BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy11930
(274 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1ESM|A Chain A, Structural Basis For The Feedback Regulation Of
Escherichia Coli Pantothenate Kinase By Coenzyme A
pdb|1ESM|B Chain B, Structural Basis For The Feedback Regulation Of
Escherichia Coli Pantothenate Kinase By Coenzyme A
pdb|1ESM|C Chain C, Structural Basis For The Feedback Regulation Of
Escherichia Coli Pantothenate Kinase By Coenzyme A
pdb|1ESM|D Chain D, Structural Basis For The Feedback Regulation Of
Escherichia Coli Pantothenate Kinase By Coenzyme A
pdb|1ESN|A Chain A, Structural Basis For The Feedback Regulation Of
Escherichia Coli Pantothenate Kinase By Coenzyme A
pdb|1ESN|B Chain B, Structural Basis For The Feedback Regulation Of
Escherichia Coli Pantothenate Kinase By Coenzyme A
pdb|1ESN|C Chain C, Structural Basis For The Feedback Regulation Of
Escherichia Coli Pantothenate Kinase By Coenzyme A
pdb|1ESN|D Chain D, Structural Basis For The Feedback Regulation Of
Escherichia Coli Pantothenate Kinase By Coenzyme A
Length = 316
Score = 28.9 bits (63), Expect = 3.3, Method: Compositional matrix adjust.
Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 2/38 (5%)
Query: 9 FFMPNKREDSYSTLSWRKAIKS--TLWKNGGWMNIPQG 44
F P+ +Y+ L+ +AIK+ TLWK W+N+ Q
Sbjct: 252 FTDPDSYFHNYAKLTKEEAIKTAXTLWKEINWLNLKQN 289
>pdb|1SQ5|A Chain A, Crystal Structure Of E. Coli Pantothenate Kinase
pdb|1SQ5|B Chain B, Crystal Structure Of E. Coli Pantothenate Kinase
pdb|1SQ5|C Chain C, Crystal Structure Of E. Coli Pantothenate Kinase
pdb|1SQ5|D Chain D, Crystal Structure Of E. Coli Pantothenate Kinase
Length = 308
Score = 28.9 bits (63), Expect = 3.3, Method: Compositional matrix adjust.
Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 2/38 (5%)
Query: 9 FFMPNKREDSYSTLSWRKAIKS--TLWKNGGWMNIPQG 44
F P+ +Y+ L+ +AIK+ TLWK W+N+ Q
Sbjct: 244 FTDPDSYFHNYAKLTKEEAIKTAMTLWKEINWLNLKQN 281
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.322 0.140 0.452
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,887,275
Number of Sequences: 62578
Number of extensions: 377529
Number of successful extensions: 638
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 638
Number of HSP's gapped (non-prelim): 2
length of query: 274
length of database: 14,973,337
effective HSP length: 97
effective length of query: 177
effective length of database: 8,903,271
effective search space: 1575878967
effective search space used: 1575878967
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 51 (24.3 bits)