs~v   90 (90)
T PF10235_consen   79 ILDTKNYKQSSV   90 (90)
T ss_pred             ecccccccccCC
Confidence            999999999987


No 3  
>KOG1604|consensus
Probab=99.77  E-value=9.1e-19  Score=154.27  Aligned_cols=107  Identities=36%  Similarity=0.575  Sum_probs=90.2

Q ss_pred             eeccccceeccCCCceecEEEEEEEcCCCeEEEEecCCcEEEEEEeeCCCCcccceEeCcCCchhhh-----hhhhcccc
Q psy11903         10 MEDKFGECINESNGQVLPVRRFTLTNSQRMSVQVIDYGATITTIKVPDKRGNVDDVVLGFDDMREEI-----YFIMVCSK   84 (179)
Q Consensus        10 ~~~~FG~~~~~~~G~~~~v~~~tL~n~~gl~v~vlnyGAtI~sl~vpdr~G~~~dVVLGfd~~e~Y~-----~~gmvc~k   84 (179)
                      .+..|| -+++...+  .++.|||.|+.+|+|.|++|||+|+||.+||++|+..|||||||+++.|+     |||++.+|
T Consensus         5 ~~~~~~-~~~~~~~~--~~~~~tl~n~~~l~vti~~~GATi~sL~vpd~~gk~~DVVLGfd~v~gY~~~~~~yfGatvGR   81 (353)
T KOG1604|consen    5 VEDVFG-NSNTDQKQ--TIRVYTLGNGKGLQVTIINLGATITSLKVPDKSGKLDDVVLGFDDVDGYLKDDAAYFGATVGR   81 (353)
T ss_pred             cccccC-CCcccccC--ceEEEEecCCCeeEEEEeeCCcEEEEEEcCCcCCcccceEecccchhhhccCCcceecceehh
Confidence            345666 23333343  89999999998999999999999999999999999999999999999998     69999999


Q ss_pred             ccceecc--------eeccCccCCCCCccccCCceecccceeeee
Q psy11903         85 CEKKLGK--------VITPDNWKSGSRNTIESGGRRIGENKALTA  121 (179)
Q Consensus        85 c~~klg~--------va~pd~~k~~~~n~l~gG~~gi~~nk~l~~  121 (179)
                      .++||++        .++..+  |+++|++|||..||+.-...-.
T Consensus        82 vANRI~~G~F~ldgk~y~lt~--N~g~n~lHgg~~gf~~~~w~v~  124 (353)
T KOG1604|consen   82 VANRIAKGKFSLDGKPYKLTV--NNGKNTLHGGIKGFDKVIWEVV  124 (353)
T ss_pred             hhhhcccceEEECCceEEecc--cCCCccccCCcccccceEEEEE
Confidence            9999986        344443  4789999999999998887755


No 4  
>PRK11055 galM galactose-1-epimerase; Provisional
Probab=99.69  E-value=6.5e-17  Score=143.16  Aligned_cols=88  Identities=26%  Similarity=0.443  Sum_probs=78.0

Q ss_pred             CCceecEEEEEEEcCCCeEEEEecCCcEEEEEEeeCCCCcccceEeCcCCchhhh----hhhhccccccceecc------
Q psy11903         22 NGQVLPVRRFTLTNSQRMSVQVIDYGATITTIKVPDKRGNVDDVVLGFDDMREEI----YFIMVCSKCEKKLGK------   91 (179)
Q Consensus        22 ~G~~~~v~~~tL~n~~gl~v~vlnyGAtI~sl~vpdr~G~~~dVVLGfd~~e~Y~----~~gmvc~kc~~klg~------   91 (179)
                      +|+  ++++|||+|++|++|+|++|||+|++|++||++|..+|||||||++++|+    ++|++.+++++||+.      
T Consensus         5 ~g~--~v~~~tl~n~~g~~v~i~~~GA~i~~l~vpd~~g~~~dvvlg~~~~~~y~~~~~~~Ga~iGr~anRI~~g~f~~~   82 (342)
T PRK11055          5 DGQ--PYRLLTLRNNAGMVVTLMDWGATWLSCRVPLSDGSVREVLLGCASPEDYPDQAAYLGASVGRYANRIANSRFTLD   82 (342)
T ss_pred             CCC--eEEEEEEECCCCeEEEEeCcCcEEEEEEeECCCCCEeeeEECCCCHHHHhhCCCccCceeCCcCCcccCCEEEEC
Confidence            666  89999999988999999999999999999999999999999999999998    799999999999964      


Q ss_pred             --eeccCccCCCCCccccCCceec
Q psy11903         92 --VITPDNWKSGSRNTIESGGRRI  113 (179)
Q Consensus        92 --va~pd~~k~~~~n~l~gG~~gi  113 (179)
                        .+++++ + .+.|+||||..|+
T Consensus        83 G~~y~L~~-N-~~~n~lHGg~~G~  104 (342)
T PRK11055         83 GETYQLSP-N-QGGNQLHGGPEGF  104 (342)
T ss_pred             CEEEEccc-C-CCCcccCCCCccc
Confidence              455554 4 4679999997665


No 5  
>PTZ00485 aldolase 1-epimerase; Provisional
Probab=99.66  E-value=2.9e-16  Score=141.09  Aligned_cols=85  Identities=18%  Similarity=0.286  Sum_probs=72.7

Q ss_pred             cEEEEEEEcCCCeEEEEecCCcEEEEEEeeCC-CCcccceEeCcC-Cchhhh----hhhhccccccceecc--------e
Q psy11903         27 PVRRFTLTNSQRMSVQVIDYGATITTIKVPDK-RGNVDDVVLGFD-DMREEI----YFIMVCSKCEKKLGK--------V   92 (179)
Q Consensus        27 ~v~~~tL~n~~gl~v~vlnyGAtI~sl~vpdr-~G~~~dVVLGfd-~~e~Y~----~~gmvc~kc~~klg~--------v   92 (179)
                      ..++|+|+|+ +|+|+|+||||+|++|++||+ +|.++||||||| ++++|+    ++|++.+|+++||..        .
T Consensus        12 ~~~~~~L~N~-~~~v~i~n~GA~i~si~v~~~~~g~~~dvvLG~d~~~~~Y~~~~~y~Ga~iGr~AnRI~~G~f~ldG~~   90 (376)
T PTZ00485         12 YDKLVWLETD-RLKVGLTNYAASVASIQVYHPADNKWIEVNCGYPKNPEEAYADPDYMGATVGRCAGRVAGGVFTLDGVK   90 (376)
T ss_pred             CCcEEEEEeC-CEEEEEECcCcEEEEEEEEcCCCCcEEeEEECCCCCHHHHhhCCCccCcEeCCCCCeEECCEEEECCEE
Confidence            3668999996 599999999999999999873 399999999997 699998    799999999999964        4


Q ss_pred             eccCccCCCCCccccCCceecc
Q psy11903         93 ITPDNWKSGSRNTIESGGRRIG  114 (179)
Q Consensus        93 a~pd~~k~~~~n~l~gG~~gi~  114 (179)
                      ++++.  |.+.|+||||..+|+
T Consensus        91 YqL~~--Neg~n~LHGG~~gf~  110 (376)
T PTZ00485         91 YYTQK--NRGENTCHCGDDAYH  110 (376)
T ss_pred             EEccC--CCCCcccCCCCCccc
Confidence            55553  456799999998887


No 6  
>TIGR02636 galM_Leloir galactose mutarotase. Members of this protein family act as galactose mutarotase (D-galactose 1-epimerase) and participate in the Leloir pathway for galactose/glucose interconversion. All members of the seed alignment for this model are found in gene clusters with other enzymes of the Leloir pathway. This enzyme family belongs to the aldose 1-epimerase family, described by pfam model pfam01263. However, the enzyme described as aldose 1-epimerase itself (EC 5.1.3.3) is called broadly specific for D-glucose, L-arabinose, D-xylose, D-galactose, maltose and lactose. The restricted genome context for genes in this family suggests members should act primarily on D-galactose.
Probab=99.61  E-value=2e-15  Score=132.88  Aligned_cols=85  Identities=25%  Similarity=0.421  Sum_probs=74.1

Q ss_pred             cEEEEEEEcCCCeEEEEecCCcEEEEEEeeCCCCcccceEeCcCCchhhh----hhhhccccccceecc--------eec
Q psy11903         27 PVRRFTLTNSQRMSVQVIDYGATITTIKVPDKRGNVDDVVLGFDDMREEI----YFIMVCSKCEKKLGK--------VIT   94 (179)
Q Consensus        27 ~v~~~tL~n~~gl~v~vlnyGAtI~sl~vpdr~G~~~dVVLGfd~~e~Y~----~~gmvc~kc~~klg~--------va~   94 (179)
                      .+++|||+|++||+|+|++|||+|++|.+||++ ..+|||||||++++|+    ++|++.+++++||..        .++
T Consensus         3 ~v~~~~l~n~~g~~v~i~~~GA~i~~l~~pd~~-~~~~vvlg~~~~~~y~~~~~~~Ga~igp~anRI~~g~f~~~G~~y~   81 (335)
T TIGR02636         3 PAQLITLTNNNGMTISFMDIGATWLSCQVPLAG-ELREVLLGFASMEEYYKQDAYLGATVGRYANRIANGSFEIDGETYQ   81 (335)
T ss_pred             eeEEEEEECCCCcEEEEeCcCcEEEEEEeeCCC-CccceEECCCCHHHHhhCCCccCCCcCCCCceecCCEEEECCEEEE
Confidence            789999999889999999999999999999976 7789999999999998    789999999999963        455


Q ss_pred             cCccCCCCCccccCCceecc
Q psy11903         95 PDNWKSGSRNTIESGGRRIG  114 (179)
Q Consensus        95 pd~~k~~~~n~l~gG~~gi~  114 (179)
                      +++ | .+.|++|||..|++
T Consensus        82 L~~-N-~~~n~lHGg~~G~~   99 (335)
T TIGR02636        82 LSI-N-QGGNCLHGGPEGFD   99 (335)
T ss_pred             ecc-C-CCCcccCCCCcccc
Confidence            553 4 45799999986664


No 7  
>PLN00194 aldose 1-epimerase; Provisional
Probab=99.38  E-value=1.6e-12  Score=114.71  Aligned_cols=88  Identities=28%  Similarity=0.531  Sum_probs=75.1

Q ss_pred             CCceecEEEEEEEcCCCeEEEEecCCcEEEEEEeeCCCCcccceEeCcCCchhhh----hhhhccccccceecc------
Q psy11903         22 NGQVLPVRRFTLTNSQRMSVQVIDYGATITTIKVPDKRGNVDDVVLGFDDMREEI----YFIMVCSKCEKKLGK------   91 (179)
Q Consensus        22 ~G~~~~v~~~tL~n~~gl~v~vlnyGAtI~sl~vpdr~G~~~dVVLGfd~~e~Y~----~~gmvc~kc~~klg~------   91 (179)
                      .|+  .+.+|+|+|+ .++|+|++|||+|++|.++|++|.++||||||++.++|+    ++|++.++.++||..      
T Consensus         5 ~~~--~~~~~~L~n~-~l~~~i~~~GA~l~s~~~~~~~g~~~~vvlg~~~~~~y~~~~~~~Ga~lgp~anRI~~g~~~~~   81 (337)
T PLN00194          5 AEE--KPGIYELKNG-NISVKLTNYGATITSLILPDKNGKLADVVLGFDSVEPYKNDSPYFGAIVGRVANRIKGAKFTLN   81 (337)
T ss_pred             CCC--eeEEEEEEeC-CEEEEEECCCcEEEEEEeECCCCCEeeeEECCCCHHHHhhCCCccCCeeCCCCCceeCCEEEEC
Confidence            455  8999999995 699999999999999999999999999999999999998    578999999999853      


Q ss_pred             --eeccCccCCCCCccccCCceecc
Q psy11903         92 --VITPDNWKSGSRNTIESGGRRIG  114 (179)
Q Consensus        92 --va~pd~~k~~~~n~l~gG~~gi~  114 (179)
                        .+..++  +.+.|.+|||..|+.
T Consensus        82 G~~y~l~~--N~~~~~lHGg~~G~~  104 (337)
T PLN00194         82 GVTYKLPP--NNGPNSLHGGPKGFS  104 (337)
T ss_pred             CEEEEecc--CCCCcccCCCCcccC
Confidence              444443  345799999987765


No 8  
>cd09019 galactose_mutarotase_like galactose mutarotase_like. Galactose mutarotase catalyzes the conversion of beta-D-galactose to alpha-D-galactose. Beta-D-galactose is produced by the degradation of lactose, a disaccharide composed of beta-D-glucose and beta-D-galactose. This epimerization reaction is the first step in the four-step Leloir pathway, which converts galactose into metabolically important glucose. This epimerization step is followed by the phosophorylation of alpha-D-galactose by galactokinase, an enzyme which can only act on the alpha anomer. A glutamate and a histidine residue of the galactose mutarotase have been shown to be critical for catalysis, the glutamate serves as the active site base to initiate the reaction by removing the proton from the C-1 hydroxyl group of the sugar substrate, and the histidine as the active site acid to protonate the C-5 ring oxygen. Galactose mutarotase is a member of the aldose-1-epimerase superfamily.
Probab=99.29  E-value=8.4e-12  Score=109.09  Aligned_cols=83  Identities=34%  Similarity=0.673  Sum_probs=70.3

Q ss_pred             EEEEEcCCCeEEEEecCCcEEEEEEeeCCCCcccceEeCcCCchhhh----hhhhccccccceecc--------eeccCc
Q psy11903         30 RFTLTNSQRMSVQVIDYGATITTIKVPDKRGNVDDVVLGFDDMREEI----YFIMVCSKCEKKLGK--------VITPDN   97 (179)
Q Consensus        30 ~~tL~n~~gl~v~vlnyGAtI~sl~vpdr~G~~~dVVLGfd~~e~Y~----~~gmvc~kc~~klg~--------va~pd~   97 (179)
                      +|+|+|+++++|+|+++||+|++|.+++++|..++|||||+++++|+    +++++.++.++||..        .++.++
T Consensus         1 ~~~l~n~~~~~~~i~~~GA~l~~l~~~~~~g~~~~~v~~~~~~~~~~~~~~~~g~~lgp~anRi~~g~~~~~G~~y~l~~   80 (326)
T cd09019           1 LYTLTNGNGLRVSILNYGATIQSLKVPDKNGKLRDVVLGFDDLEDYLKNSPYFGATVGRVANRIANGRFTLDGKTYQLEA   80 (326)
T ss_pred             CEEEECCCCcEEEEECcCcEEEEEEEECCCCCEeeeEECCCCHHHHhhCCCccCCcccCcCCeecCCEEEECCEEEEccC
Confidence            37899966899999999999999999998898899999999999998    578889999999863        455553


Q ss_pred             cCCCCCccccCCceecc
Q psy11903         98 WKSGSRNTIESGGRRIG  114 (179)
Q Consensus        98 ~k~~~~n~l~gG~~gi~  114 (179)
                       + .++|+||||..|+.
T Consensus        81 -N-e~~~~LHGg~~G~~   95 (326)
T cd09019          81 -N-EGPNHLHGGPKGFD   95 (326)
T ss_pred             -C-CCCcccCCCCcccc
Confidence             4 44899999986764


No 9  
>COG2017 GalM Galactose mutarotase and related enzymes [Carbohydrate transport and metabolism]
Probab=98.97  E-value=1.9e-09  Score=94.23  Aligned_cols=90  Identities=32%  Similarity=0.539  Sum_probs=75.1

Q ss_pred             cccceeccCCCceecEEEEEEEcCCCeEEEEecCCcEEEEEEeeCCCCcccceEeCcCCchhhh----hhhhccccccce
Q psy11903         13 KFGECINESNGQVLPVRRFTLTNSQRMSVQVIDYGATITTIKVPDKRGNVDDVVLGFDDMREEI----YFIMVCSKCEKK   88 (179)
Q Consensus        13 ~FG~~~~~~~G~~~~v~~~tL~n~~gl~v~vlnyGAtI~sl~vpdr~G~~~dVVLGfd~~e~Y~----~~gmvc~kc~~k   88 (179)
                      .|+..+   +|.  .+..+++.|+.++.+.|.+|||+|++|++   +|  ++||||+++.++|.    +.+++.++.++|
T Consensus         2 ~~~~~~---~~~--~~~~i~~~~~~~~~~~~~~~GA~l~~l~~---~~--~~v~l~~~~~~~~~~~~~~~ga~l~p~anR   71 (308)
T COG2017           2 PFGAAP---DGQ--PVRLLTLGNGGGMVVTVPDWGATLTSLRV---NG--RNLLLGFDDAESYPATRGYGGAILGPYANR   71 (308)
T ss_pred             cccccc---CCC--ceEEEEEeCCCeEEEEEccCCcEEEEEEE---CC--ceEEeecCCHHHhccccccccceecCccCc
Confidence            355444   777  89999999988999999999999999999   45  79999999999998    356899999999


Q ss_pred             ecc--------eeccCccCCCCCccccCCceecc
Q psy11903         89 LGK--------VITPDNWKSGSRNTIESGGRRIG  114 (179)
Q Consensus        89 lg~--------va~pd~~k~~~~n~l~gG~~gi~  114 (179)
                      |..        .+++.+ ++ +.|++|||.+++.
T Consensus        72 I~~g~f~~~G~~y~L~~-N~-~~~~lHG~~~~~~  103 (308)
T COG2017          72 ISNGRFTLDGKTYQLPP-NE-GGNALHGGARDFD  103 (308)
T ss_pred             ccCCEEEECCEEEEeCC-CC-CCccccCCccCCC
Confidence            853        777775 55 7899999987653


No 10 
>PRK15172 putative aldose-1-epimerase; Provisional
Probab=98.33  E-value=1.7e-06  Score=75.25  Aligned_cols=75  Identities=12%  Similarity=0.127  Sum_probs=58.2

Q ss_pred             EEEEEEEcCCCeEEEEecCCcEEEEEEeeCCCCcccceEeCcCCchhhh--hhhhccccccceecc--------eeccCc
Q psy11903         28 VRRFTLTNSQRMSVQVIDYGATITTIKVPDKRGNVDDVVLGFDDMREEI--YFIMVCSKCEKKLGK--------VITPDN   97 (179)
Q Consensus        28 v~~~tL~n~~gl~v~vlnyGAtI~sl~vpdr~G~~~dVVLGfd~~e~Y~--~~gmvc~kc~~klg~--------va~pd~   97 (179)
                      -..++|+|+ .++|+|++|||+|++|++.   |  .+||||++. ++|.  ++|.+-+++++||..        .+..++
T Consensus        10 ~~~~~l~~~-~~~v~i~~~Ga~i~~l~~~---~--~~vv~~~~~-~~~~~~~~g~~L~P~anRI~~g~f~~~G~~y~L~~   82 (300)
T PRK15172         10 GQTISLAAG-DYQATIVTVGAGLAELTFQ---G--RHLVIPHKP-EEMPLAHLGKVLIPWPNRIANGCYRYQGQEYQLPI   82 (300)
T ss_pred             cCEEEEeCC-CEEEEEecCCcEEEEEEEC---C--EEEEecCCc-cccCccccccEecccCCeecCCEEEECCEEEECCC
Confidence            346889985 7999999999999999983   4  489999975 6665  577888999999863        555554


Q ss_pred             cCCC-CCccccCCc
Q psy11903         98 WKSG-SRNTIESGG  110 (179)
Q Consensus        98 ~k~~-~~n~l~gG~  110 (179)
                       |++ ..|.+|||-
T Consensus        83 -N~~~~~~~lHG~~   95 (300)
T PRK15172         83 -NEHVSKAAIHGLL   95 (300)
T ss_pred             -CCCCCCcccCCCc
Confidence             432 478899974


No 11 
>PF01263 Aldose_epim:  Aldose 1-epimerase;  InterPro: IPR008183 Aldose 1-epimerase (5.1.3.3 from EC) (mutarotase) is the enzyme responsible for the anomeric interconversion of D-glucose and other aldoses between their alpha- and beta-forms. The sequence of mutarotase from two bacteria, Acinetobacter calcoaceticus and Streptococcus thermophilus is available []. It has also been shown that, on the basis of extensive sequence similarities, a mutarotase domain seems to be present in the C-terminal half of the fungal GAL10 protein which encodes, in the N-terminal part, UDP-glucose 4-epimerase.; GO: 0016853 isomerase activity, 0005975 carbohydrate metabolic process; PDB: 1YGA_A 3DCD_A 2CIQ_A 2CIS_A 2CIR_A 2HTB_C 2HTA_B 3Q1N_A 1NSZ_B 1NSR_B ....
Probab=98.01  E-value=1.7e-05  Score=67.07  Aligned_cols=80  Identities=19%  Similarity=0.141  Sum_probs=60.4

Q ss_pred             EEEEEEcCCCeEEEEecCCcEEEEEEeeCCCCcccceEeCcCCchhhhhh---hhccccccceec--------ceeccCc
Q psy11903         29 RRFTLTNSQRMSVQVIDYGATITTIKVPDKRGNVDDVVLGFDDMREEIYF---IMVCSKCEKKLG--------KVITPDN   97 (179)
Q Consensus        29 ~~~tL~n~~gl~v~vlnyGAtI~sl~vpdr~G~~~dVVLGfd~~e~Y~~~---gmvc~kc~~klg--------~va~pd~   97 (179)
                      .+|+|+|+.++++.|..+||.|++|.+++ +  ..+|+.++++.++|...   +.+..+..+||.        +.+..+.
T Consensus         1 ~~itL~n~~~~~~~i~~~Ga~l~s~~~~~-~--~~~~l~~~~~~~~~~~~~~~~~~l~p~~~Ri~~g~~~~~g~~~~l~~   77 (300)
T PF01263_consen    1 DLITLENGNGLSAVIPEYGAELTSLQVKG-N--GREVLWQPDPADAYWSNSFGGPILFPWPNRIRNGRFTFDGKPYCLPW   77 (300)
T ss_dssp             EEEEEEETTSEEEEEETBTTEEEEEEETT-T--TEESB-B-STHHHHHHSTCTTCEECSCSSEEGGGEEEETTEEEEBSS
T ss_pred             CEEEEECCCceEEEEeccCcEEEEEEECC-C--CeEEecCCCChHHhcccccceeeeecccceEECCEEEECCEEEEeee
Confidence            36899997689999999999999999986 4  47999999998888864   567788888873        3444442


Q ss_pred             cCCCCCccccCCcee
Q psy11903         98 WKSGSRNTIESGGRR  112 (179)
Q Consensus        98 ~k~~~~n~l~gG~~g  112 (179)
                       +....|.+||.-+.
T Consensus        78 -~~~~~~~~HG~~~~   91 (300)
T PF01263_consen   78 -NGPYPNPIHGFARN   91 (300)
T ss_dssp             -SBTTTBEETBSGGG
T ss_pred             -ccCCCcCCCCCccc
Confidence             33278999997654


No 12 
>cd09022 Aldose_epim_Ec_YihR Aldose 1-epimerase, similar to Escherichia coli YihR. Proteins similar to Escherichia coli YihR are uncharacterized members of aldose-1-epimerase superfamily. Aldose 1-epimerases or mutarotases are key enzymes of carbohydrate metabolism, catalyzing the interconversion of the alpha- and beta-anomers of hexose sugars such as glucose and galactose. This interconversion is an important step that allows anomer specific metabolic conversion of sugars. Studies of the catalytic mechanism of the best known member of the family, galactose mutarotase, have shown a glutamate and a histidine residue to be critical for catalysis; the glutamate serves as the active site base to initiate the reaction by removing the proton from the C-1 hydroxyl group of the sugar substrate, and the histidine as the active site acid to protonate the C-5 ring oxygen.
Probab=97.76  E-value=5.2e-05  Score=64.74  Aligned_cols=66  Identities=17%  Similarity=0.096  Sum_probs=50.5

Q ss_pred             EEEEecCCcEEEEEEeeCCCCcccceEeCcCCchh-hhhhhhccccccceecc--------eeccCccCCC-CCccccCC
Q psy11903         40 SVQVIDYGATITTIKVPDKRGNVDDVVLGFDDMRE-EIYFIMVCSKCEKKLGK--------VITPDNWKSG-SRNTIESG  109 (179)
Q Consensus        40 ~v~vlnyGAtI~sl~vpdr~G~~~dVVLGfd~~e~-Y~~~gmvc~kc~~klg~--------va~pd~~k~~-~~n~l~gG  109 (179)
                      +|+|+++||+|++|.+   +|  ++||+|+++.+. -.+.|++..++++||..        .+++++ |++ +.|.+||+
T Consensus         2 ~v~i~~~Ga~l~~~~~---~g--~~il~~~~~~~~~~~~~g~~l~p~~nRi~~g~~~~~G~~y~l~~-N~~~~~~~~HG~   75 (284)
T cd09022           2 RAVVTEVGAGLRSLTV---GG--RDLVEPYPADEVPPGAAGQVLAPWPNRIADGRYTFDGVEHQLPI-TEPERGNAIHGL   75 (284)
T ss_pred             EEEEEecCcEEEEEEE---CC--EEEEecCCCccCCccccccEEeeeCCcccCCEEEECCEEEEccC-cCCCCCCCCcCC
Confidence            6899999999999988   45  699999998872 12467899999999863        455553 432 57999997


Q ss_pred             ce
Q psy11903        110 GR  111 (179)
Q Consensus       110 ~~  111 (179)
                      .+
T Consensus        76 ~~   77 (284)
T cd09022          76 VR   77 (284)
T ss_pred             ee
Confidence            64


No 13 
>cd09024 Aldose_epim_lacX Aldose 1-epimerase, similar to Lactococcus lactis lacX. Proteins similar to Lactococcus lactis lacX are uncharacterized members of aldose-1-epimerase superfamily. Aldose 1-epimerases or mutarotases are key enzymes of carbohydrate metabolism, catalyzing the interconversion of the alpha- and beta-anomers of hexose sugars such as glucose and galactose. This interconversion is an important step that allows anomer specific metabolic conversion of sugars. Studies of the catalytic mechanism of the best known member of the family, galactose mutarotase, have shown a glutamate and a histidine residue to be critical for catalysis; the glutamate serves as the active site base to initiate the reaction by removing the proton from the C-1 hydroxyl group of the sugar substrate, and the histidine as the active site acid to protonate the C-5 ring oxygen.
Probab=95.70  E-value=0.019  Score=49.29  Aligned_cols=55  Identities=22%  Similarity=0.154  Sum_probs=40.0

Q ss_pred             EEEEcCCCeEEEEecCCcEEEEEEeeCCCCcccceEeCcCCchhhhhhhhccccccceec
Q psy11903         31 FTLTNSQRMSVQVIDYGATITTIKVPDKRGNVDDVVLGFDDMREEIYFIMVCSKCEKKLG   90 (179)
Q Consensus        31 ~tL~n~~gl~v~vlnyGAtI~sl~vpdr~G~~~dVVLGfd~~e~Y~~~gmvc~kc~~klg   90 (179)
                      |+|+|+ .++++|.++||+|+++++.+ +|  .+++..++ .+.|.....+|.+..+|+.
T Consensus         1 ~~l~n~-~~~a~v~~~Ga~l~s~~~~~-~g--~e~l~~~~-~~~~~~~~p~l~P~~gri~   55 (288)
T cd09024           1 ITLENE-FLTVTISEHGAELTSIKDKK-TG--REYLWQGD-PAYWGRHAPILFPIVGRLK   55 (288)
T ss_pred             CEEECC-cEEEEEeccCcEEEEEEeCC-CC--CEEEeCCC-hHHcCCCCCEEEeeccCCC
Confidence            578986 59999999999999999964 35  57887664 3334333367777777764


No 14 
>cd01081 Aldose_epim aldose 1-epimerase superfamily. Aldose 1-epimerases or mutarotases are key enzymes of carbohydrate metabolism; they catalyze the interconversion of the alpha- and beta-anomers of hexose sugars such as glucose and galactose. This interconversion is an important step that allows anomer specific metabolic conversion of sugars. Studies of the catalytic mechanism of the best known member of the family, galactose mutarotase, have shown a glutamate and a histidine residue to be critical for catalysis; the glutamate serves as the active site base to initiate the reaction by removing the proton from the C-1 hydroxyl group of the sugar substrate and the histidine as the active site acid to protonate the C-5 ring oxygen.
Probab=95.38  E-value=0.037  Score=45.96  Aligned_cols=65  Identities=17%  Similarity=0.122  Sum_probs=46.3

Q ss_pred             EEEEecCCcEEEEEEeeCCCCcccceEeCcCCchhh-----hhhhhccccccceecc--------eeccCccCCCCCccc
Q psy11903         40 SVQVIDYGATITTIKVPDKRGNVDDVVLGFDDMREE-----IYFIMVCSKCEKKLGK--------VITPDNWKSGSRNTI  106 (179)
Q Consensus        40 ~v~vlnyGAtI~sl~vpdr~G~~~dVVLGfd~~e~Y-----~~~gmvc~kc~~klg~--------va~pd~~k~~~~n~l  106 (179)
                      +|+|+++||.|.++++++    ..+|+++++....|     .+.+.++....+|+..        .+.+.  .++..+.+
T Consensus         2 ~~~i~~~Ga~i~~~~~~~----~~~~l~~~~~~~~~~~~~~~~~~~~l~P~~gri~~g~~~~~g~~~~~~--~~~~~~~l   75 (284)
T cd01081           2 VAVIAPRGANIISLKVKG----DVDLLWGYPDAEEYPLAPTGGGGAILFPFANRISDGRYTFDGKQYPLN--EDEGGNAI   75 (284)
T ss_pred             EEEEeCcCcEEEEEEcCC----CceEEecCCChhhhcccCCCCcceEecCcCCcccCCEEeECCEEecCC--CCCCCccc
Confidence            689999999999998863    36999999998876     2455777777777743        11121  23456888


Q ss_pred             cCCc
Q psy11903        107 ESGG  110 (179)
Q Consensus       107 ~gG~  110 (179)
                      ||+-
T Consensus        76 HG~~   79 (284)
T cd01081          76 HGFV   79 (284)
T ss_pred             cCCe
Confidence            9864


No 15 
>PF10217 DUF2039:  Uncharacterized conserved protein (DUF2039);  InterPro: IPR019351  This entry is a region of approximately 100 residues containing three pairs of cysteine residues. The region is conserved from plants to humans but its function is unknown. 
Probab=95.25  E-value=0.0023  Score=47.57  Aligned_cols=41  Identities=37%  Similarity=0.808  Sum_probs=33.4

Q ss_pred             cCCCcccCcccchhhc-ccccCCCccCcccccccCcccccCcc
Q psy11903        126 FNPYTQKFESCKICRQ-KVHQVGSHYCQACAYKKGICAMCGKK  167 (179)
Q Consensus       126 ~~p~~~~~~~c~~ck~-~~~~~~~~yc~~cay~~g~c~mcgk~  167 (179)
                      |-|..+ .++|-.|.+ +|.+.=|..|+.||-..++||.||++
T Consensus        49 YKpLt~-p~kC~~C~qktVk~AYh~iC~~Ca~~~~vCaKC~k~   90 (92)
T PF10217_consen   49 YKPLTQ-PKKCNKCQQKTVKHAYHVICDPCAKELKVCAKCGKP   90 (92)
T ss_pred             cccCCC-CccccccccchHHHHHHHHHHHHHHhhccCcccCCC
Confidence            344443 469999997 66776788999999999999999986


No 16 
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=93.12  E-value=0.023  Score=48.13  Aligned_cols=34  Identities=41%  Similarity=1.117  Sum_probs=28.0

Q ss_pred             ccchhhccc-----ccCCCccCcccc---cccC-cccccCccc
Q psy11903        135 SCKICRQKV-----HQVGSHYCQACA---YKKG-ICAMCGKKL  168 (179)
Q Consensus       135 ~c~~ck~~~-----~~~~~~yc~~ca---y~~g-~c~mcgk~~  168 (179)
                      .|.|||...     ..-||++|..||   |+|| .|-.|||..
T Consensus       198 ~C~iCKkdy~spvvt~CGH~FC~~Cai~~y~kg~~C~~Cgk~t  240 (259)
T COG5152         198 LCGICKKDYESPVVTECGHSFCSLCAIRKYQKGDECGVCGKAT  240 (259)
T ss_pred             eehhchhhccchhhhhcchhHHHHHHHHHhccCCcceecchhh
Confidence            899999753     344899999999   6776 799999864


No 17 
>KOG3241|consensus
Probab=92.28  E-value=0.0096  Score=49.51  Aligned_cols=46  Identities=28%  Similarity=0.755  Sum_probs=37.3

Q ss_pred             ccCCCcccCcccchhhc-ccccCCCccCcccccccCcccccCcccccc
Q psy11903        125 RFNPYTQKFESCKICRQ-KVHQVGSHYCQACAYKKGICAMCGKKLLDV  171 (179)
Q Consensus       125 ~~~p~~~~~~~c~~ck~-~~~~~~~~yc~~cay~~g~c~mcgk~~~d~  171 (179)
                      +|.|.+. ..+|..|++ .|.|.-|+.|..||-+...||-|+|.+.++
T Consensus        60 KYKpLt~-akkC~kC~~r~Vk~aYH~~Cr~CA~e~~vCAKC~ks~~~i  106 (227)
T KOG3241|consen   60 KYKPLTE-AKKCQKCTKRNVKQAYHKLCRGCAKEQKVCAKCCKSVDQI  106 (227)
T ss_pred             cccccch-hHHHHHHHHHHHHHHHHHhcccHHHHHHHHHHHhccHHHh
Confidence            4556554 469999987 778888899999999999999999976543


No 18 
>PF12773 DZR:  Double zinc ribbon
Probab=89.14  E-value=0.26  Score=31.53  Aligned_cols=34  Identities=24%  Similarity=0.646  Sum_probs=20.3

Q ss_pred             cchhhcccccCCCccCcccccccC-------cccccCccccc
Q psy11903        136 CKICRQKVHQVGSHYCQACAYKKG-------ICAMCGKKLLD  170 (179)
Q Consensus       136 c~~ck~~~~~~~~~yc~~cay~~g-------~c~mcgk~~~d  170 (179)
                      |..|.+.+.. ++.||..|-.+-.       +|.-||..+..
T Consensus         1 Cp~Cg~~~~~-~~~fC~~CG~~l~~~~~~~~~C~~Cg~~~~~   41 (50)
T PF12773_consen    1 CPHCGTPNPD-DAKFCPHCGTPLPPPDQSKKICPNCGAENPP   41 (50)
T ss_pred             CCCcCCcCCc-cccCChhhcCChhhccCCCCCCcCCcCCCcC
Confidence            4556666655 5666666655444       57777766543


No 19 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=79.81  E-value=0.95  Score=25.63  Aligned_cols=22  Identities=18%  Similarity=0.694  Sum_probs=16.6

Q ss_pred             cccchhhcccccCCCccCccccc
Q psy11903        134 ESCKICRQKVHQVGSHYCQACAY  156 (179)
Q Consensus       134 ~~c~~ck~~~~~~~~~yc~~cay  156 (179)
                      ..|..|.+.+.. +++||+.|-.
T Consensus         3 ~~Cp~Cg~~~~~-~~~fC~~CG~   24 (26)
T PF13248_consen    3 MFCPNCGAEIDP-DAKFCPNCGA   24 (26)
T ss_pred             CCCcccCCcCCc-ccccChhhCC
Confidence            479999996655 7898887643


No 20 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=79.79  E-value=0.85  Score=25.37  Aligned_cols=20  Identities=20%  Similarity=0.866  Sum_probs=15.1

Q ss_pred             ccchhhcccccCCCccCcccc
Q psy11903        135 SCKICRQKVHQVGSHYCQACA  155 (179)
Q Consensus       135 ~c~~ck~~~~~~~~~yc~~ca  155 (179)
                      .|..|..++.. ++++|+.|-
T Consensus         1 ~Cp~CG~~~~~-~~~fC~~CG   20 (23)
T PF13240_consen    1 YCPNCGAEIED-DAKFCPNCG   20 (23)
T ss_pred             CCcccCCCCCC-cCcchhhhC
Confidence            48889999976 778876654


No 21 
>PF14849 YidC_periplas:  YidC periplasmic domain; PDB: 3BS6_B 3BLC_B.
Probab=79.36  E-value=3.6  Score=34.45  Aligned_cols=37  Identities=22%  Similarity=0.307  Sum_probs=25.5

Q ss_pred             EEEEEcCCCeEEEEecCCcEEEEEEeeCC----CCcccceEe
Q psy11903         30 RFTLTNSQRMSVQVIDYGATITTIKVPDK----RGNVDDVVL   67 (179)
Q Consensus        30 ~~tL~n~~gl~v~vlnyGAtI~sl~vpdr----~G~~~dVVL   67 (179)
                      +++|+|+ -++|+|.+.||.|.++.+++=    ++...+|.|
T Consensus         1 ~v~ven~-~~~~~~s~~GG~i~~~~Lk~y~~~~~~~~~pv~L   41 (270)
T PF14849_consen    1 RVTVEND-LFKVTFSSKGGRIKSVELKKYKNTLDPDSKPVEL   41 (270)
T ss_dssp             -EEEE-S-S-EEEEETBTTEEEEEEEEEEESSTT-SS-EEEE
T ss_pred             CEEEECC-CEEEEEECCCCeEEEEEcCCCccccCCCCCceEE
Confidence            4789995 799999999999999998742    222236777


No 22 
>KOG1813|consensus
Probab=69.70  E-value=2.3  Score=37.93  Aligned_cols=36  Identities=33%  Similarity=0.907  Sum_probs=29.4

Q ss_pred             ccchhhccc-----ccCCCccCcccc---ccc-CcccccCccccc
Q psy11903        135 SCKICRQKV-----HQVGSHYCQACA---YKK-GICAMCGKKLLD  170 (179)
Q Consensus       135 ~c~~ck~~~-----~~~~~~yc~~ca---y~~-g~c~mcgk~~~d  170 (179)
                      +|-||++.-     ..-+|++|-.||   |++ -.|-.|++++.-
T Consensus       243 ~c~icr~~f~~pVvt~c~h~fc~~ca~~~~qk~~~c~vC~~~t~g  287 (313)
T KOG1813|consen  243 KCFICRKYFYRPVVTKCGHYFCEVCALKPYQKGEKCYVCSQQTHG  287 (313)
T ss_pred             cccccccccccchhhcCCceeehhhhccccccCCcceeccccccc
Confidence            899999853     344889999999   777 589999998763


No 23 
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=68.35  E-value=1.3  Score=27.75  Aligned_cols=20  Identities=35%  Similarity=0.936  Sum_probs=16.9

Q ss_pred             CCccCcccccccC----cccccCc
Q psy11903        147 GSHYCQACAYKKG----ICAMCGK  166 (179)
Q Consensus       147 ~~~yc~~cay~~g----~c~mcgk  166 (179)
                      ||.+|+.|+.+.-    .|..|++
T Consensus        21 gH~~C~~C~~~~~~~~~~CP~C~k   44 (44)
T PF14634_consen   21 GHIFCEKCLKKLKGKSVKCPICRK   44 (44)
T ss_pred             CCHHHHHHHHhhcCCCCCCcCCCC
Confidence            7889999998777    8988875


No 24 
>cd09021 Aldose_epim_Ec_YphB aldose 1-epimerase, similar to Escherichia coli YphB. Proteins similar to Escherichia coli YphB are uncharacterized members of the aldose-1-epimerase superfamily. Aldose 1-epimerases or mutarotases are key enzymes of carbohydrate metabolism, catalyzing the interconversion of the alpha- and beta-anomers of hexose sugars such as glucose and galactose. This interconversion is an important step that allows anomer specific metabolic conversion of sugars. Studies of the catalytic mechanism of the best known member of the family, galactose mutarotase, have shown a glutamate and a histidine residue to be critical for catalysis; the glutamate serves as the active site base to initiate the reaction by removing the proton from the C-1 hydroxyl group of the sugar substrate, and the histidine as the active site acid to protonate the C-5 ring oxygen.
Probab=66.94  E-value=12  Score=31.60  Aligned_cols=66  Identities=8%  Similarity=0.152  Sum_probs=39.0

Q ss_pred             EEecCCcEEEEEEeeCCCCcccceEeCcCCchh--hhhhh-hccccccceec--------ceeccCccCCCCCccccCCc
Q psy11903         42 QVIDYGATITTIKVPDKRGNVDDVVLGFDDMRE--EIYFI-MVCSKCEKKLG--------KVITPDNWKSGSRNTIESGG  110 (179)
Q Consensus        42 ~vlnyGAtI~sl~vpdr~G~~~dVVLGfd~~e~--Y~~~g-mvc~kc~~klg--------~va~pd~~k~~~~n~l~gG~  110 (179)
                      .|-.+||.|++|...   |...+++...+ .+.  ....+ .+-.++++||.        +.+...+...++.|.+||+.
T Consensus         4 ~v~~~Ga~l~sl~~~---~~~~~~l~~~~-~~~~~~~~~~~p~LfP~~gRi~~~~~~~~g~~y~l~~n~~~~~~~~HG~a   79 (273)
T cd09021           4 LAPELGGSIAALTSR---GDPTPLLRPAD-PDAADALAMACFPLVPFSNRIRGGRFLFAGREVALPPNTADEPHPLHGDG   79 (273)
T ss_pred             eCCCCCceEEEEEeC---CCcceeeecCC-ccccCcccccCceEeccCCcccCCcEeECCEEEecCCCCCCCccCcccch
Confidence            355689999999884   33367877543 222  11222 45556677765        35555542224678899975


Q ss_pred             e
Q psy11903        111 R  111 (179)
Q Consensus       111 ~  111 (179)
                      +
T Consensus        80 r   80 (273)
T cd09021          80 W   80 (273)
T ss_pred             h
Confidence            4


No 25 
>TIGR03593 yidC_nterm membrane protein insertase, YidC/Oxa1 family, N-terminal domain. Essentially all bacteria have a member of the YidC family, whose C-terminal domain is modeled by TIGR03592. The two copies are found in endospore-forming bacteria such as Bacillus subtilis appear redundant during vegetative growth, although the member designated spoIIIJ (stage III sporulation protein J) has a distinct role in spore formation. YidC, its mitochondrial homolog Oxa1, and its chloroplast homolog direct insertion into the bacterial/organellar inner (or only) membrane. This model describes an N-terminal sequence region, including a large periplasmic domain lacking in YidC members from Gram-positive species. The multifunctional YidC protein acts both with and independently of the Sec system.
Probab=64.86  E-value=8.3  Score=34.16  Aligned_cols=29  Identities=14%  Similarity=0.373  Sum_probs=25.8

Q ss_pred             EEEEEEEcCCCeEEEEecCCcEEEEEEeeC
Q psy11903         28 VRRFTLTNSQRMSVQVIDYGATITTIKVPD   57 (179)
Q Consensus        28 v~~~tL~n~~gl~v~vlnyGAtI~sl~vpd   57 (179)
                      .++++|+|+ -++++|.+.||+|.++.+++
T Consensus        73 ~~~i~v~td-~~~~~is~~Gg~i~~~~Lk~  101 (366)
T TIGR03593        73 AKRITVKTD-VLRASISTKGGDIDSLELKK  101 (366)
T ss_pred             CCeEEEECC-eEEEEEeCCCceeeeecccc
Confidence            457999996 79999999999999999875


No 26 
>PF07191 zinc-ribbons_6:  zinc-ribbons;  InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length. Members of this family 8 highly conserved cysteine residues. The function of the family is unknown.; PDB: 2JRP_A 2JNE_A.
Probab=61.18  E-value=2.3  Score=30.10  Aligned_cols=37  Identities=32%  Similarity=0.773  Sum_probs=22.4

Q ss_pred             ccchhhcccccCC-CccCcccc---cccCcccccCcccccc
Q psy11903        135 SCKICRQKVHQVG-SHYCQACA---YKKGICAMCGKKLLDV  171 (179)
Q Consensus       135 ~c~~ck~~~~~~~-~~yc~~ca---y~~g~c~mcgk~~~d~  171 (179)
                      .|..|.+.+...+ ..+|..|.   -+.+.|.-||..+--.
T Consensus         3 ~CP~C~~~L~~~~~~~~C~~C~~~~~~~a~CPdC~~~Le~L   43 (70)
T PF07191_consen    3 TCPKCQQELEWQGGHYHCEACQKDYKKEAFCPDCGQPLEVL   43 (70)
T ss_dssp             B-SSS-SBEEEETTEEEETTT--EEEEEEE-TTT-SB-EEE
T ss_pred             cCCCCCCccEEeCCEEECccccccceecccCCCcccHHHHH
Confidence            6888998886655 66788886   3567899998887543


No 27 
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=59.67  E-value=3.7  Score=26.74  Aligned_cols=23  Identities=22%  Similarity=0.353  Sum_probs=18.2

Q ss_pred             CCccCccccc----ccCcccccCcccc
Q psy11903        147 GSHYCQACAY----KKGICAMCGKKLL  169 (179)
Q Consensus       147 ~~~yc~~cay----~~g~c~mcgk~~~  169 (179)
                      |+.||..|.-    +.+.|.+||+.+.
T Consensus        20 G~v~~~~~i~~~~~~~~~cP~~~~~~~   46 (63)
T smart00504       20 GQTYERRAIEKWLLSHGTDPVTGQPLT   46 (63)
T ss_pred             CCEEeHHHHHHHHHHCCCCCCCcCCCC
Confidence            7788888764    3678999999873


No 28 
>PF06750 DiS_P_DiS:  Bacterial Peptidase A24 N-terminal domain;  InterPro: IPR010627 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Aspartic endopeptidases 3.4.23. from EC of vertebrate, fungal and retroviral origin have been characterised []. More recently, aspartic endopeptidases associated with the processing of bacterial type 4 prepilin [] and archaean preflagellin have been described [, ]. Structurally, aspartic endopeptidases are bilobal enzymes, each lobe contributing a catalytic Asp residue, with an extended active site cleft localised between the two lobes of the molecule. One lobe has probably evolved from the other through a gene duplication event in the distant past. In modern-day enzymes, although the three-dimensional structures are very similar, the amino acid sequences are more divergent, except for the catalytic site motif, which is very conserved. The presence and position of disulphide bridges are other conserved features of aspartic peptidases. All or most aspartate peptidases are endopeptidases. These enzymes have been assigned into clans (proteins which are evolutionary related), and further sub-divided into families, largely on the basis of their tertiary structure. This domain is found at the N terminus of bacterial aspartic peptidases belonging to MEROPS peptidase family A24 (clan AD), subfamily A24A (type IV prepilin peptidase, IPR000045 from INTERPRO). It's function has not been specifically determined; however some of the family have been characterised as bifunctional [], and this domain may contain the N-methylation activity. The domain consists of an intracellular region between a pair of transmembrane domains. This intracellular region contains an invariant proline and four conserved cysteines. These Cys residues are arranged in a two-pair motif, with the Cys residues of a pair separated (usually) by 2 aa and with each pair separated by 21 largely hydrophilic residues (C-X-X-C...X21...C-X-X-C); they have been shown to be essential to the overall function of the enzyme [, ].   The bifunctional enzyme prepilin peptidase (PilD) from Pseudomonas aeruginosa is a key determinant in both type-IV pilus biogenesis and extracellular protein secretion, in its roles as a leader peptidase and methyl transferase (MTase). It is responsible for endopeptidic cleavage of the unique leader peptides that characterise type-IV pilin precursors, as well as proteins with homologous leader sequences that are essential components of the general secretion pathway found in a variety of Gram-negative pathogens. Following removal of the leader peptides, the same enzyme is responsible for the second posttranslational modification that characterises the type-IV pilins and their homologues, namely N-methylation of the newly exposed N-terminal amino acid residue []. 
Probab=58.90  E-value=3.4  Score=30.29  Aligned_cols=37  Identities=16%  Similarity=0.320  Sum_probs=24.3

Q ss_pred             CcccchhhcccccCCCccCcccccccCcccccCcccc
Q psy11903        133 FESCKICRQKVHQVGSHYCQACAYKKGICAMCGKKLL  169 (179)
Q Consensus       133 ~~~c~~ck~~~~~~~~~yc~~cay~~g~c~mcgk~~~  169 (179)
                      .|.|..|++++.--.--===+=-..+|.|.-|+++|.
T Consensus        33 rS~C~~C~~~L~~~~lIPi~S~l~lrGrCr~C~~~I~   69 (92)
T PF06750_consen   33 RSHCPHCGHPLSWWDLIPILSYLLLRGRCRYCGAPIP   69 (92)
T ss_pred             CCcCcCCCCcCcccccchHHHHHHhCCCCcccCCCCC
Confidence            4899999999875211000011357899999999885


No 29 
>KOG2272|consensus
Probab=57.16  E-value=6.9  Score=34.50  Aligned_cols=51  Identities=31%  Similarity=0.705  Sum_probs=38.1

Q ss_pred             ceeeeecccccCCCcccCcccchhhccccc-----CCCccCcccccccC--cccccCcccc
Q psy11903        116 NKALTASKARFNPYTQKFESCKICRQKVHQ-----VGSHYCQACAYKKG--ICAMCGKKLL  169 (179)
Q Consensus       116 nk~l~~~k~~~~p~~~~~~~c~~ck~~~~~-----~~~~yc~~cay~~g--~c~mcgk~~~  169 (179)
                      +.+|.-   |-+||-.|.-+|..|+..+..     .|.-||..|--+-|  ||--|-+.|-
T Consensus       149 ~~~l~f---r~d~yH~yHFkCt~C~keL~sdaRevk~eLyClrChD~mgipiCgaC~rpIe  206 (332)
T KOG2272|consen  149 EQPLTF---RGDPYHPYHFKCTTCGKELTSDAREVKGELYCLRCHDKMGIPICGACRRPIE  206 (332)
T ss_pred             cccccc---cCCCCCccceecccccccccchhhhhccceeccccccccCCcccccccCchH
Confidence            477743   667888888899999987753     36789999987655  6776766664


No 30 
>KOG0320|consensus
Probab=54.82  E-value=3.3  Score=34.47  Aligned_cols=36  Identities=33%  Similarity=0.843  Sum_probs=27.0

Q ss_pred             cccchhhccccc-------CCCccCcccc---ccc-CcccccCcccc
Q psy11903        134 ESCKICRQKVHQ-------VGSHYCQACA---YKK-GICAMCGKKLL  169 (179)
Q Consensus       134 ~~c~~ck~~~~~-------~~~~yc~~ca---y~~-g~c~mcgk~~~  169 (179)
                      -+|.||--.+.+       =||-+|..|+   .++ ..|..|+|||.
T Consensus       132 ~~CPiCl~~~sek~~vsTkCGHvFC~~Cik~alk~~~~CP~C~kkIt  178 (187)
T KOG0320|consen  132 YKCPICLDSVSEKVPVSTKCGHVFCSQCIKDALKNTNKCPTCRKKIT  178 (187)
T ss_pred             cCCCceecchhhccccccccchhHHHHHHHHHHHhCCCCCCcccccc
Confidence            489999654433       3788999996   343 48999999986


No 31 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=54.65  E-value=6.5  Score=22.48  Aligned_cols=22  Identities=27%  Similarity=0.957  Sum_probs=17.0

Q ss_pred             ccchhhcccccCCCccCcccccc
Q psy11903        135 SCKICRQKVHQVGSHYCQACAYK  157 (179)
Q Consensus       135 ~c~~ck~~~~~~~~~yc~~cay~  157 (179)
                      .|..|.+.|.. .++.|..|-|.
T Consensus         2 ~CP~C~~~V~~-~~~~Cp~CG~~   23 (26)
T PF10571_consen    2 TCPECGAEVPE-SAKFCPHCGYD   23 (26)
T ss_pred             cCCCCcCCchh-hcCcCCCCCCC
Confidence            68899999987 67877777653


No 32 
>PRK12496 hypothetical protein; Provisional
Probab=54.25  E-value=5.8  Score=31.96  Aligned_cols=21  Identities=29%  Similarity=1.051  Sum_probs=15.5

Q ss_pred             ccCcccc--c----ccCcccccCcccc
Q psy11903        149 HYCQACA--Y----KKGICAMCGKKLL  169 (179)
Q Consensus       149 ~yc~~ca--y----~~g~c~mcgk~~~  169 (179)
                      ++|++|-  |    ....|.+||-++.
T Consensus       128 ~~C~gC~~~~~~~~~~~~C~~CG~~~~  154 (164)
T PRK12496        128 KVCKGCKKKYPEDYPDDVCEICGSPVK  154 (164)
T ss_pred             EECCCCCccccCCCCCCcCCCCCChhh
Confidence            5577776  5    4467999998875


No 33 
>PF13920 zf-C3HC4_3:  Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A ....
Probab=53.81  E-value=2.7  Score=26.73  Aligned_cols=37  Identities=27%  Similarity=0.770  Sum_probs=23.8

Q ss_pred             ccchhhcccc-----cCCCc-cCccccccc----CcccccCcccccc
Q psy11903        135 SCKICRQKVH-----QVGSH-YCQACAYKK----GICAMCGKKLLDV  171 (179)
Q Consensus       135 ~c~~ck~~~~-----~~~~~-yc~~cay~~----g~c~mcgk~~~d~  171 (179)
                      .|.+|.....     .=||. +|..|+.+-    ..|.+|-++|.++
T Consensus         4 ~C~iC~~~~~~~~~~pCgH~~~C~~C~~~~~~~~~~CP~Cr~~i~~V   50 (50)
T PF13920_consen    4 ECPICFENPRDVVLLPCGHLCFCEECAERLLKRKKKCPICRQPIESV   50 (50)
T ss_dssp             B-TTTSSSBSSEEEETTCEEEEEHHHHHHHHHTTSBBTTTTBB-SEE
T ss_pred             CCccCCccCCceEEeCCCChHHHHHHhHHhcccCCCCCcCChhhcCC
Confidence            4555555422     22566 888888766    8999999988753


No 34 
>TIGR00599 rad18 DNA repair protein rad18. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=51.55  E-value=6  Score=36.50  Aligned_cols=36  Identities=19%  Similarity=0.606  Sum_probs=27.6

Q ss_pred             cccchhhcccccC-----CCccCccccc----ccCcccccCcccc
Q psy11903        134 ESCKICRQKVHQV-----GSHYCQACAY----KKGICAMCGKKLL  169 (179)
Q Consensus       134 ~~c~~ck~~~~~~-----~~~yc~~cay----~~g~c~mcgk~~~  169 (179)
                      -.|.||+.-+..+     ||.||..|..    ..+.|.+|...+.
T Consensus        27 l~C~IC~d~~~~PvitpCgH~FCs~CI~~~l~~~~~CP~Cr~~~~   71 (397)
T TIGR00599        27 LRCHICKDFFDVPVLTSCSHTFCSLCIRRCLSNQPKCPLCRAEDQ   71 (397)
T ss_pred             cCCCcCchhhhCccCCCCCCchhHHHHHHHHhCCCCCCCCCCccc
Confidence            3788887655433     9999999986    3468999998765


No 35 
>KOG3799|consensus
Probab=51.30  E-value=6.8  Score=31.48  Aligned_cols=36  Identities=31%  Similarity=0.725  Sum_probs=24.5

Q ss_pred             Ccccchhhc-ccccCCCccCcccccccCcccccCccccc
Q psy11903        133 FESCKICRQ-KVHQVGSHYCQACAYKKGICAMCGKKLLD  170 (179)
Q Consensus       133 ~~~c~~ck~-~~~~~~~~yc~~cay~~g~c~mcgk~~~d  170 (179)
                      -..|-||-. +...--.|-|..|-.+  .||.||-++.-
T Consensus        65 datC~IC~KTKFADG~GH~C~YCq~r--~CARCGGrv~l  101 (169)
T KOG3799|consen   65 DATCGICHKTKFADGCGHNCSYCQTR--FCARCGGRVSL  101 (169)
T ss_pred             CcchhhhhhcccccccCcccchhhhh--HHHhcCCeeee
Confidence            458999954 5554335667666544  79999987753


No 36 
>PF06906 DUF1272:  Protein of unknown function (DUF1272);  InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length. This family contains a number of conserved cysteine residues and its function is unknown.
Probab=49.64  E-value=7.2  Score=26.59  Aligned_cols=36  Identities=28%  Similarity=0.854  Sum_probs=27.1

Q ss_pred             cccchhhcccccCC---------CccCccccccc--CcccccCcccc
Q psy11903        134 ESCKICRQKVHQVG---------SHYCQACAYKK--GICAMCGKKLL  169 (179)
Q Consensus       134 ~~c~~ck~~~~~~~---------~~yc~~cay~~--g~c~mcgk~~~  169 (179)
                      ..|..|.+.+.++.         -.||..||-..  ++|.-||=.+.
T Consensus         6 pnCE~C~~dLp~~s~~A~ICSfECTFC~~C~e~~l~~~CPNCgGelv   52 (57)
T PF06906_consen    6 PNCECCDKDLPPDSPEAYICSFECTFCADCAETMLNGVCPNCGGELV   52 (57)
T ss_pred             CCccccCCCCCCCCCcceEEeEeCcccHHHHHHHhcCcCcCCCCccc
Confidence            46888888887744         25788888665  99999996553


No 37 
>PF05715 zf-piccolo:  Piccolo Zn-finger;  InterPro: IPR008899 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This (predicted) zinc finger is found in the bassoon and piccolo proteins, both of which are components of the presynaptic cytoskeletal matrix (PCM) assembled at the active zone of neurotransmitter release, where Piccolo plays a role in the trafficking of synaptic vesicles (SVs) [, , ]. The Piccolo zinc fingers were found to interact with the dual prenylated rab3A and VAMP2/Synaptobrevin II receptor PRA1. There are eight conserved cysteines in Piccolo-type zinc fingers, suggesting that they coordinates two zinc ligands. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding, 0045202 synapse
Probab=48.52  E-value=6.8  Score=27.02  Aligned_cols=32  Identities=25%  Similarity=0.850  Sum_probs=15.6

Q ss_pred             cccchhhccccc-----CCCccCcccccccCcccccCcc
Q psy11903        134 ESCKICRQKVHQ-----VGSHYCQACAYKKGICAMCGKK  167 (179)
Q Consensus       134 ~~c~~ck~~~~~-----~~~~yc~~cay~~g~c~mcgk~  167 (179)
                      +.|..||+.+.-     +...-|..|  |+-+|.+||-.
T Consensus         3 ~~CPlCkt~~n~gsk~~pNyntCT~C--k~~VCnlCGFN   39 (61)
T PF05715_consen    3 SLCPLCKTTLNVGSKDPPNYNTCTEC--KSQVCNLCGFN   39 (61)
T ss_pred             ccCCcccchhhcCCCCCCCccHHHHH--hhhhhcccCCC
Confidence            355666654421     122234444  34477888753


No 38 
>PRK01318 membrane protein insertase; Provisional
Probab=47.86  E-value=37  Score=32.37  Aligned_cols=27  Identities=15%  Similarity=0.298  Sum_probs=24.9

Q ss_pred             EEEEEcCCCeEEEEecCCcEEEEEEeeC
Q psy11903         30 RFTLTNSQRMSVQVIDYGATITTIKVPD   57 (179)
Q Consensus        30 ~~tL~n~~gl~v~vlnyGAtI~sl~vpd   57 (179)
                      +++++|+ -++++|.+.||+|.++.+++
T Consensus        40 ~i~v~td-~~~~~is~~Gg~i~~~~Lk~   66 (521)
T PRK01318         40 RITVETD-VLRLSIDTKGGRIDDLLLKK   66 (521)
T ss_pred             EEEEEcC-cEEEEEECCCCeeeeeeccC
Confidence            8999996 79999999999999999875


No 39 
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=45.19  E-value=17  Score=20.80  Aligned_cols=9  Identities=56%  Similarity=1.250  Sum_probs=4.8

Q ss_pred             cccccCccc
Q psy11903        160 ICAMCGKKL  168 (179)
Q Consensus       160 ~c~mcgk~~  168 (179)
                      .|+.|++.|
T Consensus        29 ~C~~C~~~L   37 (39)
T smart00132       29 KCSKCGKPL   37 (39)
T ss_pred             CCcccCCcC
Confidence            355555554


No 40 
>PF03660 PHF5:  PHF5-like protein;  InterPro: IPR005345 Phf5 is a member of a novel murine multigene family that is highly conserved during evolution and belongs to the superfamily of PHD-finger proteins. At least one example, from Mus musculus (Mouse), may act as a chromatin-associated protein []. The Schizosaccharomyces pombe (Fission yeast) ini1 gene is essential, required for splicing []. It is localised in the nucleus, but not detected in the nucleolus and can be complemented by human ini1 []. The proteins of this family contain five CXXC motifs.; PDB: 2K0A_A.
Probab=45.18  E-value=5.7  Score=30.27  Aligned_cols=26  Identities=23%  Similarity=0.487  Sum_probs=15.2

Q ss_pred             cccCcccchhhcccccCCCccCcccc
Q psy11903        130 TQKFESCKICRQKVHQVGSHYCQACA  155 (179)
Q Consensus       130 ~~~~~~c~~ck~~~~~~~~~yc~~ca  155 (179)
                      +.+..+|.+|........+.||..|-
T Consensus        52 G~~~~rCIiCg~~~g~sdAYYC~eC~   77 (106)
T PF03660_consen   52 GSLQGRCIICGSGPGVSDAYYCWECV   77 (106)
T ss_dssp             SSTTSB-TTTSSSB--EE-EE-HHHH
T ss_pred             CCcCceEEEecCCCCcccceehhhhH
Confidence            34457999999555445689999983


No 41 
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional
Probab=44.37  E-value=8  Score=32.38  Aligned_cols=36  Identities=28%  Similarity=0.799  Sum_probs=27.6

Q ss_pred             ccchhhccccc-----CCCccCcccccc--------------------cCcccccCccccc
Q psy11903        135 SCKICRQKVHQ-----VGSHYCQACAYK--------------------KGICAMCGKKLLD  170 (179)
Q Consensus       135 ~c~~ck~~~~~-----~~~~yc~~cay~--------------------~g~c~mcgk~~~d  170 (179)
                      .|.||...+..     =||.||..|.++                    ...|.+|...|..
T Consensus        20 ~CpICld~~~dPVvT~CGH~FC~~CI~~wl~~s~~s~~~~~~~~~~k~~~~CPvCR~~Is~   80 (193)
T PLN03208         20 DCNICLDQVRDPVVTLCGHLFCWPCIHKWTYASNNSRQRVDQYDHKREPPKCPVCKSDVSE   80 (193)
T ss_pred             CCccCCCcCCCcEEcCCCchhHHHHHHHHHHhccccccccccccccCCCCcCCCCCCcCCh
Confidence            79999764433     389999999963                    3579999998864


No 42 
>cd04476 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds corresponding to the C-terminal OB fold, the ssDNA-binding domain (DBD)-C, of human RPA1 (also called RPA70). RPA1 is the large subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). In addition to DBD-C, RPA1 contains three other OB folds: DBD-A, DBD-B, and RPA1N. The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B. RPA1 DBD-C is involved in DNA binding and trimerization. It contains two structural insertions not found to date in other OB-folds: a zinc ribbon and a three-helix bundle. RPA1 DBD-C also contains a Cys4-type zinc-binding motif, which plays a role in the ssDNA binding fun
Probab=44.09  E-value=9.4  Score=30.05  Aligned_cols=22  Identities=32%  Similarity=0.881  Sum_probs=15.6

Q ss_pred             CcccchhhcccccCC--CccCccc
Q psy11903        133 FESCKICRQKVHQVG--SHYCQAC  154 (179)
Q Consensus       133 ~~~c~~ck~~~~~~~--~~yc~~c  154 (179)
                      -..|..|+.+|.+.+  ..+|..|
T Consensus        34 Y~aC~~C~kkv~~~~~~~~~C~~C   57 (166)
T cd04476          34 YPACPGCNKKVVEEGNGTYRCEKC   57 (166)
T ss_pred             EccccccCcccEeCCCCcEECCCC
Confidence            459999999998753  4445444


No 43 
>PF14471 DUF4428:  Domain of unknown function (DUF4428)
Probab=43.79  E-value=11  Score=24.77  Aligned_cols=16  Identities=50%  Similarity=0.939  Sum_probs=11.5

Q ss_pred             cccccCcccccccccc
Q psy11903        160 ICAMCGKKLLDVKNYK  175 (179)
Q Consensus       160 ~c~mcgk~~~d~~~~~  175 (179)
                      +|+.||+++--.+..+
T Consensus         1 ~C~iCg~kigl~~~~k   16 (51)
T PF14471_consen    1 KCAICGKKIGLFKRFK   16 (51)
T ss_pred             CCCcccccccccccee
Confidence            5899999887555443


No 44 
>cd09020 D-hex-6-P-epi_like D-hexose-6-phosphate epimerase-like. D-Hexose-6-phosphate epimerase Ymr099c from Saccharomyces cerevisiae belongs to the large superfamily of aldose-1-epimerases. Its active site is very similar to the catalytic site of galactose mutarotase, the best studied member of the superfamily. It also contains the conserved glutamate and histidine residues that have been shown in galactose mutarotase to be critical for catalysis, the glutamate serving as the active site base to initiate the reaction by removing the proton from the C-1 hydroxyl group of the sugar substrate, and the histidine as the active site acid to protonate the C-5 ring oxygen. In addition Ymr099c contains 2 conserved arginine residues which are involved in phosphate binding, and exhibits hexose-6-phosphate mutarotase activity on glucose-6-P, galactose-6-P and mannose-6-P.
Probab=42.05  E-value=47  Score=28.22  Aligned_cols=32  Identities=22%  Similarity=0.335  Sum_probs=25.1

Q ss_pred             EEEEcCCCeEEEEecCCcEEEEEEeeCCCCcccceEe
Q psy11903         31 FTLTNSQRMSVQVIDYGATITTIKVPDKRGNVDDVVL   67 (179)
Q Consensus        31 ~tL~n~~gl~v~vlnyGAtI~sl~vpdr~G~~~dVVL   67 (179)
                      ++|+++ +.+++|..+||.|.++....  |  .+++-
T Consensus         2 i~i~~~-~~~a~i~~~Ga~l~s~~~~~--~--~~~L~   33 (269)
T cd09020           2 IVLDHP-GASAEIALQGAQVLSWKPKG--G--QDLLW   33 (269)
T ss_pred             EEEeCC-CceEEEECCCcEEEEEeCCC--C--ceeEE
Confidence            568885 89999999999999998752  2  45653


No 45 
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=37.47  E-value=15  Score=24.74  Aligned_cols=14  Identities=43%  Similarity=0.990  Sum_probs=10.4

Q ss_pred             cccCcccccCcccc
Q psy11903        156 YKKGICAMCGKKLL  169 (179)
Q Consensus       156 y~~g~c~mcgk~~~  169 (179)
                      |...+|..||+++.
T Consensus         3 ~~~~~C~~Cg~~~~   16 (54)
T PF14446_consen    3 YEGCKCPVCGKKFK   16 (54)
T ss_pred             ccCccChhhCCccc
Confidence            56677888888774


No 46 
>TIGR00375 conserved hypothetical protein TIGR00375. The member of this family from Methanococcus jannaschii, MJ0043, is considerably longer and appears to contain an intein N-terminal to the region of homology.
Probab=37.05  E-value=14  Score=33.77  Aligned_cols=38  Identities=16%  Similarity=0.477  Sum_probs=23.7

Q ss_pred             ccCCCc-cc-CcccchhhcccccCCCccCcccccccCcccccCcccc
Q psy11903        125 RFNPYT-QK-FESCKICRQKVHQVGSHYCQACAYKKGICAMCGKKLL  169 (179)
Q Consensus       125 ~~~p~~-~~-~~~c~~ck~~~~~~~~~yc~~cay~~g~c~mcgk~~~  169 (179)
                      -|+|-- .| ...|+.|...+....+.     ++ .++|+ ||++|.
T Consensus       230 g~~P~~GKYh~~~c~~C~~~~~~~~~~-----~~-~~~Cp-CG~~i~  269 (374)
T TIGR00375       230 GLDPLLGKYHQTACEACGEPAVSEDAE-----TA-CANCP-CGGRIK  269 (374)
T ss_pred             eECcCCCccchhhhcccCCcCCchhhh-----hc-CCCCC-CCCcce
Confidence            455643 22 56788887776542211     23 58999 999964


No 47 
>KOG1594|consensus
Probab=36.13  E-value=89  Score=27.86  Aligned_cols=30  Identities=20%  Similarity=0.357  Sum_probs=26.3

Q ss_pred             cEEEEEEEcCCCeEEEEecCCcEEEEEEee
Q psy11903         27 PVRRFTLTNSQRMSVQVIDYGATITTIKVP   56 (179)
Q Consensus        27 ~v~~~tL~n~~gl~v~vlnyGAtI~sl~vp   56 (179)
                      ....+.|++.+|-+++|.=|||.+.|+++.
T Consensus        22 g~~~ivL~~p~g~taev~L~Gg~V~SWK~~   51 (305)
T KOG1594|consen   22 GLDKIVLTDPRGSTAEVYLYGGQVVSWKNE   51 (305)
T ss_pred             CCceEEEeCCCCCeEEEEEeccEEEEeecC
Confidence            456777888889999999999999999986


No 48 
>PF13923 zf-C3HC4_2:  Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A.
Probab=36.00  E-value=5.9  Score=23.89  Aligned_cols=10  Identities=30%  Similarity=1.075  Sum_probs=7.1

Q ss_pred             CCccCccccc
Q psy11903        147 GSHYCQACAY  156 (179)
Q Consensus       147 ~~~yc~~cay  156 (179)
                      ||.||..|+.
T Consensus        18 GH~fC~~C~~   27 (39)
T PF13923_consen   18 GHSFCKECIE   27 (39)
T ss_dssp             SEEEEHHHHH
T ss_pred             CCchhHHHHH
Confidence            6777777764


No 49 
>KOG1701|consensus
Probab=36.00  E-value=6.9  Score=36.60  Aligned_cols=36  Identities=31%  Similarity=0.929  Sum_probs=0.0

Q ss_pred             ccchhhccc------ccCCCccCcccc-cccCcccccCccccc
Q psy11903        135 SCKICRQKV------HQVGSHYCQACA-YKKGICAMCGKKLLD  170 (179)
Q Consensus       135 ~c~~ck~~~------~~~~~~yc~~ca-y~~g~c~mcgk~~~d  170 (179)
                      +|.+|..+|      ..++.-||..|- -..-.|.-||..|+|
T Consensus       304 tC~~C~r~L~Gq~FY~v~~k~~CE~cyq~tlekC~~Cg~~I~d  346 (468)
T KOG1701|consen  304 TCRTCRRQLAGQSFYQVDGKPYCEGCYQDTLEKCNKCGEPIMD  346 (468)
T ss_pred             ehHhhhhhhccccccccCCcccchHHHHHHHHHHhhhhhHHHH


No 50 
>PF14486 DUF4432:  Domain of unknown function (DUF4432); PDB: 3TY1_A.
Probab=35.75  E-value=1.1e+02  Score=26.94  Aligned_cols=41  Identities=24%  Similarity=0.332  Sum_probs=27.4

Q ss_pred             cEEEEEEEcCCCeEEEEecC-CcEEEEEEeeCCCCcccceEeCcCCchh
Q psy11903         27 PVRRFTLTNSQRMSVQVIDY-GATITTIKVPDKRGNVDDVVLGFDDMRE   74 (179)
Q Consensus        27 ~v~~~tL~n~~gl~v~vlny-GAtI~sl~vpdr~G~~~dVVLGfd~~e~   74 (179)
                      .++.++|+|+.||+++|+.. |.-|-++.+.   |    +-|++.++.+
T Consensus         3 Gv~~l~i~N~~gl~~~vlp~rg~dI~~~~~~---G----~~l~w~s~~~   44 (302)
T PF14486_consen    3 GVRALEIRNGGGLRFTVLPDRGMDIWDAEFD---G----VNLGWHSPFG   44 (302)
T ss_dssp             T-EEEEEEETTS-EEEEETTTTTEEEEEEET---T----EEE----S--
T ss_pred             CcEEEEEECCCCcEEEEecccCCceEEEEEC---C----EEecccCCCc
Confidence            48899999988999999987 9999999883   4    4467766654


No 51 
>KOG0153|consensus
Probab=34.58  E-value=10  Score=34.57  Aligned_cols=47  Identities=34%  Similarity=0.798  Sum_probs=33.1

Q ss_pred             ecccceeeeecccccCCCcccCcccchhhcccc----cCC-------CccCcccccccCccccc
Q psy11903        112 RIGENKALTASKARFNPYTQKFESCKICRQKVH----QVG-------SHYCQACAYKKGICAMC  164 (179)
Q Consensus       112 gi~~nk~l~~~k~~~~p~~~~~~~c~~ck~~~~----~~~-------~~yc~~cay~~g~c~mc  164 (179)
                      =+|+|-++.-   -..||+   +-|+||-....    ++|       -.-||.||=.|.+|.-|
T Consensus        26 CLGdnpyvRM---tK~~~g---kECKICtrPfT~Frw~pgr~~r~kKTeICqtCaklKNvCQ~C   83 (377)
T KOG0153|consen   26 CLGDNPYVRM---TKEPYG---KECKICTRPFTIFRWCPGRGARFKKTEICQTCAKLKNVCQTC   83 (377)
T ss_pred             hcCCCceeee---eccccC---CccceecCcceEEEeccccccccccchHHHHHHHHHhHHHHh
Confidence            4678888854   336775   48999976431    111       23699999999999988


No 52 
>PF10764 Gin:  Inhibitor of sigma-G Gin;  InterPro: IPR019700  Gin allows sigma-F to delay late forespore transcription by preventing sigma-G to take over before the cell has reached a critical stage of development. Gin is also known as CsfB []. 
Probab=34.18  E-value=10  Score=24.55  Aligned_cols=32  Identities=34%  Similarity=0.817  Sum_probs=25.0

Q ss_pred             ccchhhcccccCCCccCcccccccCcccccCccccccc
Q psy11903        135 SCKICRQKVHQVGSHYCQACAYKKGICAMCGKKLLDVK  172 (179)
Q Consensus       135 ~c~~ck~~~~~~~~~yc~~cay~~g~c~mcgk~~~d~~  172 (179)
                      +|-+|.+.... |-+     -|.+.||.-|-+.|..|.
T Consensus         1 ~CiiC~~~~~~-GI~-----I~~~fIC~~CE~~iv~~~   32 (46)
T PF10764_consen    1 KCIICGKEKEE-GIH-----IYGKFICSDCEKEIVNTE   32 (46)
T ss_pred             CeEeCCCcCCC-CEE-----EECeEehHHHHHHhccCC
Confidence            48888888776 655     467789999999998664


No 53 
>PF14315 DUF4380:  Domain of unknown function (DUF4380)
Probab=33.30  E-value=1.1e+02  Score=26.30  Aligned_cols=29  Identities=21%  Similarity=0.312  Sum_probs=24.5

Q ss_pred             EEEEEEEcCCCeEEEEe-cCCcEEEEEEeeC
Q psy11903         28 VRRFTLTNSQRMSVQVI-DYGATITTIKVPD   57 (179)
Q Consensus        28 v~~~tL~n~~gl~v~vl-nyGAtI~sl~vpd   57 (179)
                      ...++|+|+ .+++.|+ .+|.+|.++.+.+
T Consensus         4 ~~~~~l~N~-~i~l~Vtp~~GgRIl~~~~~g   33 (274)
T PF14315_consen    4 GNCLRLSNG-DIELIVTPDVGGRILSFGLNG   33 (274)
T ss_pred             ceEEEEECC-CEEEEEecCCCCEEEEEEeCC
Confidence            356889995 7999998 7899999999964


No 54 
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)
Probab=33.14  E-value=17  Score=21.07  Aligned_cols=21  Identities=29%  Similarity=0.920  Sum_probs=14.7

Q ss_pred             CCccCccccc-----ccCcccccCcc
Q psy11903        147 GSHYCQACAY-----KKGICAMCGKK  167 (179)
Q Consensus       147 ~~~yc~~cay-----~~g~c~mcgk~  167 (179)
                      ||.||..|..     ....|.+|.+.
T Consensus        19 ~H~~c~~C~~~~~~~~~~~Cp~C~~~   44 (45)
T cd00162          19 GHVFCRSCIDKWLKSGKNTCPLCRTP   44 (45)
T ss_pred             CChhcHHHHHHHHHhCcCCCCCCCCc
Confidence            6778888764     25568888764


No 55 
>PRK05580 primosome assembly protein PriA; Validated
Probab=33.08  E-value=34  Score=33.36  Aligned_cols=22  Identities=32%  Similarity=0.851  Sum_probs=17.3

Q ss_pred             CccCcccccccC---cccccCcccc
Q psy11903        148 SHYCQACAYKKG---ICAMCGKKLL  169 (179)
Q Consensus       148 ~~yc~~cay~~g---~c~mcgk~~~  169 (179)
                      .-.|+.|-|...   .|.-||...+
T Consensus       408 ~l~Ch~Cg~~~~~~~~Cp~Cg~~~l  432 (679)
T PRK05580        408 RLRCHHCGYQEPIPKACPECGSTDL  432 (679)
T ss_pred             eEECCCCcCCCCCCCCCCCCcCCee
Confidence            346999999865   7999988754


No 56 
>PHA02929 N1R/p28-like protein; Provisional
Probab=32.69  E-value=20  Score=30.90  Aligned_cols=41  Identities=27%  Similarity=0.692  Sum_probs=30.5

Q ss_pred             Ccccchhhcccc-------------cCCCccCcccc----cccCcccccCcccccccc
Q psy11903        133 FESCKICRQKVH-------------QVGSHYCQACA----YKKGICAMCGKKLLDVKN  173 (179)
Q Consensus       133 ~~~c~~ck~~~~-------------~~~~~yc~~ca----y~~g~c~mcgk~~~d~~~  173 (179)
                      ...|.||-..+.             .=+|.||..|-    =.+..|+||-..+.-+..
T Consensus       174 ~~eC~ICle~~~~~~~~~~~~~vl~~C~H~FC~~CI~~Wl~~~~tCPlCR~~~~~v~~  231 (238)
T PHA02929        174 DKECAICMEKVYDKEIKNMYFGILSNCNHVFCIECIDIWKKEKNTCPVCRTPFISVIK  231 (238)
T ss_pred             CCCCccCCcccccCccccccceecCCCCCcccHHHHHHHHhcCCCCCCCCCEeeEEee
Confidence            358999987643             23788999997    256799999988875443


No 57 
>PF01258 zf-dskA_traR:  Prokaryotic dksA/traR C4-type zinc finger;  InterPro: IPR000962 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents domains identified in zinc finger-containing members of the DksA/TraR family. DksA is a critical component of the rRNA transcription initiation machinery that potentiates the regulation of rRNA promoters by ppGpp and the initiating NTP. In delta-dksA mutants, rRNA promoters are unresponsive to changes in amino acid availability, growth rate, or growth phase. In vitro, DksA binds to RNAP, reduces open complex lifetime, inhibits rRNA promoter activity, and amplifies effects of ppGpp and the initiating NTP on rRNA transcription [, ]. The dksA gene product suppresses the temperature-sensitive growth and filamentation of a dnaK deletion mutant of Escherichia coli. Gene knockout [] and deletion [] experiments have shown the gene to be non-essential, mutations causing a mild sensitivity to UV light, but not affecting DNA recombination []. In Pseudomonas aeruginosa, dksA is a novel regulator involved in the post-transcriptional control of extracellular virulence factor production [].  The proteins contain a C-terminal region thought to fold into a 4-cysteine zinc finger. Other proteins found to contain a similar zinc finger domain include:  the traR gene products encoded on the E. coli F and R100 plasmids [, ]  the traR gene products encoded on Salmonella spp. plasmids pED208 and pSLT  the dnaK suppressor  hypothetical proteins from bacteria and bacteriophage  FHL4, LIM proteins from Homo sapiens (Human) and Mus musculus (Mouse) []  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2GVI_A 2KQ9_A 2KGO_A 1TJL_I.
Probab=32.55  E-value=19  Score=21.51  Aligned_cols=12  Identities=42%  Similarity=1.137  Sum_probs=9.0

Q ss_pred             CcccccCccccc
Q psy11903        159 GICAMCGKKLLD  170 (179)
Q Consensus       159 g~c~mcgk~~~d  170 (179)
                      |+|..||..|.+
T Consensus         4 g~C~~CGe~I~~   15 (36)
T PF01258_consen    4 GICEDCGEPIPE   15 (36)
T ss_dssp             SB-TTTSSBEEH
T ss_pred             CCccccCChHHH
Confidence            679999998874


No 58 
>KOG4458|consensus
Probab=32.49  E-value=19  Score=25.41  Aligned_cols=33  Identities=30%  Similarity=0.634  Sum_probs=22.5

Q ss_pred             ccccCCCcccCcccchhhcccccCCCccCcccccccCccc
Q psy11903        123 KARFNPYTQKFESCKICRQKVHQVGSHYCQACAYKKGICA  162 (179)
Q Consensus       123 k~~~~p~~~~~~~c~~ck~~~~~~~~~yc~~cay~~g~c~  162 (179)
                      |.+++||.-..--=-.|+-.+|...       ||+.|||-
T Consensus         4 k~k~~pydii~dd~~d~riplhne~-------a~qhgi~f   36 (78)
T KOG4458|consen    4 KKKHGPYDIIADDGHDCRIPLHNED-------AFQHGICF   36 (78)
T ss_pred             ccccCCcceeecccccceeeccchh-------hhhccceE
Confidence            4578898743333345667888754       89999994


No 59 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=32.05  E-value=11  Score=19.23  Aligned_cols=15  Identities=27%  Similarity=0.742  Sum_probs=8.0

Q ss_pred             cccccCccccccccc
Q psy11903        160 ICAMCGKKLLDVKNY  174 (179)
Q Consensus       160 ~c~mcgk~~~d~~~~  174 (179)
                      .|.+||+...+-..+
T Consensus         2 ~C~~C~~~~~~~~~l   16 (24)
T PF13894_consen    2 QCPICGKSFRSKSEL   16 (24)
T ss_dssp             E-SSTS-EESSHHHH
T ss_pred             CCcCCCCcCCcHHHH
Confidence            477888776654443


No 60 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=31.82  E-value=20  Score=23.65  Aligned_cols=28  Identities=25%  Similarity=0.624  Sum_probs=19.1

Q ss_pred             ccchhhcccccCCCccCcccccccCcccccCcccc
Q psy11903        135 SCKICRQKVHQVGSHYCQACAYKKGICAMCGKKLL  169 (179)
Q Consensus       135 ~c~~ck~~~~~~~~~yc~~cay~~g~c~mcgk~~~  169 (179)
                      +|..|...+.+..       ++.--.|.-||-+|+
T Consensus         8 ~C~~Cg~~~~~~~-------~~~~irCp~Cg~rIl   35 (49)
T COG1996           8 KCARCGREVELDQ-------ETRGIRCPYCGSRIL   35 (49)
T ss_pred             EhhhcCCeeehhh-------ccCceeCCCCCcEEE
Confidence            7888988887533       345556777776665


No 61 
>COG0266 Nei Formamidopyrimidine-DNA glycosylase [DNA replication, recombination, and repair]
Probab=31.78  E-value=20  Score=31.53  Aligned_cols=32  Identities=22%  Similarity=0.617  Sum_probs=24.7

Q ss_pred             cccCCCcccCcccchhhcc-----cccCCCccCcccc
Q psy11903        124 ARFNPYTQKFESCKICRQK-----VHQVGSHYCQACA  155 (179)
Q Consensus       124 ~~~~p~~~~~~~c~~ck~~-----~~~~~~~yc~~ca  155 (179)
                      .++.-|+.....|+.|.+.     +.+-+.+||..|-
T Consensus       236 ~~l~VYgR~GepC~~CGt~I~k~~~~gR~t~~CP~CQ  272 (273)
T COG0266         236 QELKVYGRAGEPCRRCGTPIEKIKLGGRSTFYCPVCQ  272 (273)
T ss_pred             eeEEEecCCCCCCCccCCEeEEEEEcCCcCEeCCCCC
Confidence            4566787778899999764     4566889999993


No 62 
>KOG3896|consensus
Probab=31.76  E-value=20  Score=32.86  Aligned_cols=41  Identities=37%  Similarity=0.865  Sum_probs=27.8

Q ss_pred             cccCCCcccCcccchhhc------ccccCCCccCccc---------ccccCcccccC
Q psy11903        124 ARFNPYTQKFESCKICRQ------KVHQVGSHYCQAC---------AYKKGICAMCG  165 (179)
Q Consensus       124 ~~~~p~~~~~~~c~~ck~------~~~~~~~~yc~~c---------ay~~g~c~mcg  165 (179)
                      ..|+|....+ -||-|-.      .+|...+|||..|         ..||..||-|-
T Consensus        16 g~~~pl~~L~-FCRyC~klrc~~Cv~hEvdshfCp~CLEn~ps~EArlKKn~CAnCf   71 (449)
T KOG3896|consen   16 GKFRPLPDLV-FCRYCFKLRCDDCVLHEVDSHFCPRCLENSPSPEARLKKNKCANCF   71 (449)
T ss_pred             ccccccccee-eeecccccccccccccccccccchhhccCCCchHHHhhhccccccc
Confidence            3566665422 4554432      4677789999999         47999999883


No 63 
>PRK00420 hypothetical protein; Validated
Probab=31.61  E-value=24  Score=27.09  Aligned_cols=22  Identities=18%  Similarity=0.528  Sum_probs=15.5

Q ss_pred             Ccccchhhccccc--CCCccCccc
Q psy11903        133 FESCKICRQKVHQ--VGSHYCQAC  154 (179)
Q Consensus       133 ~~~c~~ck~~~~~--~~~~yc~~c  154 (179)
                      ...|..|...+-.  .|..||+.|
T Consensus        23 ~~~CP~Cg~pLf~lk~g~~~Cp~C   46 (112)
T PRK00420         23 SKHCPVCGLPLFELKDGEVVCPVH   46 (112)
T ss_pred             cCCCCCCCCcceecCCCceECCCC
Confidence            4689999997753  476666654


No 64 
>PF10621 FpoO:  F420H2 dehydrogenase subunit FpoO ;  InterPro: IPR018288 This entry represents the FpoO subunit of membrane-bound multi-subunit F420H2 dehydrogenase, which oxidises the reduced coenzyme F420H2 to coenzyme F420 and feeds the electrons via an FeS cluster into an energy-conserving electron transport chain [, ]. This enzyme plays a role in the methanogenic pathway in methanogenic archaea. Reduced coenzyme F420H2 is the major cytoplasmic electron carrier of methanogens and a reversible hydride donor, much like NADH []. F420H2 + COB-S-S-CoM = F420 + CoM-SH + CoB-SH  Where CoB-S-S-CoM (the heterosulphide of 2-mercaptoethanesulphonate and 7-mercaptoheptanoylthreonine phosphate) is the terminal electron acceptor of the methanogenic pathway, and is reduced with the concomitant generation of a transmembrane proton potential and ATP synthesis.  The FpoO subunit of F420H2 dehydrogenase probably participates in the reduction of methanophenazine, where it acts as a special mechanism for the reduction of the methanogenic cofactor []. 
Probab=30.72  E-value=22  Score=27.53  Aligned_cols=36  Identities=28%  Similarity=0.563  Sum_probs=22.4

Q ss_pred             CCcccCcccchhhc-------ccccCCCccCcccccccCcccccCcccc
Q psy11903        128 PYTQKFESCKICRQ-------KVHQVGSHYCQACAYKKGICAMCGKKLL  169 (179)
Q Consensus       128 p~~~~~~~c~~ck~-------~~~~~~~~yc~~cay~~g~c~mcgk~~~  169 (179)
                      |-+.+..-|.+|-.       .+.++ ..-     -+.|.|.|||++-.
T Consensus        29 PeGvwKGLC~~CL~sa~~ty~e~~~~-~~s-----~~~gKC~LCG~kt~   71 (119)
T PF10621_consen   29 PEGVWKGLCETCLDSAEKTYQEVNEN-ESS-----CRSGKCDLCGKKTQ   71 (119)
T ss_pred             cchHHHhhHHHHHHHHHHHHHHHhcc-ccc-----ccccceeccCCcce
Confidence            55555667777743       33332 222     27899999999743


No 65 
>cd09025 Aldose_epim_Slr1438 Aldose 1-epimerase, similar to Synechocystis Slr1438. Proteins similar to Synechocystis Slr1438 are uncharacterized members of aldose-1-epimerase superfamily. Aldose 1-epimerases or mutarotases are key enzymes of carbohydrate metabolism, catalyzing the interconversion of the alpha- and beta-anomers of hexose sugars such as glucose and galactose. This interconversion is an important step that allows anomer specific metabolic conversion of sugars. Studies of the catalytic mechanism of the best known member of the family, galactose mutarotase, have shown a glutamate and a histidine residue to be critical for catalysis; the glutamate serves as the active site base to initiate the reaction by removing the proton from the C-1 hydroxyl group of the sugar substrate, and the histidine as the active site acid to protonate the C-5 ring oxygen.
Probab=30.66  E-value=2.2e+02  Score=24.04  Aligned_cols=55  Identities=20%  Similarity=0.253  Sum_probs=32.5

Q ss_pred             EEEEEcC-CCeEEEEe-cCCcEEEEEEeeCCCCcccceEeCcCCchhhh------hhhhccccccceec
Q psy11903         30 RFTLTNS-QRMSVQVI-DYGATITTIKVPDKRGNVDDVVLGFDDMREEI------YFIMVCSKCEKKLG   90 (179)
Q Consensus        30 ~~tL~n~-~gl~v~vl-nyGAtI~sl~vpdr~G~~~dVVLGfd~~e~Y~------~~gmvc~kc~~klg   90 (179)
                      .++|+++ .++++.|+ .+||.|.++..   +|  .+|+- ..+.+.+.      .-..+|.+..+|++
T Consensus         3 ~~~l~~~~~~~~~~v~p~~Ga~l~s~~~---~g--~~~l~-~~~~~~~~~~~~~~gG~p~l~P~~gri~   65 (271)
T cd09025           3 TYELSDEEAGSRLRVVPERGGLITRWTV---QG--RELLY-LDEERFADPAKSVRGGIPILFPICGNLP   65 (271)
T ss_pred             EEEEEcCCCceEEEEecccCCEEEEEec---CC--EEEEe-cCChHHhccccccCCCCcEEECccCCCC
Confidence            3566764 24999998 67999999975   35  46653 22222221      11246666666664


No 66 
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=29.76  E-value=31  Score=21.81  Aligned_cols=11  Identities=18%  Similarity=0.754  Sum_probs=6.2

Q ss_pred             ccchhhccccc
Q psy11903        135 SCKICRQKVHQ  145 (179)
Q Consensus       135 ~c~~ck~~~~~  145 (179)
                      +|..|++.+..
T Consensus        28 ~C~~C~~~l~~   38 (58)
T PF00412_consen   28 KCSKCGKPLND   38 (58)
T ss_dssp             BETTTTCBTTT
T ss_pred             ccCCCCCccCC
Confidence            56666655543


No 67 
>PF06827 zf-FPG_IleRS:  Zinc finger found in FPG and IleRS;  InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger domain found at the C-terminal in both DNA glycosylase/AP lyase enzymes and in isoleucyl tRNA synthetase. In these two types of enzymes, the C-terminal domain forms a zinc finger. Some related proteins may not bind zinc.  DNA glycosylase/AP lyase enzymes are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. These enzymes have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC) []. Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines []. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above, but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine [, ].  An Fpg-type zinc finger is also found at the C terminus of isoleucyl tRNA synthetase (6.1.1.5 from EC) [, ]. This enzyme catalyses the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such errors it has two additional distinct tRNA(Ile)-dependent editing activities. One activity is designated as 'pre-transfer' editing and involves the hydrolysis of activated Val-AMP. The other activity is designated 'post-transfer' editing and involves deacylation of mischarged Val-tRNA(Ile) [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003824 catalytic activity; PDB: 1K82_C 1Q39_A 2OQ4_B 2OPF_A 1K3X_A 1K3W_A 1Q3B_A 2EA0_A 1Q3C_A 2XZF_A ....
Probab=29.44  E-value=16  Score=20.91  Aligned_cols=21  Identities=19%  Similarity=0.654  Sum_probs=8.5

Q ss_pred             ccchhhccccc-----CCCccCcccc
Q psy11903        135 SCKICRQKVHQ-----VGSHYCQACA  155 (179)
Q Consensus       135 ~c~~ck~~~~~-----~~~~yc~~ca  155 (179)
                      +|..|...+..     ....||..|.
T Consensus         3 ~C~rC~~~~~~~~~~~r~~~~C~rCq   28 (30)
T PF06827_consen    3 KCPRCWNYIEDIGINGRSTYLCPRCQ   28 (30)
T ss_dssp             B-TTT--BBEEEEETTEEEEE-TTTC
T ss_pred             cCccCCCcceEeEecCCCCeECcCCc
Confidence            56666655432     2335666653


No 68 
>COG1439 Predicted nucleic acid-binding protein, consists of a PIN domain and a Zn-ribbon module [General function prediction only]
Probab=27.74  E-value=30  Score=28.69  Aligned_cols=25  Identities=28%  Similarity=0.693  Sum_probs=17.7

Q ss_pred             cccchhhcccccCCCccCcccccccCcccccCcccc
Q psy11903        134 ESCKICRQKVHQVGSHYCQACAYKKGICAMCGKKLL  169 (179)
Q Consensus       134 ~~c~~ck~~~~~~~~~yc~~cay~~g~c~mcgk~~~  169 (179)
                      -.|.-|+...+           +.+++|+.||-++.
T Consensus       140 ~rC~GC~~~f~-----------~~~~~Cp~CG~~~~  164 (177)
T COG1439         140 LRCHGCKRIFP-----------EPKDFCPICGSPLK  164 (177)
T ss_pred             EEEecCceecC-----------CCCCcCCCCCCceE
Confidence            46777777665           34678889997755


No 69 
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=26.85  E-value=34  Score=36.21  Aligned_cols=31  Identities=23%  Similarity=0.717  Sum_probs=16.0

Q ss_pred             cccchhhcccccCCCccCcccccc---cCcccccCcc
Q psy11903        134 ESCKICRQKVHQVGSHYCQACAYK---KGICAMCGKK  167 (179)
Q Consensus       134 ~~c~~ck~~~~~~~~~yc~~cay~---~g~c~mcgk~  167 (179)
                      .+|..|...+.+   .+|+.|-.+   ...|.-||.+
T Consensus       668 rkCPkCG~~t~~---~fCP~CGs~te~vy~CPsCGae  701 (1337)
T PRK14714        668 RRCPSCGTETYE---NRCPDCGTHTEPVYVCPDCGAE  701 (1337)
T ss_pred             EECCCCCCcccc---ccCcccCCcCCCceeCccCCCc
Confidence            466666665544   366666544   2234444443


No 70 
>PRK01103 formamidopyrimidine/5-formyluracil/ 5-hydroxymethyluracil DNA glycosylase; Validated
Probab=26.11  E-value=31  Score=29.71  Aligned_cols=31  Identities=19%  Similarity=0.645  Sum_probs=21.0

Q ss_pred             ccCCCcccCcccchhhcccc-----cCCCccCcccc
Q psy11903        125 RFNPYTQKFESCKICRQKVH-----QVGSHYCQACA  155 (179)
Q Consensus       125 ~~~p~~~~~~~c~~ck~~~~-----~~~~~yc~~ca  155 (179)
                      ++.-|+.....|..|.+.+.     .-+..||..|-
T Consensus       237 ~l~Vy~R~g~pC~~Cg~~I~~~~~~gR~t~~CP~CQ  272 (274)
T PRK01103        237 SLQVYGREGEPCRRCGTPIEKIKQGGRSTFFCPRCQ  272 (274)
T ss_pred             eeEEcCCCCCCCCCCCCeeEEEEECCCCcEECcCCC
Confidence            34456555678999988764     23678898884


No 71 
>PRK14810 formamidopyrimidine-DNA glycosylase; Provisional
Probab=25.82  E-value=32  Score=29.70  Aligned_cols=30  Identities=30%  Similarity=0.730  Sum_probs=21.7

Q ss_pred             ccCCCcccCcccchhhcccc-----cCCCccCccc
Q psy11903        125 RFNPYTQKFESCKICRQKVH-----QVGSHYCQAC  154 (179)
Q Consensus       125 ~~~p~~~~~~~c~~ck~~~~-----~~~~~yc~~c  154 (179)
                      ++.-|+.....|..|.+.|.     +-...||..|
T Consensus       236 ~~~Vy~R~g~pCprCG~~I~~~~~~gR~t~~CP~C  270 (272)
T PRK14810        236 SHRVYQRTGEPCLNCKTPIRRVVVAGRSSHYCPHC  270 (272)
T ss_pred             hEeecCCCCCcCCCCCCeeEEEEECCCccEECcCC
Confidence            45567666779999988664     3466888887


No 72 
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=24.88  E-value=32  Score=27.18  Aligned_cols=24  Identities=25%  Similarity=0.885  Sum_probs=16.8

Q ss_pred             cccchhhcccc-cCCCccCcccccc
Q psy11903        134 ESCKICRQKVH-QVGSHYCQACAYK  157 (179)
Q Consensus       134 ~~c~~ck~~~~-~~~~~yc~~cay~  157 (179)
                      ..|..|++.+- -+|.-||+.|-|+
T Consensus        29 ~hCp~Cg~PLF~KdG~v~CPvC~~~   53 (131)
T COG1645          29 KHCPKCGTPLFRKDGEVFCPVCGYR   53 (131)
T ss_pred             hhCcccCCcceeeCCeEECCCCCce
Confidence            48999999773 3476777666553


No 73 
>PF00643 zf-B_box:  B-box zinc finger;  InterPro: IPR000315 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents B-box-type zinc finger domains, which are around 40 residues in length. B-box zinc fingers can be divided into two groups, where types 1 and 2 B-box domains differ in their consensus sequence and in the spacing of the 7-8 zinc-binding residues. Several proteins contain both types 1 and 2 B-boxes, suggesting some level of cooperativity between these two domains. B-box domains are found in over 1500 proteins from a variety of organisms. They are found in TRIM (tripartite motif) proteins that consist of an N-terminal RING finger (originally called an A-box), followed by 1-2 B-box domains and a coiled-coil domain (also called RBCC for Ring, B-box, Coiled-Coil). TRIM proteins contain a type 2 B-box domain, and may also contain a type 1 B-box. In proteins that do not contain RING or coiled-coil domains, the B-box domain is primarily type 2. Many type 2 B-box proteins are involved in ubiquitinylation. Proteins containing a B-box zinc finger domain include transcription factors, ribonucleoproteins and proto-oncoproteins; for example, MID1, MID2, TRIM9, TNL, TRIM36, TRIM63, TRIFIC, NCL1 and CONSTANS-like proteins []. The microtubule-associated E3 ligase MID1 (6.3.2 from EC) contains a type 1 B-box zinc finger domain. MID1 specifically binds Alpha-4, which in turn recruits the catalytic subunit of phosphatase 2A (PP2Ac). This complex is required for targeting of PP2Ac for proteasome-mediated degradation. The MID1 B-box coordinates two zinc ions and adopts a beta/beta/alpha cross-brace structure similar to that of ZZ, PHD, RING and FYVE zinc fingers [, ]. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 3DDT_B 2D8U_A 3Q1D_A 2EGM_A 2YVR_B 2DJA_A 2DQ5_A 2JUN_A 2YRG_A 2DID_A ....
Probab=24.63  E-value=17  Score=21.94  Aligned_cols=29  Identities=21%  Similarity=0.601  Sum_probs=19.1

Q ss_pred             cccchhhcccccCCCccCcccccccCcccccCcc
Q psy11903        134 ESCKICRQKVHQVGSHYCQACAYKKGICAMCGKK  167 (179)
Q Consensus       134 ~~c~~ck~~~~~~~~~yc~~cay~~g~c~mcgk~  167 (179)
                      ..|..|....-   ..||..|..  -+|..|-..
T Consensus         4 ~~C~~H~~~~~---~~~C~~C~~--~~C~~C~~~   32 (42)
T PF00643_consen    4 PKCPEHPEEPL---SLFCEDCNE--PLCSECTVS   32 (42)
T ss_dssp             SB-SSTTTSBE---EEEETTTTE--EEEHHHHHT
T ss_pred             ccCccCCccce---EEEecCCCC--ccCccCCCC
Confidence            46777776533   378998876  688877543


No 74 
>PRK14811 formamidopyrimidine-DNA glycosylase; Provisional
Probab=23.32  E-value=38  Score=29.26  Aligned_cols=33  Identities=21%  Similarity=0.615  Sum_probs=22.8

Q ss_pred             ccCCCcccCcccchhhcccc-----cCCCccCcccccc
Q psy11903        125 RFNPYTQKFESCKICRQKVH-----QVGSHYCQACAYK  157 (179)
Q Consensus       125 ~~~p~~~~~~~c~~ck~~~~-----~~~~~yc~~cay~  157 (179)
                      ++.-|+.....|..|.+.+.     +-+..||..|--.
T Consensus       227 ~~~Vy~R~g~pC~~Cg~~I~~~~~~gR~ty~Cp~CQ~~  264 (269)
T PRK14811        227 QHAVYGREGQPCPRCGTPIEKIVVGGRGTHFCPQCQPL  264 (269)
T ss_pred             eEEecCCCcCCCCcCCCeeEEEEECCCCcEECCCCcCC
Confidence            34456655678999988664     3467899988543


No 75 
>PF14835 zf-RING_6:  zf-RING of BARD1-type protein; PDB: 1JM7_B.
Probab=22.97  E-value=57  Score=22.80  Aligned_cols=42  Identities=21%  Similarity=0.592  Sum_probs=18.1

Q ss_pred             ccchhhcccccC------CCccCccccccc--CcccccCccc--cccccccc
Q psy11903        135 SCKICRQKVHQV------GSHYCQACAYKK--GICAMCGKKL--LDVKNYKQ  176 (179)
Q Consensus       135 ~c~~ck~~~~~~------~~~yc~~cay~~--g~c~mcgk~~--~d~~~~~~  176 (179)
                      +|.+|..-++.|      .|.||..|.=..  -.|+.|-.+-  .|++-.+|
T Consensus         9 rCs~C~~~l~~pv~l~~CeH~fCs~Ci~~~~~~~CPvC~~Paw~qD~~~Nrq   60 (65)
T PF14835_consen    9 RCSICFDILKEPVCLGGCEHIFCSSCIRDCIGSECPVCHTPAWIQDIQINRQ   60 (65)
T ss_dssp             S-SSS-S--SS-B---SSS--B-TTTGGGGTTTB-SSS--B-S-SS----HH
T ss_pred             CCcHHHHHhcCCceeccCccHHHHHHhHHhcCCCCCCcCChHHHHHHHhhhh
Confidence            677887777665      578999998443  4588887775  56665544


No 76 
>PF09706 Cas_CXXC_CXXC:  CRISPR-associated protein (Cas_CXXC_CXXC);  InterPro: IPR019121 Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) are a family of DNA direct repeats separated by regularly sized non-repetitive spacer sequences that are found in most bacterial and archaeal genomes []. CRISPRs appear to provide acquired resistance against bacteriophages, possibly acting with an RNA interference-like mechanism to inhibit gene functions of invasive DNA elements [, ]. Differences in the number and type of spacers between CRISPR repeats correlate with phage sensitivity. It is thought that following phage infection, bacteria integrate new spacers derived from phage genomic sequences, and that the removal or addition of particular spacers modifies the phage-resistance phenotype of the cell. Therefore, the specificity of CRISPRs may be determined by spacer-phage sequence similarity. In addition, there are many protein families known as CRISPR-associated sequences (Cas), which are encoded in the vicinity of CRISPR loci []. CRISPR/cas gene regions can be quite large, with up to 20 different, tandem-arranged cas genes next to a CRISPR cluster or filling the region between two repeat clusters. Cas genes and CRISPRs are found on mobile genetic elements such as plasmids, and have undergone extensive horizontal transfer. Cas proteins are thought to be involved in the propagation and functioning of CRISPRs. Some Cas proteins show similarity to helicases and repair proteins, although the functions of most are unknown. Cas families can be divided into subtypes according to operon organisation and phylogeny.  This entry represents a conserved domain of about 65 amino acids found in otherwise highly divergent proteins encoded in CRISPR-associated regions. This domain features two CXXC motifs. 
Probab=22.75  E-value=43  Score=23.21  Aligned_cols=11  Identities=45%  Similarity=1.026  Sum_probs=8.4

Q ss_pred             ccCcccccCcc
Q psy11903        157 KKGICAMCGKK  167 (179)
Q Consensus       157 ~~g~c~mcgk~  167 (179)
                      +++.|..||.+
T Consensus         4 ~~~~C~~Cg~r   14 (69)
T PF09706_consen    4 KKYNCIFCGER   14 (69)
T ss_pred             CCCcCcCCCCc
Confidence            46789999944


No 77 
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=22.15  E-value=31  Score=19.70  Aligned_cols=22  Identities=18%  Similarity=0.588  Sum_probs=6.8

Q ss_pred             ccchhhcccccCCCccCccccc
Q psy11903        135 SCKICRQKVHQVGSHYCQACAY  156 (179)
Q Consensus       135 ~c~~ck~~~~~~~~~yc~~cay  156 (179)
                      .|..|+.++......+|..|-|
T Consensus         2 ~C~~C~~~~~~~~~Y~C~~Cdf   23 (30)
T PF07649_consen    2 RCDACGKPIDGGWFYRCSECDF   23 (30)
T ss_dssp             --TTTS----S--EEE-TTT--
T ss_pred             cCCcCCCcCCCCceEECccCCC
Confidence            4667777665423455666654


No 78 
>PRK06393 rpoE DNA-directed RNA polymerase subunit E''; Validated
Probab=22.02  E-value=41  Score=23.44  Aligned_cols=22  Identities=23%  Similarity=0.780  Sum_probs=16.2

Q ss_pred             CcccchhhcccccCCCccCcccccccCcccccCcc
Q psy11903        133 FESCKICRQKVHQVGSHYCQACAYKKGICAMCGKK  167 (179)
Q Consensus       133 ~~~c~~ck~~~~~~~~~yc~~cay~~g~c~mcgk~  167 (179)
                      +..|+.|+.-++..             .|..||-.
T Consensus         5 ~~AC~~C~~i~~~~-------------~Cp~Cgs~   26 (64)
T PRK06393          5 YRACKKCKRLTPEK-------------TCPVHGDE   26 (64)
T ss_pred             hhhHhhCCcccCCC-------------cCCCCCCC
Confidence            35899999877531             78888875


No 79 
>TIGR02420 dksA RNA polymerase-binding protein DksA. The model that is the basis for this family describes a small, pleiotropic protein, DksA (DnaK suppressor A), originally named as a multicopy suppressor of temperature sensitivity of dnaKJ mutants. DksA mutants are defective in quorum sensing, virulence, etc. DksA is now understood to bind RNA polymerase directly and modulate its response to small molecules to control the level of transcription of rRNA. Nearly all members of this family are in the Proteobacteria. Whether the closest homologs outside the Proteobacteria function equivalently is unknown. The low value set for the noise cutoff allows identification of possible DksA proteins from outside the proteobacteria. TIGR02419 describes a closely related family of short sequences usually found in prophage regions of proteobacterial genomes or in known phage.
Probab=21.95  E-value=37  Score=25.31  Aligned_cols=11  Identities=36%  Similarity=1.038  Sum_probs=8.9

Q ss_pred             CcccccCcccc
Q psy11903        159 GICAMCGKKLL  169 (179)
Q Consensus       159 g~c~mcgk~~~  169 (179)
                      |+|-.||+.|-
T Consensus        81 G~C~~Cge~I~   91 (110)
T TIGR02420        81 GYCEECGEEIG   91 (110)
T ss_pred             CchhccCCccc
Confidence            68889998874


No 80 
>TIGR03826 YvyF flagellar operon protein TIGR03826. This gene is found in flagellar operons of Bacillus-related organisms. Its function has not been determined and an official gene symbol has not been assigned, although the gene is designated yvyF in B. subtilus. A tentative assignment as a regulator is suggested in the NCBI record GI:16080597.
Probab=21.92  E-value=38  Score=26.75  Aligned_cols=24  Identities=25%  Similarity=0.667  Sum_probs=20.0

Q ss_pred             ccCcccchhhcccccCCCccCccccc
Q psy11903        131 QKFESCKICRQKVHQVGSHYCQACAY  156 (179)
Q Consensus       131 ~~~~~c~~ck~~~~~~~~~yc~~cay  156 (179)
                      +..-.|..|-+.+.. | .||..|+-
T Consensus        79 nl~~~CE~CG~~I~~-G-r~C~~C~~  102 (137)
T TIGR03826        79 NLGYPCERCGTSIRE-G-RLCDSCAG  102 (137)
T ss_pred             CCcCcccccCCcCCC-C-CccHHHHH
Confidence            345699999999998 5 99999973


No 81 
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=21.67  E-value=87  Score=29.47  Aligned_cols=37  Identities=30%  Similarity=0.789  Sum_probs=24.8

Q ss_pred             Ccccchhhccc--cc-CCCccCcccccccC---cccccCcccc
Q psy11903        133 FESCKICRQKV--HQ-VGSHYCQACAYKKG---ICAMCGKKLL  169 (179)
Q Consensus       133 ~~~c~~ck~~~--~~-~~~~yc~~cay~~g---~c~mcgk~~~  169 (179)
                      ..+|..|-..+  |+ .+.-.|+.|.|...   .|.-||-.-+
T Consensus       222 ~~~C~~C~~~l~~h~~~~~l~Ch~Cg~~~~~~~~Cp~C~s~~l  264 (505)
T TIGR00595       222 ILCCPNCDVSLTYHKKEGKLRCHYCGYQEPIPKTCPQCGSEDL  264 (505)
T ss_pred             ccCCCCCCCceEEecCCCeEEcCCCcCcCCCCCCCCCCCCCee
Confidence            34566666544  32 23456999999876   8999998654


No 82 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=21.14  E-value=50  Score=22.79  Aligned_cols=29  Identities=24%  Similarity=0.562  Sum_probs=19.4

Q ss_pred             cccchhhcccccCCCccCcccccccCcccccCcccc
Q psy11903        134 ESCKICRQKVHQVGSHYCQACAYKKGICAMCGKKLL  169 (179)
Q Consensus       134 ~~c~~ck~~~~~~~~~yc~~cay~~g~c~mcgk~~~  169 (179)
                      ..|..|..-++. +.+      |-+-.|.+||+.++
T Consensus        10 ~~CtSCg~~i~p-~e~------~v~F~CPnCGe~~I   38 (61)
T COG2888          10 PVCTSCGREIAP-GET------AVKFPCPNCGEVEI   38 (61)
T ss_pred             ceeccCCCEecc-CCc------eeEeeCCCCCceee
Confidence            489999999866 433      45556777774443


No 83 
>KOG1734|consensus
Probab=20.87  E-value=32  Score=30.65  Aligned_cols=15  Identities=27%  Similarity=0.751  Sum_probs=12.0

Q ss_pred             cCcccccCccccccc
Q psy11903        158 KGICAMCGKKLLDVK  172 (179)
Q Consensus       158 ~g~c~mcgk~~~d~~  172 (179)
                      .++||.||+++.++-
T Consensus       224 d~vCaVCg~~~~~s~  238 (328)
T KOG1734|consen  224 DSVCAVCGQQIDVSV  238 (328)
T ss_pred             cchhHhhcchheeec
Confidence            359999999998653


No 84 
>PF06045 Rhamnogal_lyase:  Rhamnogalacturonate lyase family;  InterPro: IPR010325 Rhamnogalacturonate lyase degrades the rhamnogalacturonan I (RG-I) backbone of pectin []. This family contains mainly members from plants, but also contains the plant pathogen Erwinia chrysanthemi.
Probab=20.80  E-value=1.5e+02  Score=25.00  Aligned_cols=34  Identities=29%  Similarity=0.364  Sum_probs=26.7

Q ss_pred             EEEEcCCCeEEEEecCCcEEEEEEeeCCCCcccceEeCcC
Q psy11903         31 FTLTNSQRMSVQVIDYGATITTIKVPDKRGNVDDVVLGFD   70 (179)
Q Consensus        31 ~tL~n~~gl~v~vlnyGAtI~sl~vpdr~G~~~dVVLGfd   70 (179)
                      .+|.|+ =++|+|.+=|+.|++|+.   +|.  +.+|.+.
T Consensus        18 VvldNG-iVqVtls~p~G~VtgIkY---nGi--~NLle~~   51 (203)
T PF06045_consen   18 VVLDNG-IVQVTLSKPGGIVTGIKY---NGI--DNLLEVA   51 (203)
T ss_pred             EEEECC-EEEEEEcCCCceEEEEEE---CCE--ehhhccc
Confidence            678884 699999999999999998   573  4555543


No 85 
>KOG1705|consensus
Probab=20.38  E-value=31  Score=25.97  Aligned_cols=33  Identities=27%  Similarity=0.651  Sum_probs=22.8

Q ss_pred             CcccCcccchhhcccccCCCccCcccc---cccCccc
Q psy11903        129 YTQKFESCKICRQKVHQVGSHYCQACA---YKKGICA  162 (179)
Q Consensus       129 ~~~~~~~c~~ck~~~~~~~~~yc~~ca---y~~g~c~  162 (179)
                      |+.+...|.||.- +....+.||..|-   |-+.-|+
T Consensus        51 ~Gs~q~~ciic~~-~gV~d~~yc~ectr~ekdrdgCp   86 (110)
T KOG1705|consen   51 YGSYQGRCVICGG-VGVSDAYYCKECTRQEKDRDGCP   86 (110)
T ss_pred             CccccCceEEecC-CcccchHHHHHHHhhccccccCh
Confidence            4445679999998 5444789999986   4444454


No 86 
>smart00746 TRASH metallochaperone-like domain.
Probab=20.18  E-value=47  Score=17.64  Aligned_cols=9  Identities=44%  Similarity=1.435  Sum_probs=7.6

Q ss_pred             ccccCcccc
Q psy11903        161 CAMCGKKLL  169 (179)
Q Consensus       161 c~mcgk~~~  169 (179)
                      |+.||..|.
T Consensus         1 c~~C~~~~~    9 (39)
T smart00746        1 CSFCGKDIY    9 (39)
T ss_pred             CCCCCCCcc
Confidence            788999886


No 87 
>COG1545 Predicted nucleic-acid-binding protein containing a Zn-ribbon [General function prediction only]
Probab=20.16  E-value=56  Score=25.55  Aligned_cols=20  Identities=30%  Similarity=0.815  Sum_probs=13.9

Q ss_pred             cccchhhcccccCCCccCccc
Q psy11903        134 ESCKICRQKVHQVGSHYCQAC  154 (179)
Q Consensus       134 ~~c~~ck~~~~~~~~~yc~~c  154 (179)
                      ++|..|-.-.+.+ ..+|..|
T Consensus        30 ~kC~~CG~v~~PP-r~~Cp~C   49 (140)
T COG1545          30 TKCKKCGRVYFPP-RAYCPKC   49 (140)
T ss_pred             EEcCCCCeEEcCC-cccCCCC
Confidence            4899998877774 4555544


Done!