Query         psy11933
Match_columns 79
No_of_seqs    102 out of 164
Neff          4.5 
Searched_HMMs 46136
Date          Fri Aug 16 22:41:36 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy11933.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/11933hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4118|consensus              100.0 1.7E-31 3.7E-36  168.5   6.6   74    1-77      1-74  (74)
  2 PF12907 zf-met2:  Zinc-binding  99.6 4.3E-16 9.3E-21   89.2   0.8   35   41-75      1-38  (40)
  3 PF04419 4F5:  4F5 protein fami  98.0 7.8E-08 1.7E-12   54.2  -4.9   38    1-41      1-38  (38)
  4 PF12874 zf-met:  Zinc-finger o  97.2  0.0001 2.2E-09   36.4   0.6   23   42-64      1-23  (25)
  5 PF13894 zf-C2H2_4:  C2H2-type   97.1 0.00019 4.1E-09   34.0   0.7   24   42-65      1-24  (24)
  6 PF00096 zf-C2H2:  Zinc finger,  96.9 0.00031 6.6E-09   34.0   0.5   22   42-63      1-22  (23)
  7 PF13912 zf-C2H2_6:  C2H2-type   96.4  0.0016 3.4E-08   32.6   1.1   25   42-66      2-26  (27)
  8 smart00355 ZnF_C2H2 zinc finge  95.5  0.0076 1.6E-07   28.3   1.2   24   42-66      1-24  (26)
  9 PF12171 zf-C2H2_jaz:  Zinc-fin  95.4  0.0042   9E-08   31.4   0.1   23   42-64      2-24  (27)
 10 PF09237 GAGA:  GAGA factor;  I  95.2    0.01 2.3E-07   36.0   1.3   28   42-69     25-52  (54)
 11 smart00451 ZnF_U1 U1-like zinc  95.1  0.0088 1.9E-07   31.1   0.8   24   41-64      3-26  (35)
 12 KOG4488|consensus               94.9   0.033 7.2E-07   35.3   3.0   26    1-26      1-26  (70)
 13 PF12756 zf-C2H2_2:  C2H2 type   94.1   0.025 5.3E-07   34.3   1.1   30   41-70     50-80  (100)
 14 PF05605 zf-Di19:  Drought indu  93.7    0.05 1.1E-06   31.5   1.8   28   41-69      2-29  (54)
 15 PHA00616 hypothetical protein   93.6   0.039 8.4E-07   32.1   1.3   32   42-73      2-33  (44)
 16 PF13909 zf-H2C2_5:  C2H2-type   92.5   0.033 7.2E-07   27.1  -0.1   24   42-66      1-24  (24)
 17 KOG1842|consensus               91.6     0.1 2.2E-06   43.1   1.6   29   41-69     15-43  (505)
 18 PHA02768 hypothetical protein;  91.3    0.14   3E-06   31.0   1.6   26   40-66      4-29  (55)
 19 PF12756 zf-C2H2_2:  C2H2 type   89.4    0.11 2.4E-06   31.4   0.0   26   43-68      1-26  (100)
 20 smart00734 ZnF_Rad18 Rad18-lik  89.2    0.23 5.1E-06   25.4   1.2   20   42-62      2-21  (26)
 21 PF04780 DUF629:  Protein of un  88.4    0.23 5.1E-06   40.7   1.3   32   42-74     58-89  (466)
 22 PF13913 zf-C2HC_2:  zinc-finge  88.3    0.27 5.9E-06   24.8   1.1   20   42-62      3-22  (25)
 23 PF05605 zf-Di19:  Drought indu  86.7    0.32 6.9E-06   28.0   0.9   24   40-65     30-53  (54)
 24 PHA00732 hypothetical protein   85.9    0.63 1.4E-05   29.4   2.0   24   42-65      2-25  (79)
 25 PF02892 zf-BED:  BED zinc fing  85.9    0.34 7.4E-06   26.5   0.7   26   41-66     16-45  (45)
 26 PHA00733 hypothetical protein   84.6    0.59 1.3E-05   31.7   1.5   21   42-62     74-94  (128)
 27 PF04988 AKAP95:  A-kinase anch  78.0    0.97 2.1E-05   32.8   0.7   23   42-64      1-23  (165)
 28 PF04423 Rad50_zn_hook:  Rad50   74.8    0.98 2.1E-05   26.0   0.0   21   43-63     22-44  (54)
 29 smart00614 ZnF_BED BED zinc fi  73.5     1.7 3.6E-05   24.7   0.8   27   41-67     18-49  (50)
 30 PTZ00448 hypothetical protein;  70.3     2.4 5.3E-05   34.1   1.3   24   41-64    314-337 (373)
 31 PF09986 DUF2225:  Uncharacteri  69.9    0.72 1.6E-05   33.5  -1.6   16   40-55      4-19  (214)
 32 KOG2482|consensus               69.8     2.7 5.9E-05   34.2   1.5   25   41-65    195-220 (423)
 33 PHA00733 hypothetical protein   69.1     2.9 6.3E-05   28.3   1.3   24   43-66    101-124 (128)
 34 COG2879 Uncharacterized small   66.1     5.6 0.00012   24.9   2.0   22   49-70     20-41  (65)
 35 KOG2785|consensus               64.7     4.1 8.8E-05   33.1   1.6   28   37-64     64-91  (390)
 36 KOG1074|consensus               62.5       2 4.4E-05   38.1  -0.5   28   41-68    381-408 (958)
 37 KOG2462|consensus               62.0     4.2 9.2E-05   31.6   1.2   23   41-63    215-237 (279)
 38 PF12013 DUF3505:  Protein of u  58.7     5.2 0.00011   25.6   1.0   25   41-65     80-108 (109)
 39 PF07800 DUF1644:  Protein of u  58.0     8.6 0.00019   27.8   2.1   32   38-69     77-136 (162)
 40 PF13465 zf-H2C2_2:  Zinc-finge  57.6     2.3 5.1E-05   21.2  -0.6   13   40-52     13-25  (26)
 41 KOG0717|consensus               57.5     3.7 7.9E-05   34.3   0.1   25   42-66    293-318 (508)
 42 KOG3608|consensus               57.1     7.2 0.00016   32.0   1.8   27   42-68    264-290 (467)
 43 PLN02748 tRNA dimethylallyltra  56.0     5.4 0.00012   32.6   0.9   26   40-65    417-444 (468)
 44 KOG1146|consensus               53.8     4.7  0.0001   37.3   0.3   29   40-68    464-492 (1406)
 45 PF04959 ARS2:  Arsenite-resist  52.6     4.1   9E-05   30.2  -0.2   26   41-66     77-102 (214)
 46 smart00504 Ubox Modified RING   52.0      16 0.00034   20.5   2.2   12   42-53      2-13  (63)
 47 PF05290 Baculo_IE-1:  Baculovi  50.7     5.5 0.00012   28.3   0.1   15   40-54    120-134 (140)
 48 PF03884 DUF329:  Domain of unk  49.8     4.9 0.00011   24.3  -0.2   14   40-53      1-14  (57)
 49 PF11931 DUF3449:  Domain of un  49.7     5.5 0.00012   29.4   0.0   28   39-66     99-128 (196)
 50 KOG3408|consensus               47.8     9.8 0.00021   26.7   1.0   24   42-65     58-82  (129)
 51 PF13719 zinc_ribbon_5:  zinc-r  47.1     5.3 0.00012   21.6  -0.3   14   40-53      1-14  (37)
 52 COG4338 Uncharacterized protei  46.4     8.2 0.00018   23.3   0.4   21   42-62     13-33  (54)
 53 TIGR02652 conserved hypothetic  44.9     8.6 0.00019   27.8   0.4   13   41-53      9-21  (163)
 54 PF09654 DUF2396:  Protein of u  44.9     8.7 0.00019   27.7   0.4   13   41-53      6-18  (161)
 55 KOG1074|consensus               44.3      15 0.00033   32.9   1.8   25   42-67    880-904 (958)
 56 KOG2462|consensus               44.2     7.3 0.00016   30.4  -0.1   29   39-67    241-269 (279)
 57 PF07535 zf-DBF:  DBF zinc fing  43.9     6.6 0.00014   23.0  -0.3   19   43-64      7-25  (49)
 58 TIGR02098 MJ0042_CXXC MJ0042 f  43.3     6.4 0.00014   20.8  -0.4   15   40-54      1-15  (38)
 59 PF10146 zf-C4H2:  Zinc finger-  40.5      12 0.00026   27.9   0.6   18   42-69    209-226 (230)
 60 COG4049 Uncharacterized protei  40.2      10 0.00022   23.6   0.2   24   42-65     18-41  (65)
 61 TIGR01206 lysW lysine biosynth  39.6     8.9 0.00019   22.8  -0.2   13   41-53      2-14  (54)
 62 COG5539 Predicted cysteine pro  38.8      11 0.00024   29.7   0.2   28   37-64    271-298 (306)
 63 PF12230 PRP21_like_P:  Pre-mRN  38.6      10 0.00022   27.3   0.0   23   39-62    166-188 (229)
 64 COG1655 Uncharacterized protei  36.5      12 0.00025   29.1  -0.0   14   41-54     19-32  (267)
 65 PTZ00417 lysine-tRNA ligase; P  36.4      15 0.00032   30.9   0.6   24   38-61     32-56  (585)
 66 KOG3623|consensus               36.4      19 0.00041   32.2   1.2   30   37-67    277-306 (1007)
 67 COG5246 PRP11 Splicing factor   36.0      16 0.00035   27.5   0.7   24   41-64     53-76  (222)
 68 PRK11088 rrmA 23S rRNA methylt  35.5      12 0.00027   27.1   0.0   13   41-53      2-14  (272)
 69 KOG3576|consensus               35.1      20 0.00044   27.6   1.1   32   39-70    210-241 (267)
 70 PF03194 LUC7:  LUC7 N_terminus  33.2      21 0.00045   26.8   0.9   23   42-64    191-216 (254)
 71 PF06348 DUF1059:  Protein of u  33.2      35 0.00076   20.0   1.7   24   54-77     26-49  (57)
 72 KOG2893|consensus               33.2      20 0.00043   28.2   0.8   29   39-67      8-36  (341)
 73 KOG1280|consensus               33.0      29 0.00062   28.2   1.7   30   40-69     78-107 (381)
 74 PF05741 zf-nanos:  Nanos RNA b  32.3      17 0.00037   21.8   0.3   11   41-51     33-43  (55)
 75 PF13717 zinc_ribbon_4:  zinc-r  31.8      13 0.00028   20.1  -0.3   14   40-53      1-14  (36)
 76 KOG2505|consensus               30.8      27 0.00059   29.8   1.3   23   42-64     67-89  (591)
 77 PF15227 zf-C3HC4_4:  zinc fing  30.8      14 0.00031   20.3  -0.3   14   44-57      1-14  (42)
 78 KOG2636|consensus               30.6      25 0.00055   29.4   1.0   23   40-62    400-423 (497)
 79 PF04564 U-box:  U-box domain;   28.5      47   0.001   19.9   1.8   29   42-70      5-44  (73)
 80 smart00586 ZnF_DBF Zinc finger  28.5      18  0.0004   21.2  -0.1   19   43-64      7-25  (49)
 81 COG5188 PRP9 Splicing factor 3  27.2      28  0.0006   28.7   0.7   34   35-68    232-266 (470)
 82 KOG0227|consensus               27.2      32 0.00069   26.0   1.0   25   41-65     53-78  (222)
 83 KOG1493|consensus               26.4      24 0.00051   23.1   0.1   11   42-52     71-81  (84)
 84 PF04328 DUF466:  Protein of un  26.1      42 0.00092   20.4   1.2   23   51-73     22-44  (65)
 85 PRK00420 hypothetical protein;  26.0      44 0.00095   22.6   1.4   21   33-53     15-35  (112)
 86 PF09538 FYDLN_acid:  Protein o  25.6      25 0.00054   23.4   0.2   13   42-54     27-39  (108)
 87 PF13445 zf-RING_UBOX:  RING-ty  25.3      19 0.00041   20.2  -0.4    9   44-53      1-9   (43)
 88 KOG4696|consensus               25.0      39 0.00086   27.3   1.2   21   41-62      2-22  (393)
 89 KOG0717|consensus               25.0      40 0.00086   28.4   1.2   26   40-65    459-485 (508)
 90 PF14357 DUF4404:  Domain of un  24.9      41  0.0009   21.3   1.1   16   54-69     55-70  (85)
 91 PLN00104 MYST -like histone ac  24.6      52  0.0011   27.2   1.8   23   40-62    197-219 (450)
 92 PF13462 Thioredoxin_4:  Thiore  24.6      21 0.00045   22.9  -0.4   22   40-61     20-41  (162)
 93 PF10886 DUF2685:  Protein of u  24.0      26 0.00057   21.2   0.0   22   43-64      3-36  (54)
 94 PF14634 zf-RING_5:  zinc-RING   23.5      27 0.00058   18.9  -0.0   10   40-49     35-44  (44)
 95 PF02891 zf-MIZ:  MIZ/SP-RING z  23.3      49  0.0011   18.8   1.1   18   32-49     32-49  (50)
 96 PRK01343 zinc-binding protein;  23.3      29 0.00063   21.1   0.1   14   40-53      8-21  (57)
 97 KOG3623|consensus               23.0      48   0.001   29.8   1.4   30   40-69    239-268 (1007)
 98 PF14353 CpXC:  CpXC protein     23.0      13 0.00028   24.4  -1.6   26   40-65     37-62  (128)
 99 TIGR00373 conserved hypothetic  22.9      26 0.00057   24.3  -0.1   14   40-53    127-140 (158)
100 PF13920 zf-C3HC4_3:  Zinc fing  22.9      38 0.00082   18.6   0.5   12   40-51     36-47  (50)
101 PF05443 ROS_MUCR:  ROS/MUCR tr  22.5      37  0.0008   23.5   0.5   22   41-65     72-93  (132)
102 KOG4172|consensus               22.4      20 0.00044   22.1  -0.7   19   39-57     41-60  (62)
103 PF10013 DUF2256:  Uncharacteri  22.3      37 0.00079   19.6   0.4   18   42-59      9-26  (42)
104 cd02970 PRX_like2 Peroxiredoxi  22.2      33 0.00072   21.6   0.2   20   43-62     35-54  (149)
105 cd03000 PDI_a_TMX3 PDIa family  21.9      53  0.0011   20.0   1.1   19   44-62     27-45  (104)
106 TIGR02738 TrbB type-F conjugat  21.7      28  0.0006   24.0  -0.2   18   44-61     62-79  (153)
107 PHA02610 uvsY.-2 hypothetical   21.2      28 0.00061   21.0  -0.2   11   43-53      3-13  (53)
108 PLN03239 histone acetyltransfe  20.8      64  0.0014   25.9   1.6   22   41-62    106-127 (351)
109 PF15176 LRR19-TM:  Leucine-ric  20.4      25 0.00055   23.7  -0.6   22   39-60     35-58  (102)
110 PHA02929 N1R/p28-like protein;  20.2      33 0.00072   25.8  -0.1   13   41-53    216-228 (238)
111 COG5432 RAD18 RING-finger-cont  20.1      64  0.0014   26.1   1.5   22   42-64    161-182 (391)
112 cd00162 RING RING-finger (Real  20.1      38 0.00082   16.8   0.1   11   40-50     34-44  (45)
113 KOG3288|consensus               20.0      49  0.0011   26.1   0.8   28   37-64    272-299 (307)

No 1  
>KOG4118|consensus
Probab=99.97  E-value=1.7e-31  Score=168.46  Aligned_cols=74  Identities=73%  Similarity=1.079  Sum_probs=72.3

Q ss_pred             CcchHHHHHHHHHHHHHHHHHHhhcCCChhhHHHHHHhhhhccchhhhhcCCChhhHhHHHHcCCCCCCCCchhhhh
Q psy11933          1 MARGQQKLQSQAKAQEKQAKAKKQQGHSLLDQKKAAQKALVHACVVCKAQMPDPKTYKQHFENKHPKNDLPEDLKDV   77 (79)
Q Consensus         1 M~rG~qK~q~q~r~~~k~~~~~~~~~~s~~sq~ka~~aA~~~~C~vC~~~f~~~k~l~~H~esKHpK~~~p~e~~~~   77 (79)
                      |+||+||+|+|+||++++++++++.|+   ||++++.+||.++|.||+.+||++++|++||||||||++||+||.+|
T Consensus         1 MARGhQKiqSQqknaeKqAkakk~~G~---DQK~AA~~aL~~kCtVC~~~mpdpktfkqhfe~kHpk~~~P~eL~~v   74 (74)
T KOG4118|consen    1 MARGHQKIQSQQKNAEKQAKAKKKQGH---DQKAAAMAALHHKCTVCMVQMPDPKTFKQHFENKHPKEPLPEELSEV   74 (74)
T ss_pred             CcchHHHHHHHHHHHHHHHHHHHHcCc---cHHHHHHHHHHhhhHhhHhhCCCCchHHHHHhhcCCCCCCCHhhccC
Confidence            999999999999999999999999998   99999999999999999999999999999999999999999999876


No 2  
>PF12907 zf-met2:  Zinc-binding
Probab=99.57  E-value=4.3e-16  Score=89.15  Aligned_cols=35  Identities=34%  Similarity=0.608  Sum_probs=31.5

Q ss_pred             hccchhhhhcCCC---hhhHhHHHHcCCCCCCCCchhh
Q psy11933         41 VHACVVCKAQMPD---PKTYKQHFENKHPKNDLPEDLK   75 (79)
Q Consensus        41 ~~~C~vC~~~f~~---~k~l~~H~esKHpK~~~p~e~~   75 (79)
                      +|+|+|||++||.   +++|++|+||||||.+|++++=
T Consensus         1 ~i~C~iC~qtF~~t~~~~~L~eH~enKHpK~~~~~CFP   38 (40)
T PF12907_consen    1 NIICKICRQTFMQTTNEPQLKEHAENKHPKNTFEECFP   38 (40)
T ss_pred             CcCcHHhhHHHHhcCCHHHHHHHHHccCCCCCHHHcCC
Confidence            5899999999998   8999999999999998887653


No 3  
>PF04419 4F5:  4F5 protein family;  InterPro: IPR007513 Members of this family are short proteins that are rich in aspartate, glutamate, lysine and arginine. Although the function of these proteins is unknown, they are found to be ubiquitously expressed [].; PDB: 1WVK_A.
Probab=98.00  E-value=7.8e-08  Score=54.17  Aligned_cols=38  Identities=53%  Similarity=0.632  Sum_probs=18.0

Q ss_pred             CcchHHHHHHHHHHHHHHHHHHhhcCCChhhHHHHHHhhhh
Q psy11933          1 MARGQQKLQSQAKAQEKQAKAKKQQGHSLLDQKKAAQKALV   41 (79)
Q Consensus         1 M~rG~qK~q~q~r~~~k~~~~~~~~~~s~~sq~ka~~aA~~   41 (79)
                      |+||||+.++|+||.+++++.+++.++   ||++.++.+|+
T Consensus         1 MtRGnQr~~aRekn~Kk~~~~~~k~~~---s~l~~~~~~l~   38 (38)
T PF04419_consen    1 MTRGNQREQAREKNQKKQAKQKKKGGK---SGLKAAQRALN   38 (38)
T ss_dssp             ---SGGGTTTSTTT---SS---SS-SS----SS----TT--
T ss_pred             CccHhHHHHHHHHHHHHhhccccCCCc---cchhHHHHhcC
Confidence            999999999999999999776555555   89999888764


No 4  
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.24  E-value=0.0001  Score=36.40  Aligned_cols=23  Identities=22%  Similarity=0.634  Sum_probs=21.4

Q ss_pred             ccchhhhhcCCChhhHhHHHHcC
Q psy11933         42 HACVVCKAQMPDPKTYKQHFENK   64 (79)
Q Consensus        42 ~~C~vC~~~f~~~k~l~~H~esK   64 (79)
                      +.|.||..+|.++.+|.+|+.++
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            57999999999999999999876


No 5  
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.09  E-value=0.00019  Score=34.01  Aligned_cols=24  Identities=21%  Similarity=0.609  Sum_probs=20.1

Q ss_pred             ccchhhhhcCCChhhHhHHHHcCC
Q psy11933         42 HACVVCKAQMPDPKTYKQHFENKH   65 (79)
Q Consensus        42 ~~C~vC~~~f~~~k~l~~H~esKH   65 (79)
                      ++|++|..+|.+...|..|....|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            589999999999999999998765


No 6  
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=96.90  E-value=0.00031  Score=34.00  Aligned_cols=22  Identities=18%  Similarity=0.545  Sum_probs=20.5

Q ss_pred             ccchhhhhcCCChhhHhHHHHc
Q psy11933         42 HACVVCKAQMPDPKTYKQHFEN   63 (79)
Q Consensus        42 ~~C~vC~~~f~~~k~l~~H~es   63 (79)
                      |+|++|...|.+...|..|...
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            6899999999999999999876


No 7  
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=96.42  E-value=0.0016  Score=32.57  Aligned_cols=25  Identities=12%  Similarity=0.343  Sum_probs=22.5

Q ss_pred             ccchhhhhcCCChhhHhHHHHcCCC
Q psy11933         42 HACVVCKAQMPDPKTYKQHFENKHP   66 (79)
Q Consensus        42 ~~C~vC~~~f~~~k~l~~H~esKHp   66 (79)
                      +.|.+|..+|.+...|..|-...|+
T Consensus         2 ~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    2 FECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             EEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCccCCccCChhHHHHHhHHhcC
Confidence            6899999999999999999976665


No 8  
>smart00355 ZnF_C2H2 zinc finger.
Probab=95.51  E-value=0.0076  Score=28.33  Aligned_cols=24  Identities=21%  Similarity=0.490  Sum_probs=21.2

Q ss_pred             ccchhhhhcCCChhhHhHHHHcCCC
Q psy11933         42 HACVVCKAQMPDPKTYKQHFENKHP   66 (79)
Q Consensus        42 ~~C~vC~~~f~~~k~l~~H~esKHp   66 (79)
                      +.|++|..+|.....|..|.. .|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~-~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMR-THX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHH-Hhc
Confidence            579999999999999999998 554


No 9  
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=95.43  E-value=0.0042  Score=31.45  Aligned_cols=23  Identities=26%  Similarity=0.550  Sum_probs=21.5

Q ss_pred             ccchhhhhcCCChhhHhHHHHcC
Q psy11933         42 HACVVCKAQMPDPKTYKQHFENK   64 (79)
Q Consensus        42 ~~C~vC~~~f~~~k~l~~H~esK   64 (79)
                      +.|.+|.-.|.+...|.+|..+|
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~sk   24 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKSK   24 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTSH
T ss_pred             CCcccCCCCcCCHHHHHHHHccC
Confidence            68999999999999999999875


No 10 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=95.20  E-value=0.01  Score=35.96  Aligned_cols=28  Identities=25%  Similarity=0.610  Sum_probs=21.9

Q ss_pred             ccchhhhhcCCChhhHhHHHHcCCCCCC
Q psy11933         42 HACVVCKAQMPDPKTYKQHFENKHPKND   69 (79)
Q Consensus        42 ~~C~vC~~~f~~~k~l~~H~esKHpK~~   69 (79)
                      .+|++|...+.....|+.|.|..|-+.|
T Consensus        25 atCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   25 ATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             CCCCcchhhccchhhHHHHHHHHhcccC
Confidence            5899999999999999999999996653


No 11 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=95.14  E-value=0.0088  Score=31.14  Aligned_cols=24  Identities=21%  Similarity=0.506  Sum_probs=22.2

Q ss_pred             hccchhhhhcCCChhhHhHHHHcC
Q psy11933         41 VHACVVCKAQMPDPKTYKQHFENK   64 (79)
Q Consensus        41 ~~~C~vC~~~f~~~k~l~~H~esK   64 (79)
                      .+.|.+|...|.+...+..|..++
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~gk   26 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKGK   26 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHChH
Confidence            478999999999999999999987


No 12 
>KOG4488|consensus
Probab=94.89  E-value=0.033  Score=35.30  Aligned_cols=26  Identities=31%  Similarity=0.385  Sum_probs=20.9

Q ss_pred             CcchHHHHHHHHHHHHHHHHHHhhcC
Q psy11933          1 MARGQQKLQSQAKAQEKQAKAKKQQG   26 (79)
Q Consensus         1 M~rG~qK~q~q~r~~~k~~~~~~~~~   26 (79)
                      |+||||.--++++|.++.+...++..
T Consensus         1 MtRGNQRdLaRqKN~KK~~d~~K~kr   26 (70)
T KOG4488|consen    1 MTRGNQRDLARQKNMKKQQDIAKGKR   26 (70)
T ss_pred             CCcchHHHHHHHHHHHHHHHHHhccc
Confidence            99999988779999999885554433


No 13 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=94.14  E-value=0.025  Score=34.27  Aligned_cols=30  Identities=20%  Similarity=0.503  Sum_probs=24.0

Q ss_pred             hccchhhhhcCCChhhHhHHHHcC-CCCCCC
Q psy11933         41 VHACVVCKAQMPDPKTYKQHFENK-HPKNDL   70 (79)
Q Consensus        41 ~~~C~vC~~~f~~~k~l~~H~esK-HpK~~~   70 (79)
                      .+.|.+|...|.+...|.+|..++ |.+...
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~~~H~~~~~   80 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRSKHHKKRNS   80 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHHTTTTC-S-
T ss_pred             CCCCCccCCCCcCHHHHHHHHcCccCCCccc
Confidence            589999999999999999999988 655433


No 14 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=93.69  E-value=0.05  Score=31.47  Aligned_cols=28  Identities=18%  Similarity=0.373  Sum_probs=23.9

Q ss_pred             hccchhhhhcCCChhhHhHHHHcCCCCCC
Q psy11933         41 VHACVVCKAQMPDPKTYKQHFENKHPKND   69 (79)
Q Consensus        41 ~~~C~vC~~~f~~~k~l~~H~esKHpK~~   69 (79)
                      .|.||.|.. -.+...|..|.+..|+...
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~   29 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSES   29 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCC
Confidence            488999999 6778899999999998653


No 15 
>PHA00616 hypothetical protein
Probab=93.64  E-value=0.039  Score=32.05  Aligned_cols=32  Identities=22%  Similarity=0.415  Sum_probs=28.0

Q ss_pred             ccchhhhhcCCChhhHhHHHHcCCCCCCCCch
Q psy11933         42 HACVVCKAQMPDPKTYKQHFENKHPKNDLPED   73 (79)
Q Consensus        42 ~~C~vC~~~f~~~k~l~~H~esKHpK~~~p~e   73 (79)
                      ++|+-|...|...+.|..|..+.|--.+|--|
T Consensus         2 YqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~   33 (44)
T PHA00616          2 YQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLE   33 (44)
T ss_pred             CccchhhHHHhhHHHHHHHHHHhcCCCcccee
Confidence            68999999999999999999988877776544


No 16 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=92.52  E-value=0.033  Score=27.12  Aligned_cols=24  Identities=25%  Similarity=0.596  Sum_probs=19.5

Q ss_pred             ccchhhhhcCCChhhHhHHHHcCCC
Q psy11933         42 HACVVCKAQMPDPKTYKQHFENKHP   66 (79)
Q Consensus        42 ~~C~vC~~~f~~~k~l~~H~esKHp   66 (79)
                      |.|+.|--... +..|..|....||
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhCc
Confidence            57999998887 9999999998886


No 17 
>KOG1842|consensus
Probab=91.60  E-value=0.1  Score=43.14  Aligned_cols=29  Identities=21%  Similarity=0.560  Sum_probs=26.6

Q ss_pred             hccchhhhhcCCChhhHhHHHHcCCCCCC
Q psy11933         41 VHACVVCKAQMPDPKTYKQHFENKHPKND   69 (79)
Q Consensus        41 ~~~C~vC~~~f~~~k~l~~H~esKHpK~~   69 (79)
                      .|.||||+.-|++...|..|++.-|+-+.
T Consensus        15 gflCPiC~~dl~~~~~L~~H~d~eH~~ed   43 (505)
T KOG1842|consen   15 GFLCPICLLDLPNLSALNDHLDVEHFEED   43 (505)
T ss_pred             cccCchHhhhhhhHHHHHHHHhhhccccc
Confidence            48999999999999999999999998654


No 18 
>PHA02768 hypothetical protein; Provisional
Probab=91.34  E-value=0.14  Score=30.97  Aligned_cols=26  Identities=23%  Similarity=0.428  Sum_probs=23.6

Q ss_pred             hhccchhhhhcCCChhhHhHHHHcCCC
Q psy11933         40 LVHACVVCKAQMPDPKTYKQHFENKHP   66 (79)
Q Consensus        40 ~~~~C~vC~~~f~~~k~l~~H~esKHp   66 (79)
                      +.|.|++|...|.....|..|... |.
T Consensus         4 ~~y~C~~CGK~Fs~~~~L~~H~r~-H~   29 (55)
T PHA02768          4 LGYECPICGEIYIKRKSMITHLRK-HN   29 (55)
T ss_pred             cccCcchhCCeeccHHHHHHHHHh-cC
Confidence            568999999999999999999997 55


No 19 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=89.38  E-value=0.11  Score=31.37  Aligned_cols=26  Identities=23%  Similarity=0.556  Sum_probs=0.0

Q ss_pred             cchhhhhcCCChhhHhHHHHcCCCCC
Q psy11933         43 ACVVCKAQMPDPKTYKQHFENKHPKN   68 (79)
Q Consensus        43 ~C~vC~~~f~~~k~l~~H~esKHpK~   68 (79)
                      .|.+|...|.+...|.+|....|.-.
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~   26 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFD   26 (100)
T ss_dssp             --------------------------
T ss_pred             Cccccccccccccccccccccccccc
Confidence            59999999999999999999999643


No 20 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=89.20  E-value=0.23  Score=25.44  Aligned_cols=20  Identities=20%  Similarity=0.519  Sum_probs=16.6

Q ss_pred             ccchhhhhcCCChhhHhHHHH
Q psy11933         42 HACVVCKAQMPDPKTYKQHFE   62 (79)
Q Consensus        42 ~~C~vC~~~f~~~k~l~~H~e   62 (79)
                      +.||||.+.+ ....+..|.+
T Consensus         2 v~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        2 VQCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             CcCCCCcCcc-cHHHHHHHHH
Confidence            5799999998 6677888877


No 21 
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=88.37  E-value=0.23  Score=40.70  Aligned_cols=32  Identities=28%  Similarity=0.628  Sum_probs=27.3

Q ss_pred             ccchhhhhcCCChhhHhHHHHcCCCCCCCCchh
Q psy11933         42 HACVVCKAQMPDPKTYKQHFENKHPKNDLPEDL   74 (79)
Q Consensus        42 ~~C~vC~~~f~~~k~l~~H~esKHpK~~~p~e~   74 (79)
                      -+|++|-..|++...+..|.+++|+-. ++|.+
T Consensus        58 WiCp~CskkF~d~~~~~~H~~~eH~~~-l~P~l   89 (466)
T PF04780_consen   58 WICPRCSKKFSDAESCLSHMEQEHPAG-LKPKL   89 (466)
T ss_pred             eeCCcccceeCCHHHHHHHHHHhhhhh-cChhh
Confidence            469999999999999999999999865 44444


No 22 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=88.30  E-value=0.27  Score=24.84  Aligned_cols=20  Identities=20%  Similarity=0.669  Sum_probs=16.7

Q ss_pred             ccchhhhhcCCChhhHhHHHH
Q psy11933         42 HACVVCKAQMPDPKTYKQHFE   62 (79)
Q Consensus        42 ~~C~vC~~~f~~~k~l~~H~e   62 (79)
                      +.|++|..+| .+..|..|..
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHH
Confidence            5799999999 7778888864


No 23 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=86.69  E-value=0.32  Score=28.03  Aligned_cols=24  Identities=21%  Similarity=0.617  Sum_probs=19.8

Q ss_pred             hhccchhhhhcCCChhhHhHHHHcCC
Q psy11933         40 LVHACVVCKAQMPDPKTYKQHFENKH   65 (79)
Q Consensus        40 ~~~~C~vC~~~f~~~k~l~~H~esKH   65 (79)
                      .+++||||-..+.+  .|..|+...|
T Consensus        30 ~~v~CPiC~~~~~~--~l~~Hl~~~H   53 (54)
T PF05605_consen   30 KNVVCPICSSRVTD--NLIRHLNSQH   53 (54)
T ss_pred             CCccCCCchhhhhh--HHHHHHHHhc
Confidence            46999999987664  8899998877


No 24 
>PHA00732 hypothetical protein
Probab=85.89  E-value=0.63  Score=29.39  Aligned_cols=24  Identities=25%  Similarity=0.419  Sum_probs=14.5

Q ss_pred             ccchhhhhcCCChhhHhHHHHcCC
Q psy11933         42 HACVVCKAQMPDPKTYKQHFENKH   65 (79)
Q Consensus        42 ~~C~vC~~~f~~~k~l~~H~esKH   65 (79)
                      +.|.+|...|.....|..|....|
T Consensus         2 y~C~~Cgk~F~s~s~Lk~H~r~~H   25 (79)
T PHA00732          2 FKCPICGFTTVTLFALKQHARRNH   25 (79)
T ss_pred             ccCCCCCCccCCHHHHHHHhhccc
Confidence            456666666666666666665434


No 25 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=85.88  E-value=0.34  Score=26.47  Aligned_cols=26  Identities=27%  Similarity=0.585  Sum_probs=19.9

Q ss_pred             hccchhhhhcCCC----hhhHhHHHHcCCC
Q psy11933         41 VHACVVCKAQMPD----PKTYKQHFENKHP   66 (79)
Q Consensus        41 ~~~C~vC~~~f~~----~k~l~~H~esKHp   66 (79)
                      ...|..|...+..    -..|..|...+||
T Consensus        16 ~a~C~~C~~~~~~~~~~ts~l~~HL~~~hp   45 (45)
T PF02892_consen   16 KAKCKYCGKVIKYSSGGTSNLKRHLKKKHP   45 (45)
T ss_dssp             -EEETTTTEE-----SSTHHHHHHHHHTTH
T ss_pred             eEEeCCCCeEEeeCCCcHHHHHHhhhhhCc
Confidence            4689999999887    5899999999997


No 26 
>PHA00733 hypothetical protein
Probab=84.65  E-value=0.59  Score=31.67  Aligned_cols=21  Identities=24%  Similarity=0.539  Sum_probs=12.3

Q ss_pred             ccchhhhhcCCChhhHhHHHH
Q psy11933         42 HACVVCKAQMPDPKTYKQHFE   62 (79)
Q Consensus        42 ~~C~vC~~~f~~~k~l~~H~e   62 (79)
                      +.|+.|...|.....|..|..
T Consensus        74 y~C~~Cgk~Fss~s~L~~H~r   94 (128)
T PHA00733         74 YVCPLCLMPFSSSVSLKQHIR   94 (128)
T ss_pred             ccCCCCCCcCCCHHHHHHHHh
Confidence            556666666666555555554


No 27 
>PF04988 AKAP95:  A-kinase anchoring protein 95 (AKAP95);  InterPro: IPR007071 A-kinase (or PKA)-anchoring protein AKAP95 is implicated in mitotic chromosome condensation by acting as a targeting molecule for the condensin complex. The protein contains two zinc fingers which are thought to mediate the binding of AKAP95 to DNA [].; GO: 0003677 DNA binding, 0005634 nucleus
Probab=78.01  E-value=0.97  Score=32.76  Aligned_cols=23  Identities=30%  Similarity=0.632  Sum_probs=21.2

Q ss_pred             ccchhhhhcCCChhhHhHHHHcC
Q psy11933         42 HACVVCKAQMPDPKTYKQHFENK   64 (79)
Q Consensus        42 ~~C~vC~~~f~~~k~l~~H~esK   64 (79)
                      |.|++|+-..-....+..|++|+
T Consensus         1 F~Cs~CKfrtf~~~ei~~HleS~   23 (165)
T PF04988_consen    1 FTCSFCKFRTFEEKEIEKHLESK   23 (165)
T ss_pred             CccceeeeecccHHHHHHHHccc
Confidence            68999999888899999999998


No 28 
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=74.81  E-value=0.98  Score=26.01  Aligned_cols=21  Identities=10%  Similarity=0.542  Sum_probs=11.7

Q ss_pred             cchhhhhcCCC--hhhHhHHHHc
Q psy11933         43 ACVVCKAQMPD--PKTYKQHFEN   63 (79)
Q Consensus        43 ~C~vC~~~f~~--~k~l~~H~es   63 (79)
                      .||||...|..  ...|..++.+
T Consensus        22 ~CPlC~r~l~~e~~~~li~~~~~   44 (54)
T PF04423_consen   22 CCPLCGRPLDEEHRQELIKKYKS   44 (54)
T ss_dssp             E-TTT--EE-HHHHHHHHHHHHH
T ss_pred             cCCCCCCCCCHHHHHHHHHHHHH
Confidence            89999999988  4455555543


No 29 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=73.45  E-value=1.7  Score=24.67  Aligned_cols=27  Identities=22%  Similarity=0.620  Sum_probs=23.2

Q ss_pred             hccchhhhhcCCCh-----hhHhHHHHcCCCC
Q psy11933         41 VHACVVCKAQMPDP-----KTYKQHFENKHPK   67 (79)
Q Consensus        41 ~~~C~vC~~~f~~~-----k~l~~H~esKHpK   67 (79)
                      ..+|..|...+...     ..|..|..++||.
T Consensus        18 ~a~C~~C~~~l~~~~~~gTs~L~rHl~~~h~~   49 (50)
T smart00614       18 RAKCKYCGKKLSRSSKGGTSNLRRHLRRKHPA   49 (50)
T ss_pred             EEEecCCCCEeeeCCCCCcHHHHHHHHhHCcC
Confidence            46899999998664     6999999999985


No 30 
>PTZ00448 hypothetical protein; Provisional
Probab=70.33  E-value=2.4  Score=34.11  Aligned_cols=24  Identities=29%  Similarity=0.701  Sum_probs=22.0

Q ss_pred             hccchhhhhcCCChhhHhHHHHcC
Q psy11933         41 VHACVVCKAQMPDPKTYKQHFENK   64 (79)
Q Consensus        41 ~~~C~vC~~~f~~~k~l~~H~esK   64 (79)
                      .+.|..|..+|.+....++||.|-
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KSD  337 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRSE  337 (373)
T ss_pred             CccccccccccCCHHHHHHHhhhh
Confidence            477999999999999999999986


No 31 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=69.85  E-value=0.72  Score=33.53  Aligned_cols=16  Identities=25%  Similarity=0.480  Sum_probs=13.2

Q ss_pred             hhccchhhhhcCCChh
Q psy11933         40 LVHACVVCKAQMPDPK   55 (79)
Q Consensus        40 ~~~~C~vC~~~f~~~k   55 (79)
                      .+++||||.+.|....
T Consensus         4 k~~~CPvC~~~F~~~~   19 (214)
T PF09986_consen    4 KKITCPVCGKEFKTKK   19 (214)
T ss_pred             CceECCCCCCeeeeeE
Confidence            3589999999999843


No 32 
>KOG2482|consensus
Probab=69.84  E-value=2.7  Score=34.17  Aligned_cols=25  Identities=32%  Similarity=0.655  Sum_probs=23.3

Q ss_pred             hccchhhhhcCCChhhHhHHHHcC-C
Q psy11933         41 VHACVVCKAQMPDPKTYKQHFENK-H   65 (79)
Q Consensus        41 ~~~C~vC~~~f~~~k~l~~H~esK-H   65 (79)
                      .+.|=-|-..|++.++|++|...| |
T Consensus       195 r~~CLyCekifrdkntLkeHMrkK~H  220 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRKKRH  220 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHhccC
Confidence            478999999999999999999998 6


No 33 
>PHA00733 hypothetical protein
Probab=69.06  E-value=2.9  Score=28.27  Aligned_cols=24  Identities=25%  Similarity=0.542  Sum_probs=21.5

Q ss_pred             cchhhhhcCCChhhHhHHHHcCCC
Q psy11933         43 ACVVCKAQMPDPKTYKQHFENKHP   66 (79)
Q Consensus        43 ~C~vC~~~f~~~k~l~~H~esKHp   66 (79)
                      .|++|...|.....|..|..-+|.
T Consensus       101 ~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733        101 VCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             cCCCCCCccCCHHHHHHHHHHhcC
Confidence            799999999999999999988885


No 34 
>COG2879 Uncharacterized small protein [Function unknown]
Probab=66.14  E-value=5.6  Score=24.95  Aligned_cols=22  Identities=32%  Similarity=0.646  Sum_probs=19.5

Q ss_pred             hcCCChhhHhHHHHcCCCCCCC
Q psy11933         49 AQMPDPKTYKQHFENKHPKNDL   70 (79)
Q Consensus        49 ~~f~~~k~l~~H~esKHpK~~~   70 (79)
                      ...||...|.+|...+||..|.
T Consensus        20 vGvpdYdnYVehmr~~hPd~p~   41 (65)
T COG2879          20 VGVPDYDNYVEHMRKKHPDKPP   41 (65)
T ss_pred             cCCCcHHHHHHHHHHhCcCCCc
Confidence            4678999999999999998875


No 35 
>KOG2785|consensus
Probab=64.73  E-value=4.1  Score=33.06  Aligned_cols=28  Identities=25%  Similarity=0.560  Sum_probs=24.7

Q ss_pred             HhhhhccchhhhhcCCChhhHhHHHHcC
Q psy11933         37 QKALVHACVVCKAQMPDPKTYKQHFENK   64 (79)
Q Consensus        37 ~aA~~~~C~vC~~~f~~~k~l~~H~esK   64 (79)
                      ++-+-+.|.||+..|..+....+|.-||
T Consensus        64 ~~~~~~~c~~c~k~~~s~~a~~~hl~Sk   91 (390)
T KOG2785|consen   64 EAESVVYCEACNKSFASPKAHENHLKSK   91 (390)
T ss_pred             hcccceehHHhhccccChhhHHHHHHHh
Confidence            4456688999999999999999999887


No 36 
>KOG1074|consensus
Probab=62.48  E-value=2  Score=38.08  Aligned_cols=28  Identities=25%  Similarity=0.503  Sum_probs=20.0

Q ss_pred             hccchhhhhcCCChhhHhHHHHcCCCCC
Q psy11933         41 VHACVVCKAQMPDPKTYKQHFENKHPKN   68 (79)
Q Consensus        41 ~~~C~vC~~~f~~~k~l~~H~esKHpK~   68 (79)
                      -|+|.||...|..+-.|+-||.-.|-|.
T Consensus       381 PfqCnvCG~~FSTkGNLKvH~~rH~e~~  408 (958)
T KOG1074|consen  381 PFQCNVCGNRFSTKGNLKVHFQRHREKY  408 (958)
T ss_pred             CeeecccccccccccceeeeeeeccccC
Confidence            3778888888888777777777555443


No 37 
>KOG2462|consensus
Probab=62.00  E-value=4.2  Score=31.64  Aligned_cols=23  Identities=17%  Similarity=0.512  Sum_probs=19.5

Q ss_pred             hccchhhhhcCCChhhHhHHHHc
Q psy11933         41 VHACVVCKAQMPDPKTYKQHFEN   63 (79)
Q Consensus        41 ~~~C~vC~~~f~~~k~l~~H~es   63 (79)
                      -|.|++|...|-|+..|+-|..-
T Consensus       215 PF~C~hC~kAFADRSNLRAHmQT  237 (279)
T KOG2462|consen  215 PFSCPHCGKAFADRSNLRAHMQT  237 (279)
T ss_pred             CccCCcccchhcchHHHHHHHHh
Confidence            38899999999998888888763


No 38 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=58.74  E-value=5.2  Score=25.65  Aligned_cols=25  Identities=24%  Similarity=0.454  Sum_probs=22.8

Q ss_pred             hccc----hhhhhcCCChhhHhHHHHcCC
Q psy11933         41 VHAC----VVCKAQMPDPKTYKQHFENKH   65 (79)
Q Consensus        41 ~~~C----~vC~~~f~~~k~l~~H~esKH   65 (79)
                      -+.|    ..|.-.+.+..++..||..+|
T Consensus        80 G~~C~~~~~~C~y~~~~~~~m~~H~~~~H  108 (109)
T PF12013_consen   80 GYRCQCDPPHCGYITRSKKTMRKHWRKEH  108 (109)
T ss_pred             CeeeecCCCCCCcEeccHHHHHHHHHHhc
Confidence            3789    999998889999999999988


No 39 
>PF07800 DUF1644:  Protein of unknown function (DUF1644);  InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function. The region of interest contains nine highly conserved cysteine residues and is approximately 160 amino acids in length, which probably represent a zinc-binding domain. 
Probab=57.98  E-value=8.6  Score=27.84  Aligned_cols=32  Identities=19%  Similarity=0.498  Sum_probs=25.6

Q ss_pred             hhhhccchhhhhc---------------------------CCC-hhhHhHHHHcCCCCCC
Q psy11933         38 KALVHACVVCKAQ---------------------------MPD-PKTYKQHFENKHPKND   69 (79)
Q Consensus        38 aA~~~~C~vC~~~---------------------------f~~-~k~l~~H~esKHpK~~   69 (79)
                      ......|+.||-.                           |.. +..|.-|...+||-..
T Consensus        77 ~~~~L~CPLCRG~V~GWtvve~AR~~LN~K~RsC~~e~C~F~GtY~eLrKHar~~HP~~r  136 (162)
T PF07800_consen   77 EQPELACPLCRGEVKGWTVVEPARRFLNAKKRSCSQESCSFSGTYSELRKHARSEHPSAR  136 (162)
T ss_pred             ccccccCccccCceeceEEchHHHHHhccCCccCcccccccccCHHHHHHHHHhhCCCCC
Confidence            3456889999876                           444 8999999999999653


No 40 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=57.63  E-value=2.3  Score=21.18  Aligned_cols=13  Identities=15%  Similarity=0.368  Sum_probs=10.6

Q ss_pred             hhccchhhhhcCC
Q psy11933         40 LVHACVVCKAQMP   52 (79)
Q Consensus        40 ~~~~C~vC~~~f~   52 (79)
                      ..|.|++|...|.
T Consensus        13 k~~~C~~C~k~F~   25 (26)
T PF13465_consen   13 KPYKCPYCGKSFS   25 (26)
T ss_dssp             SSEEESSSSEEES
T ss_pred             CCCCCCCCcCeeC
Confidence            3489999998885


No 41 
>KOG0717|consensus
Probab=57.45  E-value=3.7  Score=34.32  Aligned_cols=25  Identities=36%  Similarity=0.626  Sum_probs=23.1

Q ss_pred             ccchhhhhcCCChhhHhHHHHcC-CC
Q psy11933         42 HACVVCKAQMPDPKTYKQHFENK-HP   66 (79)
Q Consensus        42 ~~C~vC~~~f~~~k~l~~H~esK-Hp   66 (79)
                      +-|.||--+|-+.++|+-|-.|| |-
T Consensus       293 lyC~vCnKsFKseKq~kNHEnSKKHk  318 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENSKKHK  318 (508)
T ss_pred             eEEeeccccccchHHHHhhHHHHHHH
Confidence            78999999999999999999998 63


No 42 
>KOG3608|consensus
Probab=57.09  E-value=7.2  Score=32.04  Aligned_cols=27  Identities=19%  Similarity=0.528  Sum_probs=25.5

Q ss_pred             ccchhhhhcCCChhhHhHHHHcCCCCC
Q psy11933         42 HACVVCKAQMPDPKTYKQHFENKHPKN   68 (79)
Q Consensus        42 ~~C~vC~~~f~~~k~l~~H~esKHpK~   68 (79)
                      |+|+.|-.+.+++..|.-|..-+|++.
T Consensus       264 ykCplCdmtc~~~ssL~~H~r~rHs~d  290 (467)
T KOG3608|consen  264 YKCPLCDMTCSSASSLTTHIRYRHSKD  290 (467)
T ss_pred             ccccccccCCCChHHHHHHHHhhhccC
Confidence            899999999999999999999999984


No 43 
>PLN02748 tRNA dimethylallyltransferase
Probab=55.96  E-value=5.4  Score=32.60  Aligned_cols=26  Identities=19%  Similarity=0.484  Sum_probs=23.1

Q ss_pred             hhccchhhhh-cCCChhhHhHHHHcC-C
Q psy11933         40 LVHACVVCKA-QMPDPKTYKQHFENK-H   65 (79)
Q Consensus        40 ~~~~C~vC~~-~f~~~k~l~~H~esK-H   65 (79)
                      ..++|.||.- +|....+-.+|..++ |
T Consensus       417 ~~~~Ce~C~~~~~~G~~eW~~Hlksr~H  444 (468)
T PLN02748        417 TQYVCEACGNKVLRGAHEWEQHKQGRGH  444 (468)
T ss_pred             ccccccCCCCcccCCHHHHHHHhcchHH
Confidence            4578999997 899999999999987 6


No 44 
>KOG1146|consensus
Probab=53.78  E-value=4.7  Score=37.27  Aligned_cols=29  Identities=24%  Similarity=0.440  Sum_probs=26.5

Q ss_pred             hhccchhhhhcCCChhhHhHHHHcCCCCC
Q psy11933         40 LVHACVVCKAQMPDPKTYKQHFENKHPKN   68 (79)
Q Consensus        40 ~~~~C~vC~~~f~~~k~l~~H~esKHpK~   68 (79)
                      ..++|++|...|....+|..|.++|||-.
T Consensus       464 kt~~cpkc~~~yk~a~~L~vhmRskhp~~  492 (1406)
T KOG1146|consen  464 KTLKCPKCNWHYKLAQTLGVHMRSKHPES  492 (1406)
T ss_pred             ccccCCccchhhhhHHHhhhccccccccc
Confidence            56899999999999999999999999853


No 45 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=52.64  E-value=4.1  Score=30.22  Aligned_cols=26  Identities=31%  Similarity=0.658  Sum_probs=21.2

Q ss_pred             hccchhhhhcCCChhhHhHHHHcCCC
Q psy11933         41 VHACVVCKAQMPDPKTYKQHFENKHP   66 (79)
Q Consensus        41 ~~~C~vC~~~f~~~k~l~~H~esKHp   66 (79)
                      ++-|++|..-|-.+.=..-|..+||+
T Consensus        77 K~~C~lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   77 KWRCPLCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             EEEE-SSS-EESSHHHHHHHHHHH-H
T ss_pred             EECCCCCCcccCChHHHHHHHhhcCH
Confidence            57899999999999999999999998


No 46 
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=52.05  E-value=16  Score=20.53  Aligned_cols=12  Identities=25%  Similarity=0.456  Sum_probs=6.1

Q ss_pred             ccchhhhhcCCC
Q psy11933         42 HACVVCKAQMPD   53 (79)
Q Consensus        42 ~~C~vC~~~f~~   53 (79)
                      +.|+||+..|-+
T Consensus         2 ~~Cpi~~~~~~~   13 (63)
T smart00504        2 FLCPISLEVMKD   13 (63)
T ss_pred             cCCcCCCCcCCC
Confidence            345555555443


No 47 
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=50.72  E-value=5.5  Score=28.27  Aligned_cols=15  Identities=33%  Similarity=0.720  Sum_probs=12.1

Q ss_pred             hhccchhhhhcCCCh
Q psy11933         40 LVHACVVCKAQMPDP   54 (79)
Q Consensus        40 ~~~~C~vC~~~f~~~   54 (79)
                      +--+||||+++|-+.
T Consensus       120 ~ypvCPvCkTSFKss  134 (140)
T PF05290_consen  120 LYPVCPVCKTSFKSS  134 (140)
T ss_pred             cCCCCCccccccccc
Confidence            445899999999874


No 48 
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=49.79  E-value=4.9  Score=24.31  Aligned_cols=14  Identities=14%  Similarity=0.451  Sum_probs=7.3

Q ss_pred             hhccchhhhhcCCC
Q psy11933         40 LVHACVVCKAQMPD   53 (79)
Q Consensus        40 ~~~~C~vC~~~f~~   53 (79)
                      +++.|++|+..+.-
T Consensus         1 m~v~CP~C~k~~~~   14 (57)
T PF03884_consen    1 MTVKCPICGKPVEW   14 (57)
T ss_dssp             -EEE-TTT--EEE-
T ss_pred             CcccCCCCCCeecc
Confidence            46889999987654


No 49 
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=49.65  E-value=5.5  Score=29.38  Aligned_cols=28  Identities=21%  Similarity=0.608  Sum_probs=0.0

Q ss_pred             hhhccchhhh-hcCCChhhHhHHHH-cCCC
Q psy11933         39 ALVHACVVCK-AQMPDPKTYKQHFE-NKHP   66 (79)
Q Consensus        39 A~~~~C~vC~-~~f~~~k~l~~H~e-sKHp   66 (79)
                      ...|.|.||. +++..++.+..||. .+|.
T Consensus        99 ~~ey~CEICGN~~Y~GrkaFekHF~E~rH~  128 (196)
T PF11931_consen   99 GVEYKCEICGNQSYKGRKAFEKHFQEWRHA  128 (196)
T ss_dssp             ------------------------------
T ss_pred             CCeeeeEeCCCcceecHHHHHHhcChhHHH
Confidence            3458999998 45667999999995 3463


No 50 
>KOG3408|consensus
Probab=47.80  E-value=9.8  Score=26.65  Aligned_cols=24  Identities=38%  Similarity=0.751  Sum_probs=22.7

Q ss_pred             ccchhhhhcCCChhhHhHHHHcC-C
Q psy11933         42 HACVVCKAQMPDPKTYKQHFENK-H   65 (79)
Q Consensus        42 ~~C~vC~~~f~~~k~l~~H~esK-H   65 (79)
                      |-|-.|---|.+.+.|..||.+| |
T Consensus        58 fyCi~CaRyFi~~~~l~~H~ktK~H   82 (129)
T KOG3408|consen   58 FYCIECARYFIDAKALKTHFKTKVH   82 (129)
T ss_pred             eehhhhhhhhcchHHHHHHHhccHH
Confidence            78999999999999999999998 5


No 51 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=47.08  E-value=5.3  Score=21.59  Aligned_cols=14  Identities=14%  Similarity=0.589  Sum_probs=11.0

Q ss_pred             hhccchhhhhcCCC
Q psy11933         40 LVHACVVCKAQMPD   53 (79)
Q Consensus        40 ~~~~C~vC~~~f~~   53 (79)
                      +.|.|+-|.+.|-.
T Consensus         1 M~i~CP~C~~~f~v   14 (37)
T PF13719_consen    1 MIITCPNCQTRFRV   14 (37)
T ss_pred             CEEECCCCCceEEc
Confidence            45788888888876


No 52 
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=46.42  E-value=8.2  Score=23.28  Aligned_cols=21  Identities=19%  Similarity=0.548  Sum_probs=16.0

Q ss_pred             ccchhhhhcCCChhhHhHHHH
Q psy11933         42 HACVVCKAQMPDPKTYKQHFE   62 (79)
Q Consensus        42 ~~C~vC~~~f~~~k~l~~H~e   62 (79)
                      -||+||.-.|.-.+...+-|+
T Consensus        13 KICpvCqRPFsWRkKW~~cWD   33 (54)
T COG4338          13 KICPVCQRPFSWRKKWARCWD   33 (54)
T ss_pred             hhhhhhcCchHHHHHHHHHHH
Confidence            489999999987666655554


No 53 
>TIGR02652 conserved hypothetical protein TIGR02652, cyanobacterial. Members of this family of conserved hypothetical proteins are found, so far, only in the Cyanobacteria. Members are about 170 amino acids long and share a motif CxxCx(14)CxxH near the amino end.
Probab=44.91  E-value=8.6  Score=27.76  Aligned_cols=13  Identities=23%  Similarity=0.705  Sum_probs=11.3

Q ss_pred             hccchhhhhcCCC
Q psy11933         41 VHACVVCKAQMPD   53 (79)
Q Consensus        41 ~~~C~vC~~~f~~   53 (79)
                      .|.|+.|||+.|-
T Consensus         9 ei~CPhCRQ~ipA   21 (163)
T TIGR02652         9 EIRCPHCRQNIPA   21 (163)
T ss_pred             cCcCchhhcccch
Confidence            4789999999876


No 54 
>PF09654 DUF2396:  Protein of unknown function (DUF2396);  InterPro: IPR013472  These conserved hypothetical proteins have so far been found only in the Cyanobacteria. They are about 170 amino acids long and contain a CxxCx(14)CxxH motif near the N terminus.
Probab=44.86  E-value=8.7  Score=27.70  Aligned_cols=13  Identities=23%  Similarity=0.698  Sum_probs=11.2

Q ss_pred             hccchhhhhcCCC
Q psy11933         41 VHACVVCKAQMPD   53 (79)
Q Consensus        41 ~~~C~vC~~~f~~   53 (79)
                      -|.|+.|||+.|-
T Consensus         6 ei~CPhCRq~ipA   18 (161)
T PF09654_consen    6 EIQCPHCRQTIPA   18 (161)
T ss_pred             cCcCchhhcccch
Confidence            4789999999876


No 55 
>KOG1074|consensus
Probab=44.29  E-value=15  Score=32.89  Aligned_cols=25  Identities=28%  Similarity=0.627  Sum_probs=20.1

Q ss_pred             ccchhhhhcCCChhhHhHHHHcCCCC
Q psy11933         42 HACVVCKAQMPDPKTYKQHFENKHPK   67 (79)
Q Consensus        42 ~~C~vC~~~f~~~k~l~~H~esKHpK   67 (79)
                      ..|.||+.+|.....|+.|.. -|++
T Consensus       880 h~C~vCgk~FsSSsALqiH~r-THtg  904 (958)
T KOG1074|consen  880 HVCNVCGKQFSSSAALEIHMR-THTG  904 (958)
T ss_pred             hhhccchhcccchHHHHHhhh-cCCC
Confidence            679999999999888888877 4544


No 56 
>KOG2462|consensus
Probab=44.23  E-value=7.3  Score=30.35  Aligned_cols=29  Identities=21%  Similarity=0.285  Sum_probs=24.8

Q ss_pred             hhhccchhhhhcCCChhhHhHHHHcCCCC
Q psy11933         39 ALVHACVVCKAQMPDPKTYKQHFENKHPK   67 (79)
Q Consensus        39 A~~~~C~vC~~~f~~~k~l~~H~esKHpK   67 (79)
                      -.+|.|+.|..+|-...-|.-|.|+.=.+
T Consensus       241 ~K~~qC~~C~KsFsl~SyLnKH~ES~C~~  269 (279)
T KOG2462|consen  241 VKKHQCPRCGKSFALKSYLNKHSESACLK  269 (279)
T ss_pred             CccccCcchhhHHHHHHHHHHhhhhcccc
Confidence            34799999999999999999999986444


No 57 
>PF07535 zf-DBF:  DBF zinc finger;  InterPro: IPR006572 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  In eukaryotes, initiation of DNA replication requires the assembly of pre-replication complexes (pre-RCs) on chromatin during the G1 phase. In the S phase, pre-RCs are activated by two protein kinases, Cdk2 and Cdc7, which results in the loading of replication factors and the unwinding of replication origins by the MCM helicase complex []. Cdc7 is a serine/threonine kinase that is conserved from yeast to human. It is regulated by its association with a regulatory subunit, the Dbf4 protein. This complex is often referred to as DDK (Dbf4-dependent kinase) []. DBF4 contains an N-terminal BRCT domain and a C-terminal conserved region that could potentially coordinate one zinc atom, the DBF4-type zinc finger. This entry represents the zinc finger, which is important for the interaction with Cdc7 [, ]. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding
Probab=43.86  E-value=6.6  Score=23.00  Aligned_cols=19  Identities=21%  Similarity=0.676  Sum_probs=15.4

Q ss_pred             cchhhhhcCCChhhHhHHHHcC
Q psy11933         43 ACVVCKAQMPDPKTYKQHFENK   64 (79)
Q Consensus        43 ~C~vC~~~f~~~k~l~~H~esK   64 (79)
                      -|.+|+..|-+   |.+|..|.
T Consensus         7 YCE~C~~ky~~---l~~Hi~s~   25 (49)
T PF07535_consen    7 YCENCRVKYDD---LEEHIQSE   25 (49)
T ss_pred             cCccccchhhh---HHHHhCCH
Confidence            59999999975   77787775


No 58 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=43.26  E-value=6.4  Score=20.77  Aligned_cols=15  Identities=20%  Similarity=0.388  Sum_probs=11.2

Q ss_pred             hhccchhhhhcCCCh
Q psy11933         40 LVHACVVCKAQMPDP   54 (79)
Q Consensus        40 ~~~~C~vC~~~f~~~   54 (79)
                      +.+.|+-|.+.|...
T Consensus         1 M~~~CP~C~~~~~v~   15 (38)
T TIGR02098         1 MRIQCPNCKTSFRVV   15 (38)
T ss_pred             CEEECCCCCCEEEeC
Confidence            457888888887763


No 59 
>PF10146 zf-C4H2:  Zinc finger-containing protein ;  InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a family of proteins which appears to have a highly conserved zinc finger domain at the C-terminal end, described as -C-X2-CH-X3-H-X5-C-X2-C-. The structure is predicted to contain a coiled coil. Members of this family are annotated as being tumour-associated antigen HCA127 in humans, but this could not be confirmed.
Probab=40.47  E-value=12  Score=27.94  Aligned_cols=18  Identities=33%  Similarity=0.752  Sum_probs=11.7

Q ss_pred             ccchhhhhcCCChhhHhHHHHcCCCCCC
Q psy11933         42 HACVVCKAQMPDPKTYKQHFENKHPKND   69 (79)
Q Consensus        42 ~~C~vC~~~f~~~k~l~~H~esKHpK~~   69 (79)
                      -||++|++          =.+|||||.+
T Consensus       209 PiCPlCK~----------KsRSrnpKk~  226 (230)
T PF10146_consen  209 PICPLCKA----------KSRSRNPKKP  226 (230)
T ss_pred             CCCccccc----------ccccCCCCCc
Confidence            36666655          3467888865


No 60 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=40.22  E-value=10  Score=23.56  Aligned_cols=24  Identities=25%  Similarity=0.511  Sum_probs=21.3

Q ss_pred             ccchhhhhcCCChhhHhHHHHcCC
Q psy11933         42 HACVVCKAQMPDPKTYKQHFENKH   65 (79)
Q Consensus        42 ~~C~vC~~~f~~~k~l~~H~esKH   65 (79)
                      +.|+-|..-|-+.+.|..|.---|
T Consensus        18 lrCPRC~~~FR~~K~Y~RHVNKaH   41 (65)
T COG4049          18 LRCPRCGMVFRRRKDYIRHVNKAH   41 (65)
T ss_pred             eeCCchhHHHHHhHHHHHHhhHHh
Confidence            679999999999999999986555


No 61 
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=39.56  E-value=8.9  Score=22.84  Aligned_cols=13  Identities=23%  Similarity=0.455  Sum_probs=8.8

Q ss_pred             hccchhhhhcCCC
Q psy11933         41 VHACVVCKAQMPD   53 (79)
Q Consensus        41 ~~~C~vC~~~f~~   53 (79)
                      .+.|++|.+.+--
T Consensus         2 ~~~CP~CG~~iev   14 (54)
T TIGR01206         2 QFECPDCGAEIEL   14 (54)
T ss_pred             ccCCCCCCCEEec
Confidence            4678888876643


No 62 
>COG5539 Predicted cysteine protease (OTU family) [Posttranslational modification, protein turnover, chaperones]
Probab=38.79  E-value=11  Score=29.70  Aligned_cols=28  Identities=18%  Similarity=0.311  Sum_probs=23.8

Q ss_pred             HhhhhccchhhhhcCCChhhHhHHHHcC
Q psy11933         37 QKALVHACVVCKAQMPDPKTYKQHFENK   64 (79)
Q Consensus        37 ~aA~~~~C~vC~~~f~~~k~l~~H~esK   64 (79)
                      -+...++|.+|...|-....+..|..+-
T Consensus       271 T~~~~ik~n~c~~~~~~e~~~~~Ha~a~  298 (306)
T COG5539         271 TASPSIKCNICGTGFVGEKDYYAHALAT  298 (306)
T ss_pred             cCCceEEeeccccccchhhHHHHHHHhh
Confidence            3456789999999999999999998764


No 63 
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=38.60  E-value=10  Score=27.33  Aligned_cols=23  Identities=13%  Similarity=0.374  Sum_probs=0.0

Q ss_pred             hhhccchhhhhcCCChhhHhHHHH
Q psy11933         39 ALVHACVVCKAQMPDPKTYKQHFE   62 (79)
Q Consensus        39 A~~~~C~vC~~~f~~~k~l~~H~e   62 (79)
                      ..-++|+||++..|.. .|.+|.+
T Consensus       166 ~~~~~cPitGe~IP~~-e~~eHmR  188 (229)
T PF12230_consen  166 EKMIICPITGEMIPAD-EMDEHMR  188 (229)
T ss_dssp             ------------------------
T ss_pred             cccccccccccccccc-ccccccc
Confidence            3448899999999873 3555544


No 64 
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=36.50  E-value=12  Score=29.06  Aligned_cols=14  Identities=21%  Similarity=0.627  Sum_probs=11.7

Q ss_pred             hccchhhhhcCCCh
Q psy11933         41 VHACVVCKAQMPDP   54 (79)
Q Consensus        41 ~~~C~vC~~~f~~~   54 (79)
                      .|.||||.+.|-.+
T Consensus        19 ~ieCPvC~tkFkke   32 (267)
T COG1655          19 TIECPVCNTKFKKE   32 (267)
T ss_pred             eeccCcccchhhhh
Confidence            48899999999763


No 65 
>PTZ00417 lysine-tRNA ligase; Provisional
Probab=36.41  E-value=15  Score=30.92  Aligned_cols=24  Identities=29%  Similarity=0.378  Sum_probs=18.6

Q ss_pred             hhhhccchh-hhhcCCChhhHhHHH
Q psy11933         38 KALVHACVV-CKAQMPDPKTYKQHF   61 (79)
Q Consensus        38 aA~~~~C~v-C~~~f~~~k~l~~H~   61 (79)
                      +..||+|+| |++-|...+.-++|.
T Consensus        32 ~~~~~~~~~~~~~~~~~~~~~~~~~   56 (585)
T PTZ00417         32 KNKNIICPVHCKQCFVTMSEKKEHV   56 (585)
T ss_pred             CCCceecccchhhheeehhhhhHHH
Confidence            456799997 888888866667775


No 66 
>KOG3623|consensus
Probab=36.35  E-value=19  Score=32.19  Aligned_cols=30  Identities=17%  Similarity=0.263  Sum_probs=24.7

Q ss_pred             HhhhhccchhhhhcCCChhhHhHHHHcCCCC
Q psy11933         37 QKALVHACVVCKAQMPDPKTYKQHFENKHPK   67 (79)
Q Consensus        37 ~aA~~~~C~vC~~~f~~~k~l~~H~esKHpK   67 (79)
                      +.--+|+|+.|...|--...|++|.+. |+.
T Consensus       277 a~lRKFKCtECgKAFKfKHHLKEHlRI-HSG  306 (1007)
T KOG3623|consen  277 ALLRKFKCTECGKAFKFKHHLKEHLRI-HSG  306 (1007)
T ss_pred             hhhccccccccchhhhhHHHHHhhhee-ecC
Confidence            334459999999999999999999986 543


No 67 
>COG5246 PRP11 Splicing factor 3a, subunit 2 [RNA processing and modification]
Probab=35.99  E-value=16  Score=27.49  Aligned_cols=24  Identities=29%  Similarity=0.580  Sum_probs=22.4

Q ss_pred             hccchhhhhcCCChhhHhHHHHcC
Q psy11933         41 VHACVVCKAQMPDPKTYKQHFENK   64 (79)
Q Consensus        41 ~~~C~vC~~~f~~~k~l~~H~esK   64 (79)
                      ++.|..|.++-+...++.-|-+-|
T Consensus        53 k~vC~LC~T~H~~e~Sy~~H~~GK   76 (222)
T COG5246          53 KYVCLLCKTKHLTEMSYVKHREGK   76 (222)
T ss_pred             cEEeeeeccccccHHHHHHhhccc
Confidence            589999999999999999999987


No 68 
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional
Probab=35.48  E-value=12  Score=27.11  Aligned_cols=13  Identities=15%  Similarity=0.480  Sum_probs=10.6

Q ss_pred             hccchhhhhcCCC
Q psy11933         41 VHACVVCKAQMPD   53 (79)
Q Consensus        41 ~~~C~vC~~~f~~   53 (79)
                      .+.||||++.+..
T Consensus         2 ~~~CP~C~~~l~~   14 (272)
T PRK11088          2 SYQCPLCHQPLTL   14 (272)
T ss_pred             cccCCCCCcchhc
Confidence            4789999998853


No 69 
>KOG3576|consensus
Probab=35.07  E-value=20  Score=27.56  Aligned_cols=32  Identities=25%  Similarity=0.435  Sum_probs=28.0

Q ss_pred             hhhccchhhhhcCCChhhHhHHHHcCCCCCCC
Q psy11933         39 ALVHACVVCKAQMPDPKTYKQHFENKHPKNDL   70 (79)
Q Consensus        39 A~~~~C~vC~~~f~~~k~l~~H~esKHpK~~~   70 (79)
                      +.-|+|.-|.-+-..+..|..|..+-||-.++
T Consensus       210 ~kl~vcedcg~t~~~~e~~~~h~~~~hp~Spa  241 (267)
T KOG3576|consen  210 AKLYVCEDCGYTSERPEVYYLHLKLHHPFSPA  241 (267)
T ss_pred             hheeeecccCCCCCChhHHHHHHHhcCCCCHH
Confidence            56699999999999999999999999996553


No 70 
>PF03194 LUC7:  LUC7 N_terminus;  InterPro: IPR004882 This family consists of several LUC7 protein homologues that are restricted to eukaryotes. LUC7 has been shown to be a U1 snRNA associated protein [] with a role in splice site recognition []. The entry contains human and mouse LUC7 like (LUC7L) proteins [] and human cisplatin resistance-associated overexpressed protein (CROP) []. 
Probab=33.23  E-value=21  Score=26.82  Aligned_cols=23  Identities=30%  Similarity=0.611  Sum_probs=18.4

Q ss_pred             ccchhhhhcCCC---hhhHhHHHHcC
Q psy11933         42 HACVVCKAQMPD---PKTYKQHFENK   64 (79)
Q Consensus        42 ~~C~vC~~~f~~---~k~l~~H~esK   64 (79)
                      .+|.||++-...   ..=|..||.-|
T Consensus       191 ~VCeVCGA~Ls~~D~d~RladH~~GK  216 (254)
T PF03194_consen  191 EVCEVCGAFLSVGDNDRRLADHFGGK  216 (254)
T ss_pred             cchhhhhhHHhccchHHHHHHHhccc
Confidence            689999976655   56689999877


No 71 
>PF06348 DUF1059:  Protein of unknown function (DUF1059);  InterPro: IPR009409 This entry consists of short hypothetical archaeal and bacterial proteins of unknown function.
Probab=33.18  E-value=35  Score=20.05  Aligned_cols=24  Identities=21%  Similarity=0.450  Sum_probs=20.9

Q ss_pred             hhhHhHHHHcCCCCCCCCchhhhh
Q psy11933         54 PKTYKQHFENKHPKNDLPEDLKDV   77 (79)
Q Consensus        54 ~k~l~~H~esKHpK~~~p~e~~~~   77 (79)
                      ...+.+|...-|.-..+|+++.+-
T Consensus        26 l~~~~~Ha~~~Hg~~~~~~el~~~   49 (57)
T PF06348_consen   26 LEAVVEHAREVHGMTEIPEELREK   49 (57)
T ss_pred             HHHHHHHHHHhcCCccCCHHHHHH
Confidence            678999999999999899998763


No 72 
>KOG2893|consensus
Probab=33.18  E-value=20  Score=28.24  Aligned_cols=29  Identities=31%  Similarity=0.370  Sum_probs=25.2

Q ss_pred             hhhccchhhhhcCCChhhHhHHHHcCCCC
Q psy11933         39 ALVHACVVCKAQMPDPKTYKQHFENKHPK   67 (79)
Q Consensus        39 A~~~~C~vC~~~f~~~k~l~~H~esKHpK   67 (79)
                      -++--|=.|-.-|-|++.|.||..+||=|
T Consensus         8 ~~kpwcwycnrefddekiliqhqkakhfk   36 (341)
T KOG2893|consen    8 VDKPWCWYCNREFDDEKILIQHQKAKHFK   36 (341)
T ss_pred             cCCceeeecccccchhhhhhhhhhhccce
Confidence            34467999999999999999999999954


No 73 
>KOG1280|consensus
Probab=32.98  E-value=29  Score=28.22  Aligned_cols=30  Identities=17%  Similarity=0.387  Sum_probs=27.0

Q ss_pred             hhccchhhhhcCCChhhHhHHHHcCCCCCC
Q psy11933         40 LVHACVVCKAQMPDPKTYKQHFENKHPKND   69 (79)
Q Consensus        40 ~~~~C~vC~~~f~~~k~l~~H~esKHpK~~   69 (79)
                      ..|.|+.|..+=....+|..|..+-||-..
T Consensus        78 qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~  107 (381)
T KOG1280|consen   78 QSFTCPYCGIMGFTERQFGTHVLSQHPEAS  107 (381)
T ss_pred             ccccCCcccccccchhHHHHHhhhcCcccC
Confidence            379999999998889999999999999776


No 74 
>PF05741 zf-nanos:  Nanos RNA binding domain;  InterPro: IPR024161 Nanos is a highly conserved RNA-binding protein in higher eukaryotes and functions as a key regulatory protein in translational control using a 3' untranslated region during the development and maintenance of germ cells. Nanos comprises a non-conserved amino-terminus and highly conserved carboxy- terminal regions. The C-terminal region has two conserved Cys-Cys-His-Cys (CCHC)-type zinc-finger motifs that are indispensable for nanos function [, , ]. The structure of the nanos-type zinc finger is composed of two independent zinc-finger (ZF) lobes, the N-terminal ZF1 and the C-terminal ZF2, which are connected by a linker helix []. These lobes create a large cleft. Zinc ions in ZF1 and ZF2 are bound to the CCHC motif by tetrahedral coordination.; PDB: 3ALR_B.
Probab=32.30  E-value=17  Score=21.81  Aligned_cols=11  Identities=27%  Similarity=0.555  Sum_probs=3.6

Q ss_pred             hccchhhhhcC
Q psy11933         41 VHACVVCKAQM   51 (79)
Q Consensus        41 ~~~C~vC~~~f   51 (79)
                      .++|++|.++=
T Consensus        33 ~y~Cp~CgAtG   43 (55)
T PF05741_consen   33 KYVCPICGATG   43 (55)
T ss_dssp             G---TTT---G
T ss_pred             cCcCCCCcCcC
Confidence            48899998873


No 75 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=31.80  E-value=13  Score=20.06  Aligned_cols=14  Identities=21%  Similarity=0.577  Sum_probs=9.9

Q ss_pred             hhccchhhhhcCCC
Q psy11933         40 LVHACVVCKAQMPD   53 (79)
Q Consensus        40 ~~~~C~vC~~~f~~   53 (79)
                      +.|.|+-|.+.|-.
T Consensus         1 M~i~Cp~C~~~y~i   14 (36)
T PF13717_consen    1 MIITCPNCQAKYEI   14 (36)
T ss_pred             CEEECCCCCCEEeC
Confidence            35778888777765


No 76 
>KOG2505|consensus
Probab=30.81  E-value=27  Score=29.76  Aligned_cols=23  Identities=13%  Similarity=0.582  Sum_probs=20.7

Q ss_pred             ccchhhhhcCCChhhHhHHHHcC
Q psy11933         42 HACVVCKAQMPDPKTYKQHFENK   64 (79)
Q Consensus        42 ~~C~vC~~~f~~~k~l~~H~esK   64 (79)
                      ..|++|..+|.+.-..+.||.+-
T Consensus        67 ~~CstCq~~F~s~~eqr~HyksD   89 (591)
T KOG2505|consen   67 DQCSTCQIPFGSRQEQREHYKSD   89 (591)
T ss_pred             ccccccCCccccHHHHHHHHHHH
Confidence            57999999999999999999874


No 77 
>PF15227 zf-C3HC4_4:  zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A.
Probab=30.80  E-value=14  Score=20.26  Aligned_cols=14  Identities=29%  Similarity=0.795  Sum_probs=9.3

Q ss_pred             chhhhhcCCChhhH
Q psy11933         44 CVVCKAQMPDPKTY   57 (79)
Q Consensus        44 C~vC~~~f~~~k~l   57 (79)
                      |+||..-|-++.+|
T Consensus         1 CpiC~~~~~~Pv~l   14 (42)
T PF15227_consen    1 CPICLDLFKDPVSL   14 (42)
T ss_dssp             ETTTTSB-SSEEE-
T ss_pred             CCccchhhCCcccc
Confidence            88999888885443


No 78 
>KOG2636|consensus
Probab=30.55  E-value=25  Score=29.41  Aligned_cols=23  Identities=22%  Similarity=0.595  Sum_probs=20.4

Q ss_pred             hhccchhhh-hcCCChhhHhHHHH
Q psy11933         40 LVHACVVCK-AQMPDPKTYKQHFE   62 (79)
Q Consensus        40 ~~~~C~vC~-~~f~~~k~l~~H~e   62 (79)
                      ..|.|.||. .+...++++.-||.
T Consensus       400 ~ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  400 IEYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             cccceeeccCccccCcHHHHHHhH
Confidence            348899999 89999999999995


No 79 
>PF04564 U-box:  U-box domain;  InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis. Molecular chaperones recognise and contribute to the refolding of misfolded or unfolded proteins, whereas the ubiquitin-proteasome system mediates the degradation of such abnormal proteins. Ubiquitin-protein ligases (E3s) determine the substrate specificity for ubiquitylation and have been classified into HECT and RING-finger families. More recently, however, U-box proteins, which contain a domain (the U box) of about 70 amino acids that is conserved from yeast to humans, have been identified as a new type of E3 []. Members of the U-box family of proteins constitute a class of ubiquitin-protein ligases (E3s) distinct from the HECT-type and RING finger-containing E3 families []. Using yeast two-hybrid technology, all mammalian U-box proteins have been reported to interact with molecular chaperones or co-chaperones, including Hsp90, Hsp70, DnaJc7, EKN1, CRN, and VCP. This suggests that the function of U box-type E3s is to mediate the degradation of unfolded or misfolded proteins in conjunction with molecular chaperones as receptors that recognise such abnormal proteins [, ]. Unlike the RING finger domain, IPR001841 from INTERPRO, that is stabilised by Zn2+ ions coordinated by the cysteines and a histidine, the U-box scaffold is probably stabilised by a system of salt-bridges and hydrogen bonds. The charged and polar residues that participate in this network of bonds are more strongly conserved in the U-box proteins than in classic RING fingers, which supports their role in maintaining the stability of the U box. Thus, the U box appears to have evolved from a RING finger domain by appropriation of a new set of residues required to stabilise its structure, concomitant with the loss of the original, metal-chelating residues [].; GO: 0004842 ubiquitin-protein ligase activity, 0016567 protein ubiquitination, 0000151 ubiquitin ligase complex; PDB: 1T1H_A 2C2L_D 2C2V_V 1WGM_A 2KR4_A 3L1Z_B 3L1X_A 2KRE_A 3M63_A 2QIZ_A ....
Probab=28.50  E-value=47  Score=19.87  Aligned_cols=29  Identities=14%  Similarity=0.290  Sum_probs=15.8

Q ss_pred             ccchhhhhcCCC-----------hhhHhHHHHcCCCCCCC
Q psy11933         42 HACVVCKAQMPD-----------PKTYKQHFENKHPKNDL   70 (79)
Q Consensus        42 ~~C~vC~~~f~~-----------~k~l~~H~esKHpK~~~   70 (79)
                      |.|+||+.-|-+           ...+..+++..++..|+
T Consensus         5 f~CpIt~~lM~dPVi~~~G~tyer~~I~~~l~~~~~~~P~   44 (73)
T PF04564_consen    5 FLCPITGELMRDPVILPSGHTYERSAIERWLEQNGGTDPF   44 (73)
T ss_dssp             GB-TTTSSB-SSEEEETTSEEEEHHHHHHHHCTTSSB-TT
T ss_pred             cCCcCcCcHhhCceeCCcCCEEcHHHHHHHHHcCCCCCCC
Confidence            678888887777           44555555553544444


No 80 
>smart00586 ZnF_DBF Zinc finger in DBF-like proteins.
Probab=28.47  E-value=18  Score=21.22  Aligned_cols=19  Identities=21%  Similarity=0.583  Sum_probs=14.7

Q ss_pred             cchhhhhcCCChhhHhHHHHcC
Q psy11933         43 ACVVCKAQMPDPKTYKQHFENK   64 (79)
Q Consensus        43 ~C~vC~~~f~~~k~l~~H~esK   64 (79)
                      -|.+|+.-|-+   |.+|..++
T Consensus         7 YCE~Cr~kfd~---l~~Hi~s~   25 (49)
T smart00586        7 YCENCREKYDD---LETHLLSE   25 (49)
T ss_pred             ccccHhHHHhh---HHHHhccH
Confidence            59999999864   66677665


No 81 
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=27.23  E-value=28  Score=28.73  Aligned_cols=34  Identities=29%  Similarity=0.466  Sum_probs=29.0

Q ss_pred             HHHhhhhccchhhhhcCCChhhHhHHHHcC-CCCC
Q psy11933         35 AAQKALVHACVVCKAQMPDPKTYKQHFENK-HPKN   68 (79)
Q Consensus        35 a~~aA~~~~C~vC~~~f~~~k~l~~H~esK-HpK~   68 (79)
                      .+.-+..|-|++|..-|-..+.++-|.++| |.|.
T Consensus       232 g~~~~~~~YC~~C~r~f~~~~VFe~Hl~gK~H~k~  266 (470)
T COG5188         232 GAEWFPKVYCVKCGREFSRSKVFEYHLEGKRHCKE  266 (470)
T ss_pred             hhhhccceeeHhhhhHhhhhHHHHHHHhhhhhhhh
Confidence            345566799999999999999999999999 8765


No 82 
>KOG0227|consensus
Probab=27.22  E-value=32  Score=26.02  Aligned_cols=25  Identities=24%  Similarity=0.489  Sum_probs=22.2

Q ss_pred             hccchhhhhcCCChhhHhHHHHcC-C
Q psy11933         41 VHACVVCKAQMPDPKTYKQHFENK-H   65 (79)
Q Consensus        41 ~~~C~vC~~~f~~~k~l~~H~esK-H   65 (79)
                      ++.|..|.+.-++..+|.-|-+-| |
T Consensus        53 ~yeCkLClT~H~ne~Syl~HtqGKKH   78 (222)
T KOG0227|consen   53 KYECKLCLTLHNNEGSYLAHTQGKKH   78 (222)
T ss_pred             ceeehhhhhhhcchhhhhhhhccchh
Confidence            489999999999999999998876 5


No 83 
>KOG1493|consensus
Probab=26.37  E-value=24  Score=23.11  Aligned_cols=11  Identities=18%  Similarity=0.682  Sum_probs=9.4

Q ss_pred             ccchhhhhcCC
Q psy11933         42 HACVVCKAQMP   52 (79)
Q Consensus        42 ~~C~vC~~~f~   52 (79)
                      -.|+.|||+|.
T Consensus        71 ~~CPmcRq~~~   81 (84)
T KOG1493|consen   71 GQCPMCRQTWQ   81 (84)
T ss_pred             ccCCcchheeE
Confidence            47999999985


No 84 
>PF04328 DUF466:  Protein of unknown function (DUF466);  InterPro: IPR007423 This is a small bacterial protein of unknown function.
Probab=26.11  E-value=42  Score=20.43  Aligned_cols=23  Identities=26%  Similarity=0.543  Sum_probs=18.5

Q ss_pred             CCChhhHhHHHHcCCCCCCCCch
Q psy11933         51 MPDPKTYKQHFENKHPKNDLPED   73 (79)
Q Consensus        51 f~~~k~l~~H~esKHpK~~~p~e   73 (79)
                      -+++-.|-+|....||-.|...+
T Consensus        22 ~~~Ye~Yv~H~~~~HP~~p~ms~   44 (65)
T PF04328_consen   22 EPDYERYVEHMRRHHPDEPPMSE   44 (65)
T ss_pred             cHHHHHHHHHHHHHCcCCCCCCH
Confidence            34578899999999998887654


No 85 
>PRK00420 hypothetical protein; Validated
Probab=25.95  E-value=44  Score=22.60  Aligned_cols=21  Identities=24%  Similarity=0.395  Sum_probs=15.4

Q ss_pred             HHHHHhhhhccchhhhhcCCC
Q psy11933         33 KKAAQKALVHACVVCKAQMPD   53 (79)
Q Consensus        33 ~ka~~aA~~~~C~vC~~~f~~   53 (79)
                      |-..+.-+...||+|...|..
T Consensus        15 Ll~Ga~ml~~~CP~Cg~pLf~   35 (112)
T PRK00420         15 LLKGAKMLSKHCPVCGLPLFE   35 (112)
T ss_pred             HHhHHHHccCCCCCCCCccee
Confidence            333556688899999988764


No 86 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=25.62  E-value=25  Score=23.43  Aligned_cols=13  Identities=23%  Similarity=0.682  Sum_probs=10.9

Q ss_pred             ccchhhhhcCCCh
Q psy11933         42 HACVVCKAQMPDP   54 (79)
Q Consensus        42 ~~C~vC~~~f~~~   54 (79)
                      |+|+-|.+.|+-.
T Consensus        27 ivCP~CG~~~~~~   39 (108)
T PF09538_consen   27 IVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCCCccCcc
Confidence            7899999998875


No 87 
>PF13445 zf-RING_UBOX:  RING-type zinc-finger; PDB: 2CT2_A.
Probab=25.28  E-value=19  Score=20.19  Aligned_cols=9  Identities=33%  Similarity=1.091  Sum_probs=3.3

Q ss_pred             chhhhhcCCC
Q psy11933         44 CVVCKAQMPD   53 (79)
Q Consensus        44 C~vC~~~f~~   53 (79)
                      |+||+. |.+
T Consensus         1 CpIc~e-~~~    9 (43)
T PF13445_consen    1 CPICKE-FST    9 (43)
T ss_dssp             -TTT-----T
T ss_pred             CCcccc-ccC
Confidence            889998 755


No 88 
>KOG4696|consensus
Probab=24.98  E-value=39  Score=27.30  Aligned_cols=21  Identities=24%  Similarity=0.339  Sum_probs=14.9

Q ss_pred             hccchhhhhcCCChhhHhHHHH
Q psy11933         41 VHACVVCKAQMPDPKTYKQHFE   62 (79)
Q Consensus        41 ~~~C~vC~~~f~~~k~l~~H~e   62 (79)
                      .++||+|+-+ .....+.-|.+
T Consensus         2 e~iCP~CkLs-v~~~~m~~Hie   22 (393)
T KOG4696|consen    2 EIICPFCKLS-VNYDEMCFHIE   22 (393)
T ss_pred             cccccceecc-cCHHHHHHHHH
Confidence            4799999999 45555555555


No 89 
>KOG0717|consensus
Probab=24.95  E-value=40  Score=28.38  Aligned_cols=26  Identities=15%  Similarity=0.506  Sum_probs=22.1

Q ss_pred             hhccchhhhhcCCChhhHhHHHHcC-C
Q psy11933         40 LVHACVVCKAQMPDPKTYKQHFENK-H   65 (79)
Q Consensus        40 ~~~~C~vC~~~f~~~k~l~~H~esK-H   65 (79)
                      ..++|..|+..|+++.-|-.|...- |
T Consensus       459 a~~~C~tCr~~FdSRnkLF~Hlk~tgH  485 (508)
T KOG0717|consen  459 ALISCTTCRESFDSRNKLFAHLKKTGH  485 (508)
T ss_pred             hhHhhhhhhhhccchhHHHHHhhhcCC
Confidence            3589999999999999999998754 5


No 90 
>PF14357 DUF4404:  Domain of unknown function (DUF4404)
Probab=24.85  E-value=41  Score=21.27  Aligned_cols=16  Identities=31%  Similarity=0.432  Sum_probs=12.6

Q ss_pred             hhhHhHHHHcCCCCCC
Q psy11933         54 PKTYKQHFENKHPKND   69 (79)
Q Consensus        54 ~k~l~~H~esKHpK~~   69 (79)
                      ...+..|||..||+..
T Consensus        55 l~~av~~FE~~HP~l~   70 (85)
T PF14357_consen   55 LNEAVERFEASHPKLA   70 (85)
T ss_pred             HHHHHHHHHHhCCcHH
Confidence            4557899999999753


No 91 
>PLN00104 MYST -like histone acetyltransferase; Provisional
Probab=24.64  E-value=52  Score=27.21  Aligned_cols=23  Identities=17%  Similarity=0.394  Sum_probs=20.9

Q ss_pred             hhccchhhhhcCCChhhHhHHHH
Q psy11933         40 LVHACVVCKAQMPDPKTYKQHFE   62 (79)
Q Consensus        40 ~~~~C~vC~~~f~~~k~l~~H~e   62 (79)
                      .-|+|.-|..-|....+|..|..
T Consensus       197 ~lyiCe~Cl~y~~~~~~~~~H~~  219 (450)
T PLN00104        197 KLYFCEFCLKFMKRKEQLQRHMK  219 (450)
T ss_pred             eEEEchhhhhhhcCHHHHHHHHh
Confidence            35899999999999999999986


No 92 
>PF13462 Thioredoxin_4:  Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DVW_A 3A3T_E 3GMF_A 1Z6M_A 3GYK_C 3BCK_A 3BD2_A 3BCI_A ....
Probab=24.60  E-value=21  Score=22.94  Aligned_cols=22  Identities=9%  Similarity=0.298  Sum_probs=16.9

Q ss_pred             hhccchhhhhcCCChhhHhHHH
Q psy11933         40 LVHACVVCKAQMPDPKTYKQHF   61 (79)
Q Consensus        40 ~~~~C~vC~~~f~~~k~l~~H~   61 (79)
                      ..+.|+.|+..+.....+..++
T Consensus        20 ~d~~Cp~C~~~~~~~~~~~~~~   41 (162)
T PF13462_consen   20 FDFQCPHCAKFHEELEKLLKKY   41 (162)
T ss_dssp             E-TTSHHHHHHHHHHHHHHHHH
T ss_pred             ECCCCHhHHHHHHHHhhhhhhc
Confidence            3578999999888866777776


No 93 
>PF10886 DUF2685:  Protein of unknown function (DUF2685);  InterPro: IPR024362 This is a family of uncharacterised bacteriophage proteins. Their function in unknown.
Probab=23.97  E-value=26  Score=21.15  Aligned_cols=22  Identities=41%  Similarity=0.739  Sum_probs=15.7

Q ss_pred             cchhhhhcCCC------------hhhHhHHHHcC
Q psy11933         43 ACVVCKAQMPD------------PKTYKQHFENK   64 (79)
Q Consensus        43 ~C~vC~~~f~~------------~k~l~~H~esK   64 (79)
                      +|-||++....            +-.-.+|.+.+
T Consensus         3 ~CvVCKqpi~~a~~v~T~~G~VH~g~C~~y~~e~   36 (54)
T PF10886_consen    3 ICVVCKQPIDDALVVETESGPVHPGVCAQYLEEL   36 (54)
T ss_pred             eeeeeCCccCcceEEEcCCCccCcHHHHHHHHhc
Confidence            79999998776            34455666655


No 94 
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=23.51  E-value=27  Score=18.93  Aligned_cols=10  Identities=20%  Similarity=0.703  Sum_probs=7.7

Q ss_pred             hhccchhhhh
Q psy11933         40 LVHACVVCKA   49 (79)
Q Consensus        40 ~~~~C~vC~~   49 (79)
                      ..+.|+||++
T Consensus        35 ~~~~CP~C~k   44 (44)
T PF14634_consen   35 KSVKCPICRK   44 (44)
T ss_pred             CCCCCcCCCC
Confidence            3578999974


No 95 
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=23.28  E-value=49  Score=18.84  Aligned_cols=18  Identities=17%  Similarity=0.423  Sum_probs=7.8

Q ss_pred             HHHHHHhhhhccchhhhh
Q psy11933         32 QKKAAQKALVHACVVCKA   49 (79)
Q Consensus        32 q~ka~~aA~~~~C~vC~~   49 (79)
                      =+..+...-...|+||.+
T Consensus        32 fl~~~~~~~~W~CPiC~~   49 (50)
T PF02891_consen   32 FLESNQRTPKWKCPICNK   49 (50)
T ss_dssp             HHHHHHHS---B-TTT--
T ss_pred             HHHHhhccCCeECcCCcC
Confidence            344455555589999975


No 96 
>PRK01343 zinc-binding protein; Provisional
Probab=23.28  E-value=29  Score=21.06  Aligned_cols=14  Identities=14%  Similarity=0.349  Sum_probs=11.0

Q ss_pred             hhccchhhhhcCCC
Q psy11933         40 LVHACVVCKAQMPD   53 (79)
Q Consensus        40 ~~~~C~vC~~~f~~   53 (79)
                      ....|+||+..|..
T Consensus         8 p~~~CP~C~k~~~~   21 (57)
T PRK01343          8 PTRPCPECGKPSTR   21 (57)
T ss_pred             CCCcCCCCCCcCcC
Confidence            34789999998763


No 97 
>KOG3623|consensus
Probab=23.04  E-value=48  Score=29.77  Aligned_cols=30  Identities=17%  Similarity=0.455  Sum_probs=24.9

Q ss_pred             hhccchhhhhcCCChhhHhHHHHcCCCCCC
Q psy11933         40 LVHACVVCKAQMPDPKTYKQHFENKHPKND   69 (79)
Q Consensus        40 ~~~~C~vC~~~f~~~k~l~~H~esKHpK~~   69 (79)
                      -+|-|..|-.+|..+.+|++|....-|-.+
T Consensus       239 ~nfsC~lCsytFAyRtQLErhm~~hkpg~d  268 (1007)
T KOG3623|consen  239 PNFSCMLCSYTFAYRTQLERHMQLHKPGGD  268 (1007)
T ss_pred             CCCcchhhhhhhhhHHHHHHHHHhhcCCCc
Confidence            357799999999999999999997666543


No 98 
>PF14353 CpXC:  CpXC protein
Probab=23.02  E-value=13  Score=24.38  Aligned_cols=26  Identities=15%  Similarity=0.225  Sum_probs=17.9

Q ss_pred             hhccchhhhhcCCChhhHhHHHHcCC
Q psy11933         40 LVHACVVCKAQMPDPKTYKQHFENKH   65 (79)
Q Consensus        40 ~~~~C~vC~~~f~~~k~l~~H~esKH   65 (79)
                      +.++|+-|+..|.-.-.+.-|...++
T Consensus        37 ~~~~CP~Cg~~~~~~~p~lY~D~~~~   62 (128)
T PF14353_consen   37 FSFTCPSCGHKFRLEYPLLYHDPEKK   62 (128)
T ss_pred             CEEECCCCCCceecCCCEEEEcCCCC
Confidence            45899999999987544444544444


No 99 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=22.90  E-value=26  Score=24.29  Aligned_cols=14  Identities=29%  Similarity=0.503  Sum_probs=10.1

Q ss_pred             hhccchhhhhcCCC
Q psy11933         40 LVHACVVCKAQMPD   53 (79)
Q Consensus        40 ~~~~C~vC~~~f~~   53 (79)
                      ..|.|++|+.++..
T Consensus       127 ~~F~Cp~Cg~~L~~  140 (158)
T TIGR00373       127 LNFTCPRCGAMLDY  140 (158)
T ss_pred             cCCcCCCCCCEeee
Confidence            46888888877544


No 100
>PF13920 zf-C3HC4_3:  Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A ....
Probab=22.86  E-value=38  Score=18.60  Aligned_cols=12  Identities=17%  Similarity=0.706  Sum_probs=8.8

Q ss_pred             hhccchhhhhcC
Q psy11933         40 LVHACVVCKAQM   51 (79)
Q Consensus        40 ~~~~C~vC~~~f   51 (79)
                      ....|++|++..
T Consensus        36 ~~~~CP~Cr~~i   47 (50)
T PF13920_consen   36 RKKKCPICRQPI   47 (50)
T ss_dssp             TTSBBTTTTBB-
T ss_pred             cCCCCCcCChhh
Confidence            457899999865


No 101
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=22.46  E-value=37  Score=23.49  Aligned_cols=22  Identities=23%  Similarity=0.606  Sum_probs=11.9

Q ss_pred             hccchhhhhcCCChhhHhHHHHcCC
Q psy11933         41 VHACVVCKAQMPDPKTYKQHFENKH   65 (79)
Q Consensus        41 ~~~C~vC~~~f~~~k~l~~H~esKH   65 (79)
                      .|+|=+|+..|-.   |+-|....|
T Consensus        72 ~i~clecGk~~k~---LkrHL~~~~   93 (132)
T PF05443_consen   72 YIICLECGKKFKT---LKRHLRTHH   93 (132)
T ss_dssp             -EE-TBT--EESB---HHHHHHHTT
T ss_pred             eeEEccCCcccch---HHHHHHHcc
Confidence            3889999999855   455555444


No 102
>KOG4172|consensus
Probab=22.43  E-value=20  Score=22.13  Aligned_cols=19  Identities=47%  Similarity=0.880  Sum_probs=13.2

Q ss_pred             hhhccchhhhhcCCC-hhhH
Q psy11933         39 ALVHACVVCKAQMPD-PKTY   57 (79)
Q Consensus        39 A~~~~C~vC~~~f~~-~k~l   57 (79)
                      ++.-.|+|||...-+ .++|
T Consensus        41 ~~~g~CPiCRapi~dvIkTY   60 (62)
T KOG4172|consen   41 ALHGCCPICRAPIKDVIKTY   60 (62)
T ss_pred             ccCCcCcchhhHHHHHHHhh
Confidence            356789999987655 4444


No 103
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=22.27  E-value=37  Score=19.56  Aligned_cols=18  Identities=22%  Similarity=0.494  Sum_probs=13.3

Q ss_pred             ccchhhhhcCCChhhHhH
Q psy11933         42 HACVVCKAQMPDPKTYKQ   59 (79)
Q Consensus        42 ~~C~vC~~~f~~~k~l~~   59 (79)
                      -+|.||.-.|.-.+-...
T Consensus         9 K~C~~C~rpf~WRKKW~~   26 (42)
T PF10013_consen    9 KICPVCGRPFTWRKKWAR   26 (42)
T ss_pred             CcCcccCCcchHHHHHHH
Confidence            379999999987554443


No 104
>cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs. Members of this group contain a CXXC motif, similar to TRX. The second cysteine in the motif corresponds to the peroxidatic cysteine of PRX, however, these proteins do not contain the other two residues of the catalytic triad of PRX. PRXs confer a protective antioxidant role in cells through their peroxidase activity in which hydrogen peroxide, peroxynitrate, and organic hydroperoxides are reduced and detoxified using reducing equivalents derived from either thioredoxin, glutathione, trypanothione and AhpF. TRXs alter the redox state of target proteins by catalyzing the reduction of their disulfide bonds via the CXXC motif using reducing equivalents derived from either NADPH or ferredoxins.
Probab=22.17  E-value=33  Score=21.56  Aligned_cols=20  Identities=10%  Similarity=0.419  Sum_probs=15.0

Q ss_pred             cchhhhhcCCChhhHhHHHH
Q psy11933         43 ACVVCKAQMPDPKTYKQHFE   62 (79)
Q Consensus        43 ~C~vC~~~f~~~k~l~~H~e   62 (79)
                      -|++|+..++....+.+-+.
T Consensus        35 ~Cp~C~~~~~~l~~~~~~~~   54 (149)
T cd02970          35 GCPFCREYLRALSKLLPELD   54 (149)
T ss_pred             CChhHHHHHHHHHHHHHHHH
Confidence            59999999888666655554


No 105
>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus. The TMX3 transcript is found in a variety of tissues with the highest levels detected in skeletal muscle and the heart. In vitro, TMX3 showed oxidase activity albeit slightly lower than that of protein disulfide isomerase.
Probab=21.85  E-value=53  Score=19.97  Aligned_cols=19  Identities=21%  Similarity=0.326  Sum_probs=15.8

Q ss_pred             chhhhhcCCChhhHhHHHH
Q psy11933         44 CVVCKAQMPDPKTYKQHFE   62 (79)
Q Consensus        44 C~vC~~~f~~~k~l~~H~e   62 (79)
                      |+.|+...|....|..++.
T Consensus        27 C~~C~~~~p~l~~l~~~~~   45 (104)
T cd03000          27 CGHCKKLEPVWNEVGAELK   45 (104)
T ss_pred             CHHHHhhChHHHHHHHHHH
Confidence            9999999998667777764


No 106
>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB. This protein is part of a large group of proteins involved in conjugative transfer of plasmid DNA, specifically the F-type system. This protein has been predicted to contain a thioredoxin fold, contains a conserved pair of cysteines and has been shown to function as a thiol disulfide isomerase by complementation of an Ecoli DsbA defect. The protein is believed to be involved in pilin assembly. The protein is closely related to TraF (TIGR02739) which is somewhat longer, lacks the cysteine motif and is apparently not functional as a disulfide bond isomerase.
Probab=21.67  E-value=28  Score=23.96  Aligned_cols=18  Identities=33%  Similarity=0.717  Sum_probs=14.9

Q ss_pred             chhhhhcCCChhhHhHHH
Q psy11933         44 CVVCKAQMPDPKTYKQHF   61 (79)
Q Consensus        44 C~vC~~~f~~~k~l~~H~   61 (79)
                      |+.|+..+|....|.+.+
T Consensus        62 CppCr~e~P~L~~l~~~~   79 (153)
T TIGR02738        62 CPYCHQFAPVLKRFSQQF   79 (153)
T ss_pred             ChhHHHHHHHHHHHHHHc
Confidence            999999999976666654


No 107
>PHA02610 uvsY.-2 hypothetical protein; Provisional
Probab=21.19  E-value=28  Score=20.99  Aligned_cols=11  Identities=45%  Similarity=1.038  Sum_probs=8.9

Q ss_pred             cchhhhhcCCC
Q psy11933         43 ACVVCKAQMPD   53 (79)
Q Consensus        43 ~C~vC~~~f~~   53 (79)
                      +|.||++.+-.
T Consensus         3 iCvvCK~Pi~~   13 (53)
T PHA02610          3 ICVVCKQPIEK   13 (53)
T ss_pred             eeeeeCCchhh
Confidence            79999998743


No 108
>PLN03239 histone acetyltransferase; Provisional
Probab=20.78  E-value=64  Score=25.90  Aligned_cols=22  Identities=5%  Similarity=0.030  Sum_probs=19.6

Q ss_pred             hccchhhhhcCCChhhHhHHHH
Q psy11933         41 VHACVVCKAQMPDPKTYKQHFE   62 (79)
Q Consensus        41 ~~~C~vC~~~f~~~k~l~~H~e   62 (79)
                      -++|.-|..-|.+...|..|..
T Consensus       106 lYiCE~Clky~~~~~~l~~H~~  127 (351)
T PLN03239        106 LYVCEFSFGFFARKSELLRFQA  127 (351)
T ss_pred             EEEeccchhhhcCHHHHHHHHH
Confidence            4899999999999999999865


No 109
>PF15176 LRR19-TM:  Leucine-rich repeat family 19 TM domain
Probab=20.41  E-value=25  Score=23.72  Aligned_cols=22  Identities=18%  Similarity=0.258  Sum_probs=16.5

Q ss_pred             hhhccchhhhhcCCC--hhhHhHH
Q psy11933         39 ALVHACVVCKAQMPD--PKTYKQH   60 (79)
Q Consensus        39 A~~~~C~vC~~~f~~--~k~l~~H   60 (79)
                      ++.++|++|+.-|.+  -.-|.+|
T Consensus        35 alaaKC~~~~k~~~SY~H~rL~e~   58 (102)
T PF15176_consen   35 ALAAKCPVWYKYLASYRHHRLPET   58 (102)
T ss_pred             HHHHHhHHHHHHHhccccccCCcc
Confidence            566899999999988  3345555


No 110
>PHA02929 N1R/p28-like protein; Provisional
Probab=20.17  E-value=33  Score=25.82  Aligned_cols=13  Identities=23%  Similarity=0.700  Sum_probs=10.6

Q ss_pred             hccchhhhhcCCC
Q psy11933         41 VHACVVCKAQMPD   53 (79)
Q Consensus        41 ~~~C~vC~~~f~~   53 (79)
                      +..||+||..|..
T Consensus       216 ~~tCPlCR~~~~~  228 (238)
T PHA02929        216 KNTCPVCRTPFIS  228 (238)
T ss_pred             CCCCCCCCCEeeE
Confidence            3589999998875


No 111
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms]
Probab=20.14  E-value=64  Score=26.06  Aligned_cols=22  Identities=18%  Similarity=0.469  Sum_probs=16.5

Q ss_pred             ccchhhhhcCCChhhHhHHHHcC
Q psy11933         42 HACVVCKAQMPDPKTYKQHFENK   64 (79)
Q Consensus        42 ~~C~vC~~~f~~~k~l~~H~esK   64 (79)
                      +.|++|- +|--.+++.+|.++=
T Consensus       161 ~~CP~C~-~~~P~~~i~~HLD~C  182 (391)
T COG5432         161 VHCPACS-NLVPHNQINQHLDSC  182 (391)
T ss_pred             hcCchhh-ccCchHHHHHHHHHH
Confidence            6899995 455567888998753


No 112
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)
Probab=20.07  E-value=38  Score=16.78  Aligned_cols=11  Identities=18%  Similarity=0.661  Sum_probs=8.1

Q ss_pred             hhccchhhhhc
Q psy11933         40 LVHACVVCKAQ   50 (79)
Q Consensus        40 ~~~~C~vC~~~   50 (79)
                      ..+.|++|+..
T Consensus        34 ~~~~Cp~C~~~   44 (45)
T cd00162          34 GKNTCPLCRTP   44 (45)
T ss_pred             CcCCCCCCCCc
Confidence            35679999865


No 113
>KOG3288|consensus
Probab=20.04  E-value=49  Score=26.09  Aligned_cols=28  Identities=18%  Similarity=0.409  Sum_probs=24.4

Q ss_pred             HhhhhccchhhhhcCCChhhHhHHHHcC
Q psy11933         37 QKALVHACVVCKAQMPDPKTYKQHFENK   64 (79)
Q Consensus        37 ~aA~~~~C~vC~~~f~~~k~l~~H~esK   64 (79)
                      -+-+.+.|.||...|...+.-.+|.++-
T Consensus       272 t~~ftlRC~~Cq~glvGq~ea~eHA~~T  299 (307)
T KOG3288|consen  272 TAKFTLRCMVCQMGLVGQKEAAEHAKAT  299 (307)
T ss_pred             ccceEEEeeecccceeeHHHHHHHHHhc
Confidence            4456788999999999999999999875


Done!