BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy11930
         (274 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1ESM|A Chain A, Structural Basis For The Feedback Regulation Of
           Escherichia Coli Pantothenate Kinase By Coenzyme A
 pdb|1ESM|B Chain B, Structural Basis For The Feedback Regulation Of
           Escherichia Coli Pantothenate Kinase By Coenzyme A
 pdb|1ESM|C Chain C, Structural Basis For The Feedback Regulation Of
           Escherichia Coli Pantothenate Kinase By Coenzyme A
 pdb|1ESM|D Chain D, Structural Basis For The Feedback Regulation Of
           Escherichia Coli Pantothenate Kinase By Coenzyme A
 pdb|1ESN|A Chain A, Structural Basis For The Feedback Regulation Of
           Escherichia Coli Pantothenate Kinase By Coenzyme A
 pdb|1ESN|B Chain B, Structural Basis For The Feedback Regulation Of
           Escherichia Coli Pantothenate Kinase By Coenzyme A
 pdb|1ESN|C Chain C, Structural Basis For The Feedback Regulation Of
           Escherichia Coli Pantothenate Kinase By Coenzyme A
 pdb|1ESN|D Chain D, Structural Basis For The Feedback Regulation Of
           Escherichia Coli Pantothenate Kinase By Coenzyme A
          Length = 316

 Score = 28.9 bits (63), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 2/38 (5%)

Query: 9   FFMPNKREDSYSTLSWRKAIKS--TLWKNGGWMNIPQG 44
           F  P+    +Y+ L+  +AIK+  TLWK   W+N+ Q 
Sbjct: 252 FTDPDSYFHNYAKLTKEEAIKTAXTLWKEINWLNLKQN 289


>pdb|1SQ5|A Chain A, Crystal Structure Of E. Coli Pantothenate Kinase
 pdb|1SQ5|B Chain B, Crystal Structure Of E. Coli Pantothenate Kinase
 pdb|1SQ5|C Chain C, Crystal Structure Of E. Coli Pantothenate Kinase
 pdb|1SQ5|D Chain D, Crystal Structure Of E. Coli Pantothenate Kinase
          Length = 308

 Score = 28.9 bits (63), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 2/38 (5%)

Query: 9   FFMPNKREDSYSTLSWRKAIKS--TLWKNGGWMNIPQG 44
           F  P+    +Y+ L+  +AIK+  TLWK   W+N+ Q 
Sbjct: 244 FTDPDSYFHNYAKLTKEEAIKTAMTLWKEINWLNLKQN 281


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.140    0.452 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,887,275
Number of Sequences: 62578
Number of extensions: 377529
Number of successful extensions: 638
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 638
Number of HSP's gapped (non-prelim): 2
length of query: 274
length of database: 14,973,337
effective HSP length: 97
effective length of query: 177
effective length of database: 8,903,271
effective search space: 1575878967
effective search space used: 1575878967
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 51 (24.3 bits)