RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy11978
         (91 letters)



>gnl|CDD|241075 cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif 1 in CUGBP
          Elav-like family member CELF-1, CELF-2, Drosophila
          melanogaster Bruno protein and similar proteins.  This
          subgroup corresponds to the RRM1 of CELF-1, CELF-2 and
          Bruno protein. CELF-1 (also termed BRUNOL-2, or
          CUG-BP1, or EDEN-BP) and CELF-2 (also termed BRUNOL-3,
          or ETR-3, or CUG-BP2, or NAPOR) belong to the CUGBP1
          and ETR-3-like factors (CELF) or BRUNOL (Bruno-like)
          family of RNA-binding proteins that have been
          implicated in regulation of pre-mRNA splicing, and
          control of mRNA translation and deadenylation. CELF-1
          is strongly expressed in all adult and fetal tissues
          tested. The human CELF-1 is a nuclear and cytoplasmic
          RNA-binding protein that regulates multiple aspects of
          nuclear and cytoplasmic mRNA processing, with
          implications for onset of type 1 myotonic dystrophy
          (DM1), a neuromuscular disease associated with an
          unstable CUG triplet expansion in the 3'-UTR
          (3'-untranslated region) of the DMPK (myotonic
          dystrophy protein kinase) gene; it preferentially
          targets UGU-rich mRNA elements. It has been shown to
          bind to a Bruno response element, a cis-element
          involved in translational control of oskar mRNA in
          Drosophila, and share sequence similarity to Bruno, the
          Drosophila protein that mediates this process. The
          Xenopus homolog embryo deadenylation element-binding
          protein (EDEN-BP) mediates sequence-specific
          deadenylation of Eg5 mRNA. It binds specifically to the
          EDEN motif in the 3'-untranslated regions of maternal
          mRNAs and targets these mRNAs for deadenylation and
          translational repression. CELF-1 contain three highly
          conserved RNA recognition motifs (RRMs), also known as
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains): two consecutive RRMs (RRM1 and RRM2) situated
          in the N-terminal region followed by a linker region
          and the third RRM (RRM3) close to the C-terminus of the
          protein. The two N-terminal RRMs of EDEN-BP are
          necessary for the interaction with EDEN as well as a
          part of the linker region (between RRM2 and RRM3).
          Oligomerization of EDEN-BP is required for specific
          mRNA deadenylation and binding. CELF-2 is expressed in
          all tissues at some level, but highest in brain, heart,
          and thymus. It has been implicated in the regulation of
          nuclear and cytoplasmic RNA processing events,
          including alternative splicing, RNA editing, stability
          and translation. CELF-2 shares high sequence identity
          with CELF-1, but shows different binding specificity;
          it binds preferentially to sequences with UG repeats
          and UGUU motifs. It has been shown to bind to a Bruno
          response element, a cis-element involved in
          translational control of oskar mRNA in Drosophila, and
          share sequence similarity to Bruno, the Drosophila
          protein that mediates this process. It also binds to
          the 3'-UTR of cyclooxygenase-2 messages, affecting both
          translation and mRNA stability, and binds to apoB mRNA,
          regulating its C to U editing. CELF-2 also contains
          three highly conserved RRMs. It binds to RNA via the
          first two RRMs, which are also important for
          localization in the cytoplasm. The splicing activation
          or repression activity of CELF-2 on some specific
          substrates is mediated by RRM1/RRM2. Both, RRM1 and
          RRM2 of CELF-2, can activate cardiac troponin T (cTNT)
          exon 5 inclusion. In addition, CELF-2 possesses a
          typical arginine and lysine-rich nuclear localization
          signal (NLS) in the C-terminus, within RRM3. This
          subgroup also includes Drosophila melanogaster Bruno
          protein, which plays a central role in regulation of
          Oskar (Osk) expression in flies. It mediates repression
          by binding to regulatory Bruno response elements (BREs)
          in the Osk mRNA 3' UTR. The full-length Bruno protein
          contains three RRMs, two located in the N-terminal half
          of the protein and the third near the C-terminus,
          separated by a linker region. .
          Length = 84

 Score = 79.5 bits (196), Expect = 3e-21
 Identities = 35/65 (53%), Positives = 43/65 (66%), Gaps = 4/65 (6%)

Query: 28 IKMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTG--QSKGKIFEAAFLKIARAAI 85
          IKMFVGQIPRS  E DL ++F +YG VY INVLRD+     QSKG  F   + +  +AA+
Sbjct: 2  IKMFVGQIPRSWSEKDLRELFEQYGAVYQINVLRDRSQNPPQSKGCCFVTFYTR--KAAL 59

Query: 86 EPQKA 90
          E Q A
Sbjct: 60 EAQNA 64


>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in
          CELF/Bruno-like family of RNA binding proteins and
          plant flowering time control protein FCA.  This
          subfamily corresponds to the RRM1 and RRM2 domains of
          the CUGBP1 and ETR-3-like factors (CELF) as well as
          plant flowering time control protein FCA. CELF, also
          termed BRUNOL (Bruno-like) proteins, is a family of
          structurally related RNA-binding proteins involved in
          regulation of pre-mRNA splicing in the nucleus, and
          control of mRNA translation and deadenylation in the
          cytoplasm. The family contains six members: CELF-1
          (also known as BRUNOL-2, CUG-BP1, NAPOR, EDEN-BP),
          CELF-2 (also known as BRUNOL-3, ETR-3, CUG-BP2,
          NAPOR-2), CELF-3 (also known as BRUNOL-1, TNRC4, ETR-1,
          CAGH4, ER DA4), CELF-4 (BRUNOL-4), CELF-5 (BRUNOL-5)
          and CELF-6 (BRUNOL-6). They all contain three highly
          conserved RNA recognition motifs (RRMs), also known as
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains): two consecutive RRMs (RRM1 and RRM2) situated
          in the N-terminal region followed by a linker region
          and the third RRM (RRM3) close to the C-terminus of the
          protein. The low sequence conservation of the linker
          region is highly suggestive of a large variety in the
          co-factors that associate with the various CELF family
          members. Based on both, sequence similarity and
          function, the CELF family can be divided into two
          subfamilies, the first containing CELFs 1 and 2, and
          the second containing CELFs 3, 4, 5, and 6. The
          different CELF proteins may act through different sites
          on at least some substrates. Furthermore, CELF proteins
          may interact with each other in varying combinations to
          influence alternative splicing in different contexts.
          This subfamily also includes plant flowering time
          control protein FCA that functions in the
          posttranscriptional regulation of transcripts involved
          in the flowering process. FCA contains two RRMs, and a
          WW protein interaction domain.  .
          Length = 77

 Score = 73.4 bits (181), Expect = 5e-19
 Identities = 28/63 (44%), Positives = 40/63 (63%), Gaps = 9/63 (14%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIFEAAFLKI-----ARA 83
          K+FVGQ+P++  E D+  +F EYG +  + ++RDK TGQSKG     AF+K      A+ 
Sbjct: 1  KLFVGQLPKTATEEDVRALFEEYGNIEEVTIIRDKDTGQSKG----CAFVKFSSREEAQK 56

Query: 84 AIE 86
          AIE
Sbjct: 57 AIE 59


>gnl|CDD|241076 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 in CUGBP
          Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6
          and similar proteins.  This subfamily corresponds to
          the RRM1 of CELF-3, CELF-4, CELF-5, CELF-6, all of
          which belong to the CUGBP1 and ETR-3-like factors
          (CELF) or BRUNOL (Bruno-like) family of RNA-binding
          proteins that display dual nuclear and cytoplasmic
          localizations and have been implicated in the
          regulation of pre-mRNA splicing and in the control of
          mRNA translation and deadenylation. CELF-3, expressed
          in brain and testis only, is also known as bruno-like
          protein 1 (BRUNOL-1), or CAG repeat protein 4, or
          CUG-BP- and ETR-3-like factor 3, or embryonic lethal
          abnormal vision (ELAV)-type RNA-binding protein 1
          (ETR-1), or expanded repeat domain protein CAG/CTG 4,
          or trinucleotide repeat-containing gene 4 protein
          (TNRC4). It plays an important role in the pathogenesis
          of tauopathies. CELF-3 contains three highly conserved
          RNA recognition motifs (RRMs), also known as RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains):
          two consecutive RRMs (RRM1 and RRM2) situated in the
          N-terminal region followed by a linker region and the
          third RRM (RRM3) close to the C-terminus of the
          protein.The effect of CELF-3 on tau splicing is
          mediated mainly by the RNA-binding activity of RRM2.
          The divergent linker region might mediate the
          interaction of CELF-3 with other proteins regulating
          its activity or involved in target recognition. CELF-4,
          highly expressed throughout the brain and in glandular
          tissues, moderately expressed in heart, skeletal
          muscle, and liver, is also known as bruno-like protein
          4 (BRUNOL-4), or CUG-BP- and ETR-3-like factor 4. Like
          CELF-3, CELF-4 also contain three highly conserved
          RRMs. The splicing activation or repression activity of
          CELF-4 on some specific substrates is mediated by its
          RRM1/RRM2. On the other hand, both RRM1 and RRM2 of
          CELF-4 can activate cardiac troponin T (cTNT) exon 5
          inclusion. CELF-5, expressed in brain, is also known as
          bruno-like protein 5 (BRUNOL-5), or CUG-BP- and
          ETR-3-like factor 5. Although its biological role
          remains unclear, CELF-5 shares same domain architecture
          with CELF-3. CELF-6, strongly expressed in kidney,
          brain, and testis, is also known as bruno-like protein
          6 (BRUNOL-6), or CUG-BP- and ETR-3-like factor 6. It
          activates exon inclusion of a cardiac troponin T
          minigene in transient transfection assays in an
          muscle-specific splicing enhancer (MSE)-dependent
          manner and can activate inclusion via multiple copies
          of a single element, MSE2. CELF-6 also promotes
          skipping of exon 11 of insulin receptor, a known target
          of CELF activity that is expressed in kidney. In
          additiona to three highly conserved RRMs, CELF-6 also
          possesses numerous potential phosphorylation sites, a
          potential nuclear localization signal (NLS) at the C
          terminus, and an alanine-rich region within the
          divergent linker region. .
          Length = 87

 Score = 71.7 bits (176), Expect = 3e-18
 Identities = 31/69 (44%), Positives = 45/69 (65%), Gaps = 6/69 (8%)

Query: 24 DPDFIKMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIFEAAFLKI--A 81
          D D IK+FVGQIPR+++E DL  +F ++G++Y + VL+DK TG  KG     AFL     
Sbjct: 2  DDDAIKLFVGQIPRNLEEKDLRPLFEQFGKIYELTVLKDKYTGMHKG----CAFLTYCAR 57

Query: 82 RAAIEPQKA 90
           +A++ Q A
Sbjct: 58 ESALKAQSA 66


>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family.
          This subfamily corresponds to the RRM of the ist3
          family that includes fungal U2 small nuclear
          ribonucleoprotein (snRNP) component increased sodium
          tolerance protein 3 (ist3), X-linked 2 RNA-binding
          motif proteins (RBMX2) found in Metazoa and plants, and
          similar proteins. Gene IST3 encoding ist3, also termed
          U2 snRNP protein SNU17 (Snu17p), is a novel yeast
          Saccharomyces cerevisiae protein required for the first
          catalytic step of splicing and for progression of
          spliceosome assembly. It binds specifically to the U2
          snRNP and is an intrinsic component of prespliceosomes
          and spliceosomes. Yeast ist3 contains an atypical RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain). In the yeast
          pre-mRNA retention and splicing complex, the atypical
          RRM of ist3 functions as a scaffold that organizes the
          other two constituents, Bud13p (bud site selection 13)
          and Pml1p (pre-mRNA leakage 1). Fission yeast
          Schizosaccharomyces pombe gene cwf29 encoding ist3,
          also termed cell cycle control protein cwf29, is an
          RNA-binding protein complexed with cdc5 protein 29. It
          also contains one RRM. The biological function of RBMX2
          remains unclear. It shows high sequence similarity to
          yeast ist3 protein and harbors one RRM as well. .
          Length = 89

 Score = 54.2 bits (131), Expect = 2e-11
 Identities = 22/49 (44%), Positives = 34/49 (69%), Gaps = 4/49 (8%)

Query: 31 FVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIFEAAFLK 79
          ++G +P  + E D+  +FS+YG + +IN++RDK TG+SKG  F  AFL 
Sbjct: 13 YIGGLPYELTEGDILCVFSQYGEIVDINLVRDKKTGKSKG--F--AFLA 57


>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter
          pylori HP0827 protein and similar proteins.  This
          subfamily corresponds to the RRM of H. pylori HP0827, a
          putative ssDNA-binding protein 12rnp2 precursor,
          containing one RNA recognition motif (RRM), also termed
          RBD (RNA binding domain) or RNP (ribonucleoprotein
          domain). The ssDNA binding may be important in
          activation of HP0827. .
          Length = 78

 Score = 53.0 bits (128), Expect = 4e-11
 Identities = 22/59 (37%), Positives = 36/59 (61%), Gaps = 1/59 (1%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF-EAAFLKIARAAIE 86
           ++VG +P ++ E DL  +F ++G V +  V+ D+ TG+S+G  F E    + A AAIE
Sbjct: 1  NLYVGNLPYNVTEEDLKDLFGQFGEVTSARVITDRETGRSRGFGFVEMETAEEANAAIE 59


>gnl|CDD|214636 smart00360, RRM, RNA recognition motif. 
          Length = 73

 Score = 52.6 bits (127), Expect = 7e-11
 Identities = 19/45 (42%), Positives = 32/45 (71%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
           +FVG +P    E +L ++FS++G+V ++ ++RDK TG+SKG  F
Sbjct: 1  TLFVGNLPPDTTEEELRELFSKFGKVESVRLVRDKETGKSKGFAF 45


>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila
          sex-lethal (SXL) and similar proteins.  This subfamily
          corresponds to the RRM2 of the sex-lethal protein (SXL)
          which governs sexual differentiation and X chromosome
          dosage compensation in Drosophila melanogaster. It
          induces female-specific alternative splicing of the
          transformer (tra) pre-mRNA by binding to the tra
          uridine-rich polypyrimidine tract at the
          non-sex-specific 3' splice site during the
          sex-determination process. SXL binds also to its own
          pre-mRNA and promotes female-specific alternative
          splicing. SXL contains an N-terminal Gly/Asn-rich
          domain that may be responsible for the protein-protein
          interaction, and tandem RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), that show high preference
          to bind single-stranded, uridine-rich target RNA
          transcripts. .
          Length = 79

 Score = 48.7 bits (116), Expect = 2e-09
 Identities = 18/44 (40%), Positives = 27/44 (61%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          ++V  +PR + E +L K+F  YG +   N+LRDK TG  +G  F
Sbjct: 3  LYVTNLPRQLTEDELRKIFEAYGNIVQCNLLRDKSTGLPRGVAF 46


>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous
          nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA
          recognition motif 1 (hRBMY), testis-specific
          heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T)
          and similar proteins.  This subfamily corresponds to
          the RRM domain of hnRNP G, also termed glycoprotein p43
          or RBMX, an RNA-binding motif protein located on the X
          chromosome. It is expressed ubiquitously and has been
          implicated in the splicing control of several
          pre-mRNAs. Moreover, hnRNP G may function as a
          regulator of transcription for SREBP-1c and GnRH1.
          Research has shown that hnRNP G may also act as a
          tumor-suppressor since it upregulates the Txnip gene
          and promotes the fidelity of DNA end-joining activity.
          In addition, hnRNP G appears to play a critical role in
          proper neural development of zebrafish and frog
          embryos. The family also includes several paralogs of
          hnRNP G, such as hRBMY and hnRNP G-T (also termed
          RNA-binding motif protein, X-linked-like-2). Both,
          hRBMY and hnRNP G-T, are exclusively expressed in
          testis and critical for male fertility. Like hnRNP G,
          hRBMY and hnRNP G-T interact with factors implicated in
          the regulation of pre-mRNA splicing, such as
          hTra2-beta1 and T-STAR. Although members in this family
          share a high conserved N-terminal RNA recognition motif
          (RRM), also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), they appear to recognize
          different RNA targets. For instance, hRBMY interacts
          specifically with a stem-loop structure in which the
          loop is formed by the sequence CA/UCAA. In contrast,
          hnRNP G associates with single stranded RNA sequences
          containing a CCA/C motif. In addition to the RRM, hnRNP
          G contains a nascent transcripts targeting domain (NTD)
          in the middle region and a novel auxiliary RNA-binding
          domain (RBD) in its C-terminal region. The C-terminal
          RBD exhibits distinct RNA binding specificity, and
          would play a critical role in the regulation of
          alternative splicing by hnRNP G. .
          Length = 80

 Score = 47.6 bits (114), Expect = 8e-09
 Identities = 15/42 (35%), Positives = 27/42 (64%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          K+FV  +     E +L  +FS++GRV  + +++D  TG+S+G
Sbjct: 3  KLFVSGLSTRTTEKELEALFSKFGRVEEVLLMKDPETGESRG 44


>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA
          selenocysteine-associated protein 1 (SECp43) and
          similar proteins.  This subfamily corresponds to the
          RRM1 in tRNA selenocysteine-associated protein 1
          (SECp43), yeast negative growth regulatory protein NGR1
          (RBP1), yeast protein NAM8, and similar proteins.
          SECp43 is an RNA-binding protein associated
          specifically with eukaryotic selenocysteine tRNA
          [tRNA(Sec)]. It may play an adaptor role in the
          mechanism of selenocysteine insertion. SECp43 is
          located primarily in the nucleus and contains two
          N-terminal RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), and a C-terminal polar/acidic region. Yeast
          proteins, NGR1 and NAM8, show high sequence similarity
          with SECp43. NGR1 is a putative glucose-repressible
          protein that binds both RNA and single-stranded DNA
          (ssDNA). It may function in regulating cell growth in
          early log phase, possibly through its participation in
          RNA metabolism. NGR1 contains three RRMs, two of which
          are followed by a glutamine-rich stretch that may be
          involved in transcriptional activity. In addition, NGR1
          has an asparagine-rich region near the C-terminus which
          also harbors a methionine-rich region. NAM8 is a
          putative RNA-binding protein that acts as a suppressor
          of mitochondrial splicing deficiencies when
          overexpressed in yeast. It may be a non-essential
          component of the mitochondrial splicing machinery. NAM8
          also contains three RRMs.  .
          Length = 81

 Score = 47.3 bits (113), Expect = 1e-08
 Identities = 20/56 (35%), Positives = 33/56 (58%), Gaps = 1/56 (1%)

Query: 32 VGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF-EAAFLKIARAAIE 86
          +G +   MDEA +   F+E G V ++ ++R+K TG+S G  F E A  + A  A++
Sbjct: 4  MGDLEPWMDEAYIYSAFAECGEVTSVKIIRNKQTGKSAGYGFVEFATHEAAEQALQ 59


>gnl|CDD|241077 cd12633, RRM1_FCA, RNA recognition motif 1 in plant flowering
          time control protein FCA and similar proteins.  This
          subgroup corresponds to the RRM1 of FCA, a gene
          controlling flowering time in Arabidopsis, encoding a
          flowering time control protein that functions in the
          posttranscriptional regulation of transcripts involved
          in the flowering process. FCA contains two RNA
          recognition motifs (RRMs), also known as RBDs (RNA
          binding domains) or RNP (ribonucleoprotein domains),
          and a WW protein interaction domain. .
          Length = 80

 Score = 45.3 bits (107), Expect = 5e-08
 Identities = 18/45 (40%), Positives = 30/45 (66%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          K+FVG +PR++ E ++  MF E+G V  + +++DK TG  +G  F
Sbjct: 1  KLFVGSVPRTITEQEVRPMFEEHGNVLEVAIIKDKRTGHQQGCCF 45


>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar
          protein interacting with the FHA domain of pKI-67
          (NIFK) and similar proteins.  This subgroup corresponds
          to the RRM of NIFK and Nop15p. NIFK, also termed MKI67
          FHA domain-interacting nucleolar phosphoprotein, or
          nucleolar phosphoprotein Nopp34, is a putative
          RNA-binding protein interacting with the forkhead
          associated (FHA) domain of pKi-67 antigen in a
          mitosis-specific and phosphorylation-dependent manner.
          It is nucleolar in interphase but associates with
          condensed mitotic chromosomes. This family also
          includes Saccharomyces cerevisiae YNL110C gene encoding
          ribosome biogenesis protein 15 (Nop15p), also termed
          nucleolar protein 15. Both, NIFK and Nop15p, contain an
          RNA recognition motif (RRM), also termed RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain). .
          Length = 74

 Score = 45.3 bits (108), Expect = 5e-08
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 31 FVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF-EAAFLKIARAAIE 86
          ++G +P    E +L K FS++G V  + + R K TG+SKG  F E    ++A+   E
Sbjct: 3  YIGHLPHGFYEPELRKYFSQFGTVTRLRLSRSKKTGKSKGYAFVEFESPEVAKIVAE 59


>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger
          CCHC-type and RNA-binding motif-containing protein 1
          (ZCRB1) and similar proteins.  This subfamily
          corresponds to the RRM of ZCRB1, also termed MADP-1, or
          U11/U12 small nuclear ribonucleoprotein 31 kDa protein
          (U11/U12 snRNP 31 or U11/U12-31K), a novel
          multi-functional nuclear factor, which may be involved
          in morphine dependence, cold/heat stress, and
          hepatocarcinoma. It is located in the nucleoplasm, but
          outside the nucleolus. ZCRB1 is one of the components
          of U11/U12 snRNPs that bind to U12-type pre-mRNAs and
          form a di-snRNP complex, simultaneously recognizing the
          5' splice site and branchpoint sequence. ZCRB1 is
          characterized by an RNA recognition motif (RRM), also
          termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), and a CCHC-type Zinc finger
          motif. In addition, it contains core nucleocapsid
          motifs, and Lys- and Glu-rich domains.  .
          Length = 78

 Score = 45.4 bits (108), Expect = 5e-08
 Identities = 18/43 (41%), Positives = 29/43 (67%)

Query: 31 FVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          +V  +P S+   DL K+FS+YG+V  + +++DK T +SKG  F
Sbjct: 5  YVSNLPFSLTNNDLHKIFSKYGKVVKVTIVKDKETRKSKGVAF 47


>gnl|CDD|241080 cd12636, RRM2_Bruno_like, RNA recognition motif 2 in Drosophila
          melanogaster Bruno protein and similar proteins.  This
          subgroup corresponds to the RRM2 of Bruno, a Drosophila
          RNA recognition motif (RRM)-containing protein that
          plays a central role in regulation of Oskar (Osk)
          expression. It mediates repression by binding to
          regulatory Bruno response elements (BREs) in the Osk
          mRNA 3' UTR. The full-length Bruno protein contains
          three RRMs, two located in the N-terminal half of the
          protein and the third near the C-terminus, separated by
          a linker region. .
          Length = 81

 Score = 45.6 bits (108), Expect = 5e-08
 Identities = 18/45 (40%), Positives = 28/45 (62%), Gaps = 1/45 (2%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          K+FVG + +  +E D+  MF+ +G +    VLRD+  GQS+G  F
Sbjct: 3  KLFVGMLSKKCNENDVRIMFAPFGSIEECTVLRDQ-NGQSRGCAF 46


>gnl|CDD|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins
          family, Drosophila sex-lethal (SXL), and similar
          proteins.  This subfamily corresponds to the RRM2 of Hu
          proteins and SXL. The Hu proteins family represents a
          group of RNA-binding proteins involved in diverse
          biological processes. Since the Hu proteins share high
          homology with the Drosophila embryonic lethal abnormal
          vision (ELAV) protein, the Hu family is sometimes
          referred to as the ELAV family. Drosophila ELAV is
          exclusively expressed in neurons and is required for
          the correct differentiation and survival of neurons in
          flies. The neuronal members of the Hu family include
          Hu-antigen B (HuB or ELAV-2 or Hel-N1), Hu-antigen C
          (HuC or ELAV-3 or PLE21), and Hu-antigen D (HuD or
          ELAV-4), which play important roles in neuronal
          differentiation, plasticity and memory. HuB is also
          expressed in gonads. Hu-antigen R (HuR or ELAV-1 or
          HuA) is the ubiquitously expressed Hu family member. It
          has a variety of biological functions mostly related to
          the regulation of cellular response to DNA damage and
          other types of stress. Hu proteins perform their
          cytoplasmic and nuclear molecular functions by
          coordinately regulating functionally related mRNAs. In
          the cytoplasm, Hu proteins recognize and bind to
          AU-rich RNA elements (AREs) in the 3' untranslated
          regions (UTRs) of certain target mRNAs, such as GAP-43,
          vascular epithelial growth factor (VEGF), the glucose
          transporter GLUT1, eotaxin and c-fos, and stabilize
          those ARE-containing mRNAs. They also bind and regulate
          the translation of some target mRNAs, such as
          neurofilament M, GLUT1, and p27. In the nucleus, Hu
          proteins function as regulators of polyadenylation and
          alternative splicing. Each Hu protein contains three
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          RRM1 and RRM2 may cooperate in binding to an ARE. RRM3
          may help to maintain the stability of the RNA-protein
          complex, and might also bind to poly(A) tails or be
          involved in protein-protein interactions. Also included
          in this subfamily is the sex-lethal protein (SXL) from
          Drosophila melanogaster. SXL governs sexual
          differentiation and X chromosome dosage compensation in
          flies. It induces female-specific alternative splicing
          of the transformer (tra) pre-mRNA by binding to the tra
          uridine-rich polypyrimidine tract at the
          non-sex-specific 3' splice site during the
          sex-determination process. SXL binds also to its own
          pre-mRNA and promotes female-specific alternative
          splicing. SXL contains an N-terminal Gly/Asn-rich
          domain that may be responsible for the protein-protein
          interaction, and tandem RRMs that show high preference
          to bind single-stranded, uridine-rich target RNA
          transcripts. .
          Length = 79

 Score = 45.3 bits (107), Expect = 6e-08
 Identities = 17/44 (38%), Positives = 32/44 (72%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          ++V  +P++M + +L ++FS+YGR+    +LRD++TG S+G  F
Sbjct: 3  LYVSGLPKTMTQKELEQLFSQYGRIITSRILRDQLTGVSRGVGF 46


>gnl|CDD|241096 cd12652, RRM2_Hu, RNA recognition motif 2 in the Hu proteins
          family.  This subfamily corresponds to the RRM2 of Hu
          proteins family which represents a group of RNA-binding
          proteins involved in diverse biological processes.
          Since the Hu proteins share high homology with the
          Drosophila embryonic lethal abnormal vision (ELAV)
          protein, the Hu family is sometimes referred to as the
          ELAV family. Drosophila ELAV is exclusively expressed
          in neurons and is required for the correct
          differentiation and survival of neurons in flies. The
          neuronal members of the Hu family include Hu-antigen B
          (HuB or ELAV-2 or Hel-N1), Hu-antigen C (HuC or ELAV-3
          or PLE21), and Hu-antigen D (HuD or ELAV-4), which play
          important roles in neuronal differentiation, plasticity
          and memory. HuB is also expressed in gonads. Hu-antigen
          R (HuR or ELAV-1 or HuA) is the ubiquitously expressed
          Hu family member. It has a variety of biological
          functions mostly related to the regulation of cellular
          response to DNA damage and other types of stress.
          Moreover, HuR has an anti-apoptotic function during
          early cell stress response. It binds to mRNAs and
          enhances the expression of several anti-apoptotic
          proteins, such as p21waf1, p53, and prothymosin alpha.
          HuR also has pro-apoptotic function by promoting
          apoptosis when cell death is unavoidable. Furthermore,
          HuR may be important in muscle differentiation,
          adipogenesis, suppression of inflammatory response and
          modulation of gene expression in response to chronic
          ethanol exposure and amino acid starvation. Hu proteins
          perform their cytoplasmic and nuclear molecular
          functions by coordinately regulating functionally
          related mRNAs. In the cytoplasm, Hu proteins recognize
          and bind to AU-rich RNA elements (AREs) in the 3'
          untranslated regions (UTRs) of certain target mRNAs,
          such as GAP-43, vascular epithelial growth factor
          (VEGF), the glucose transporter GLUT1, eotaxin and
          c-fos, and stabilize those ARE-containing mRNAs. They
          also bind and regulate the translation of some target
          mRNAs, such as neurofilament M, GLUT1, and p27. In the
          nucleus, Hu proteins function as regulators of
          polyadenylation and alternative splicing. Each Hu
          protein contains three RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). RRM1 and RRM2 may
          cooperate in binding to an ARE. RRM3 may help to
          maintain the stability of the RNA-protein complex, and
          might also bind to poly(A) tails or be involved in
          protein-protein interactions. .
          Length = 79

 Score = 45.4 bits (108), Expect = 6e-08
 Identities = 16/41 (39%), Positives = 27/41 (65%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          ++V  +P++M + +L  +FS YGR+    +L D VTG S+G
Sbjct: 3  LYVSGLPKTMTQQELEALFSPYGRIITSRILCDNVTGLSRG 43


>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in
          heterogeneous nuclear ribonucleoprotein A subfamily.
          This subfamily corresponds to the RRM2 of hnRNP A0,
          hnRNP A1, hnRNP A2/B1, hnRNP A3 and similar proteins.
          hnRNP A0 is a low abundance hnRNP protein that has been
          implicated in mRNA stability in mammalian cells. It has
          been identified as the substrate for MAPKAP-K2 and may
          be involved in the lipopolysaccharide (LPS)-induced
          post-transcriptional regulation of tumor necrosis
          factor-alpha (TNF-alpha), cyclooxygenase 2 (COX-2) and
          macrophage inflammatory protein 2 (MIP-2). hnRNP A1 is
          an abundant eukaryotic nuclear RNA-binding protein that
          may modulate splice site selection in pre-mRNA
          splicing. hnRNP A2/B1 is an RNA trafficking response
          element-binding protein that interacts with the hnRNP
          A2 response element (A2RE). Many mRNAs, such as myelin
          basic protein (MBP), myelin-associated oligodendrocytic
          basic protein (MOBP), carboxyanhydrase II (CAII),
          microtubule-associated protein tau, and amyloid
          precursor protein (APP) are trafficked by hnRNP A2/B1.
          hnRNP A3 is also a RNA trafficking response
          element-binding protein that participates in the
          trafficking of A2RE-containing RNA. The hnRNP A
          subfamily is characterized by two RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), followed by a long
          glycine-rich region at the C-terminus. .
          Length = 73

 Score = 44.9 bits (107), Expect = 6e-08
 Identities = 17/42 (40%), Positives = 28/42 (66%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          K+FVG +   + E DL + FS+YG V ++ ++ DK TG+ +G
Sbjct: 1  KLFVGGLKEDVTEEDLREYFSQYGNVESVEIVTDKETGKKRG 42


>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12
          small nuclear ribonucleoprotein 35 kDa protein
          (U11/U12-35K) and similar proteins.  This subfamily
          corresponds to the RRM of U11/U12-35K, also termed
          protein HM-1, or U1 snRNP-binding protein homolog, and
          is one of the components of the U11/U12 snRNP, which is
          a subunit of the minor (U12-dependent) spliceosome
          required for splicing U12-type nuclear pre-mRNA
          introns. U11/U12-35K is highly conserved among
          bilateria and plants, but lacks in some organisms, such
          as Saccharomyces cerevisiae and Caenorhabditis elegans.
          Moreover, U11/U12-35K shows significant sequence
          homology to U1 snRNP-specific 70 kDa protein (U1-70K or
          snRNP70). It contains a conserved RNA recognition motif
          (RRM), also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), followed by an adjacent
          glycine-rich region, and Arg-Asp and Arg-Glu dipeptide
          repeats rich domain, making U11/U12-35K a possible
          functional analog of U1-70K. It may facilitate 5'
          splice site recognition in the minor spliceosome and
          play a role in exon bridging, interacting with
          components of the major spliceosome bound to the
          pyrimidine tract of an upstream U2-type intron. The
          family corresponds to the RRM of U11/U12-35K that may
          directly contact the U11 or U12 snRNA through the RRM
          domain.
          Length = 93

 Score = 45.3 bits (108), Expect = 8e-08
 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 5/60 (8%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF-----EAAFLKIARAA 84
          +FVG++     E  L ++FS YG +  + ++RD VTG SKG  F     E   L+  R A
Sbjct: 6  LFVGRLSLQTTEETLREVFSRYGDIRRLRLVRDIVTGFSKGYAFVEYEHERDALRAYRDA 65


>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage
          stimulation factor subunit 2 (CSTF2), yeast ortholog
          mRNA 3'-end-processing protein RNA15 and similar
          proteins.  This subfamily corresponds to the RRM domain
          of CSTF2, its tau variant and eukaryotic homologs.
          CSTF2, also termed cleavage stimulation factor 64 kDa
          subunit (CstF64), is the vertebrate conterpart of yeast
          mRNA 3'-end-processing protein RNA15. It is expressed
          in all somatic tissues and is one of three cleavage
          stimulatory factor (CstF) subunits required for
          polyadenylation. CstF64 contains an N-terminal RNA
          recognition motif (RRM), also known as RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain), a
          CstF77-binding domain, a repeated MEARA helical region
          and a conserved C-terminal domain reported to bind the
          transcription factor PC-4. During polyadenylation, CstF
          interacts with the pre-mRNA through the RRM of CstF64
          at U- or GU-rich sequences within 10 to 30 nucleotides
          downstream of the cleavage site. CSTF2T, also termed
          tauCstF64, is a paralog of the X-linked cleavage
          stimulation factor CstF64 protein that supports
          polyadenylation in most somatic cells. It is expressed
          during meiosis and subsequent haploid differentiation
          in a more limited set of tissues and cell types,
          largely in meiotic and postmeiotic male germ cells, and
          to a lesser extent in brain. The loss of CSTF2T will
          cause male infertility, as it is necessary for
          spermatogenesis and fertilization. Moreover, CSTF2T is
          required for expression of genes involved in
          morphological differentiation of spermatids, as well as
          for genes having products that function during
          interaction of motile spermatozoa with eggs. It
          promotes germ cell-specific patterns of polyadenylation
          by using its RRM to bind to different sequence elements
          downstream of polyadenylation sites than does CstF64.
          The family also includes yeast ortholog mRNA
          3'-end-processing protein RNA15 and similar proteins.
          RNA15 is a core subunit of cleavage factor IA (CFIA),
          an essential transcriptional 3'-end processing factor
          from Saccharomyces cerevisiae. RNA recognition by CFIA
          is mediated by an N-terminal RRM, which is contained in
          the RNA15 subunit of the complex. The RRM of RNA15 has
          a strong preference for GU-rich RNAs, mediated by a
          binding pocket that is entirely conserved in both yeast
          and vertebrate RNA15 orthologs.
          Length = 75

 Score = 44.5 bits (106), Expect = 1e-07
 Identities = 17/40 (42%), Positives = 24/40 (60%)

Query: 31 FVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          FVG IP    E  L ++FSE G V +  ++ D+ TG+ KG
Sbjct: 2  FVGNIPYDATEEQLIEIFSEVGPVVSFRLVTDRDTGKPKG 41


>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif. (a.k.a. RRM, RBD, or RNP
          domain).  The RRM motif is probably diagnostic of an
          RNA binding protein. RRMs are found in a variety of RNA
          binding proteins, including various hnRNP proteins,
          proteins implicated in regulation of alternative
          splicing, and protein components of snRNPs. The motif
          also appears in a few single stranded DNA binding
          proteins. The RRM structure consists of four strands
          and two helices arranged in an alpha/beta sandwich,
          with a third helix present during RNA binding in some
          cases The C-terminal beta strand (4th strand) and final
          helix are hard to align and have been omitted in the
          SEED alignment The LA proteins have an N terminal rrm
          which is included in the seed. There is a second region
          towards the C terminus that has some features
          characteristic of a rrm but does not appear to have the
          important structural core of a rrm. The LA proteins are
          one of the main autoantigens in Systemic lupus
          erythematosus (SLE), an autoimmune disease.
          Length = 70

 Score = 44.1 bits (105), Expect = 1e-07
 Identities = 19/43 (44%), Positives = 29/43 (67%), Gaps = 1/43 (2%)

Query: 31 FVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          FVG +P    E DL  +FS++G + +I ++RD+ TG+SKG  F
Sbjct: 2  FVGNLPPDTTEEDLKDLFSKFGPIESIRIVRDE-TGRSKGFAF 43


>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA
          stem-loop-interacting RNA-binding protein (SLIRP) and
          similar proteins.  This subfamily corresponds to the
          RRM of SLIRP, a widely expressed small steroid receptor
          RNA activator (SRA) binding protein, which binds to
          STR7, a functional substructure of SRA. SLIRP is
          localized predominantly to the mitochondria and plays a
          key role in modulating several nuclear receptor (NR)
          pathways. It functions as a co-repressor to repress
          SRA-mediated nuclear receptor coactivation. It
          modulates SHARP- and SKIP-mediated co-regulation of NR
          activity. SLIRP contains an RNA recognition motif
          (RRM), also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), which is required for
          SLIRP's corepression activities. .
          Length = 73

 Score = 43.4 bits (103), Expect = 3e-07
 Identities = 19/42 (45%), Positives = 29/42 (69%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          K+FVG +P ++   +L + FS++G+V + NV  DK TG SKG
Sbjct: 1  KLFVGNLPWTVGSKELKEYFSQFGKVKSCNVPFDKETGLSKG 42


>gnl|CDD|241217 cd12773, RRM2_HuR, RNA recognition motif 2 in vertebrate
          Hu-antigen R (HuR).  This subgroup corresponds to the
          RRM2 of HuR, also termed ELAV-like protein 1 (ELAV-1),
          the ubiquitously expressed Hu family member. It has a
          variety of biological functions mostly related to the
          regulation of cellular response to DNA damage and other
          types of stress. HuR has an anti-apoptotic function
          during early cell stress response. It binds to mRNAs
          and enhances the expression of several anti-apoptotic
          proteins, such as p21waf1, p53, and prothymosin alpha.
          HuR also has pro-apoptotic function by promoting
          apoptosis when cell death is unavoidable. Furthermore,
          HuR may be important in muscle differentiation,
          adipogenesis, suppression of inflammatory response and
          modulation of gene expression in response to chronic
          ethanol exposure and amino acid starvation. Like other
          Hu proteins, HuR contains three RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). RRM1 and RRM2 may
          cooperate in binding to an AU-rich RNA element (ARE).
          RRM3 may help to maintain the stability of the
          RNA-protein complex, and might also bind to poly(A)
          tails or be involved in protein-protein interactions. .
          Length = 84

 Score = 43.5 bits (102), Expect = 3e-07
 Identities = 18/44 (40%), Positives = 29/44 (65%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          +++  +PR+M + D+  MFS +GR+ N  VL D+ TG S+G  F
Sbjct: 3  LYISGLPRTMTQKDVEDMFSRFGRIINSRVLVDQATGLSRGVAF 46


>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor.  This
           model describes the ELAV/HuD subfamily of splicing
           factors found in metazoa. HuD stands for the human
           paraneoplastic encephalomyelitis antigen D of which
           there are 4 variants in human. ELAV stnds for the
           Drosophila Embryonic lethal abnormal visual protein.
           ELAV-like splicing factors are also known in human as
           HuB (ELAV-like protein 2), HuC (ELAV-like protein 3,
           Paraneoplastic cerebellar degeneration-associated
           antigen) and HuR (ELAV-like protein 1). These genes are
           most closely related to the sex-lethal subfamily of
           splicing factors found in Dipteran insects (TIGR01659).
           These proteins contain 3 RNA-recognition motifs (rrm:
           pfam00076).
          Length = 352

 Score = 45.3 bits (107), Expect = 5e-07
 Identities = 19/52 (36%), Positives = 32/52 (61%), Gaps = 3/52 (5%)

Query: 22  QPDPDFIK---MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
           +P  D IK   ++V  +P++M + +L  +FS +G++    +L D VTG SKG
Sbjct: 81  RPSSDSIKGANLYVSGLPKTMTQHELESIFSPFGQIITSRILSDNVTGLSKG 132



 Score = 37.6 bits (87), Expect = 3e-04
 Identities = 15/44 (34%), Positives = 28/44 (63%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          + V  +P++M + ++  +F+  G + +  ++RDKVTGQS G  F
Sbjct: 6  LIVNYLPQTMTQEEIRSLFTSIGEIESCKLVRDKVTGQSLGYGF 49



 Score = 34.1 bits (78), Expect = 0.004
 Identities = 16/44 (36%), Positives = 24/44 (54%)

Query: 30  MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
           +FV  +    DE  L ++F  +G V N+ ++RD  T Q KG  F
Sbjct: 272 IFVYNLSPDTDETVLWQLFGPFGAVQNVKIIRDLTTNQCKGYGF 315


>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear
          polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p)
          and similar proteins.  This subfamily corresponds to
          the RRM1 of Hrp1p and similar proteins. Hrp1p or Nab4p,
          also termed cleavage factor IB (CFIB), is a
          sequence-specific trans-acting factor that is essential
          for mRNA 3'-end formation in yeast Saccharomyces
          cerevisiae. It can be UV cross-linked to RNA and
          specifically recognizes the (UA)6 RNA element required
          for both, the cleavage and poly(A) addition steps.
          Moreover, Hrp1p can shuttle between the nucleus and the
          cytoplasm, and play an additional role in the export of
          mRNAs to the cytoplasm. Hrp1p also interacts with
          Rna15p and Rna14p, two components of CF1A. In addition,
          Hrp1p functions as a factor directly involved in
          modulating the activity of the nonsense-mediated mRNA
          decay (NMD) pathway; it binds specifically to a
          downstream sequence element (DSE)-containing RNA and
          interacts with Upf1p, a component of the surveillance
          complex, further triggering the NMD pathway. Hrp1p
          contains two central RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and an
          arginine-glycine-rich region harboring repeats of the
          sequence RGGF/Y. .
          Length = 75

 Score = 42.4 bits (100), Expect = 8e-07
 Identities = 20/75 (26%), Positives = 41/75 (54%), Gaps = 13/75 (17%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG-------------KIFEA 75
          K+FVG +P  + E +  + FS++G+V +  +++D  TG+S+G             ++F A
Sbjct: 1  KIFVGGLPPDVTEEEFKEYFSQFGKVVDAQLMQDHDTGRSRGFGFVTFDSESAVERVFSA 60

Query: 76 AFLKIARAAIEPQKA 90
            L++    +E ++A
Sbjct: 61 GMLELGGKQVEVKRA 75


>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like
          family of RNA binding proteins CELF1, CELF2, CELF3,
          CELF4, CELF5, CELF6 and similar proteins.  This
          subgroup corresponds to the RRM3 of the CUGBP1 and
          ETR-3-like factors (CELF) or BRUNOL (Bruno-like)
          proteins, a family of structurally related RNA-binding
          proteins involved in the regulation of pre-mRNA
          splicing in the nucleus and in the control of mRNA
          translation and deadenylation in the cytoplasm. The
          family contains six members: CELF-1 (also termed
          BRUNOL-2, or CUG-BP1, or NAPOR, or EDEN-BP), CELF-2
          (also termed BRUNOL-3, or ETR-3, or CUG-BP2, or
          NAPOR-2), CELF-3 (also termed BRUNOL-1, or TNRC4, or
          ETR-1, or CAGH4, or ER DA4), CELF-4 (also termed
          BRUNOL-4), CELF-5 (also termed BRUNOL-5), CELF-6 (also
          termed BRUNOL-6). They all contain three highly
          conserved RNA recognition motifs (RRMs), also known as
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains): two consecutive RRMs (RRM1 and RRM2) situated
          in the N-terminal region followed by a linker region
          and the third RRM (RRM3) close to the C-terminus of the
          protein. The low sequence conservation of the linker
          region is highly suggestive of a large variety in the
          co-factors that associate with the various CELF family
          members. Based on both sequence similarity and
          function, the CELF family can be divided into two
          subfamilies, the first containing CELFs 1 and 2, and
          the second containing CELFs 3, 4, 5, and 6. The
          different CELF proteins may act through different sites
          on at least some substrates. Furthermore, CELF proteins
          may interact with each other in varying combinations to
          influence alternative splicing in different contexts. .
          Length = 73

 Score = 42.2 bits (100), Expect = 9e-07
 Identities = 15/41 (36%), Positives = 24/41 (58%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          +F+  +P    + DL ++F+ +G V +  V  DK TGQSK 
Sbjct: 1  LFIYHLPNEFTDQDLYQLFAPFGNVISAKVFVDKNTGQSKC 41


>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome
          biogenesis protein 15 (Nop15p) and similar proteins.
          This subgroup corresponds to the RRM of Nop15p, also
          termed nucleolar protein 15, which is encoded by
          YNL110C from Saccharomyces cerevisiae, and localizes to
          the nucleoplasm and nucleolus. Nop15p has been
          identified as a component of a pre-60S particle. It
          interacts with RNA components of the early pre-60S
          particles. Furthermore, Nop15p binds directly to a
          pre-rRNA transcript in vitro and is required for
          pre-rRNA processing. It functions as a ribosome
          synthesis factor required for the 5' to 3' exonuclease
          digestion that generates the 5' end of the major, short
          form of the 5.8S rRNA as well as for processing of 27SB
          to 7S pre-rRNA. Nop15p also play a specific role in
          cell cycle progression. Nop15p contains an RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain). .
          Length = 77

 Score = 42.1 bits (99), Expect = 9e-07
 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIFEAAFLKIARAAI 85
          +++G +P    E +L K FS++G V N+ V R K TG SK   F   FL    AAI
Sbjct: 2  IYIGHLPHGFLEKELKKYFSQFGTVKNVRVARSKKTGNSKHYGF-IQFLNPEVAAI 56


>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in
          eukaryotic RNA-binding protein RBM24, RBM38 and similar
          proteins.  This subfamily corresponds to the RRM of
          RBM24 and RBM38 from vertebrate, SUPpressor family
          member SUP-12 from Caenorhabditis elegans and similar
          proteins. Both, RBM24 and RBM38, are preferentially
          expressed in cardiac and skeletal muscle tissues. They
          regulate myogenic differentiation by controlling the
          cell cycle in a p21-dependent or -independent manner.
          RBM24, also termed RNA-binding region-containing
          protein 6, interacts with the 3'-untranslated region
          (UTR) of myogenin mRNA and regulates its stability in
          C2C12 cells. RBM38, also termed CLL-associated antigen
          KW-5, or HSRNASEB, or RNA-binding region-containing
          protein 1(RNPC1), or ssDNA-binding protein SEB4, is a
          direct target of the p53 family. It is required for
          maintaining the stability of the basal and
          stress-induced p21 mRNA by binding to their 3'-UTRs. It
          also binds the AU-/U-rich elements in p63 3'-UTR and
          regulates p63 mRNA stability and activity. SUP-12 is a
          novel tissue-specific splicing factor that controls
          muscle-specific splicing of the ADF/cofilin pre-mRNA in
          C. elegans. All family members contain a conserved RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain). .
          Length = 76

 Score = 42.2 bits (100), Expect = 9e-07
 Identities = 17/45 (37%), Positives = 27/45 (60%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          K+FVG +P    +  L K FS++G +    V+ D+ TG+S+G  F
Sbjct: 2  KIFVGGLPYHTTDDSLRKYFSQFGEIEEAVVITDRQTGKSRGYGF 46


>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in
          heterogeneous nuclear ribonucleoprotein hnRNP A and
          hnRNP D subfamilies and similar proteins.  This
          subfamily corresponds to the RRM1 in the hnRNP A
          subfamily which includes hnRNP A0, hnRNP A1, hnRNP
          A2/B1, hnRNP A3 and similar proteins. hnRNP A0 is a low
          abundance hnRNP protein that has been implicated in
          mRNA stability in mammalian cells. hnRNP A1 is an
          abundant eukaryotic nuclear RNA-binding protein that
          may modulate splice site selection in pre-mRNA
          splicing. hnRNP A2/B1 is an RNA trafficking response
          element-binding protein that interacts with the hnRNP
          A2 response element (A2RE). hnRNP A3 is also a RNA
          trafficking response element-binding protein that
          participates in the trafficking of A2RE-containing RNA.
          The hnRNP A subfamily is characterized by two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          followed by a long glycine-rich region at the
          C-terminus. The hnRNP D subfamily includes hnRNP D0,
          hnRNP A/B, hnRNP DL and similar proteins. hnRNP D0 is a
          UUAG-specific nuclear RNA binding protein that may be
          involved in pre-mRNA splicing and telomere elongation.
          hnRNP A/B is an RNA unwinding protein with a high
          affinity for G- followed by U-rich regions. hnRNP A/B
          has also been identified as an APOBEC1-binding protein
          that interacts with apolipoprotein B (apoB) mRNA
          transcripts around the editing site and thus, plays an
          important role in apoB mRNA editing. hnRNP DL (or hnRNP
          D-like) is a dual functional protein that possesses
          DNA- and RNA-binding properties. It has been implicated
          in mRNA biogenesis at the transcriptional and
          post-transcriptional levels. All members in this
          subfamily contain two putative RRMs and a glycine- and
          tyrosine-rich C-terminus. The family also contains
          DAZAP1 (Deleted in azoospermia-associated protein 1),
          RNA-binding protein Musashi homolog Musashi-1,
          Musashi-2 and similar proteins. They all harbor two
          RRMs. .
          Length = 72

 Score = 41.8 bits (99), Expect = 1e-06
 Identities = 14/41 (34%), Positives = 26/41 (63%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          +F+G +     E  L + FS+YG V +  +++D +TG+S+G
Sbjct: 1  LFIGGLSWDTTEESLREYFSKYGEVVDCVIMKDPITGRSRG 41


>gnl|CDD|240813 cd12367, RRM2_RBM45, RNA recognition motif 2 in RNA-binding
          protein 45 (RBM45) and similar proteins.  This
          subfamily corresponds to the RRM2 of RBM45, also termed
          developmentally-regulated RNA-binding protein 1 (DRB1),
          a new member of RNA recognition motif (RRM)-type neural
          RNA-binding proteins, which expresses under
          spatiotemporal control. It is encoded by gene drb1 that
          is expressed in neurons, not in glial cells. RBM45
          predominantly localizes in cytoplasm of cultured cells
          and specifically binds to poly(C) RNA. It could play an
          important role during neurogenesis. RBM45 carries four
          RRMs, also known as RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). .
          Length = 74

 Score = 42.0 bits (99), Expect = 1e-06
 Identities = 22/57 (38%), Positives = 38/57 (66%), Gaps = 2/57 (3%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIFEAAFLKIARAAI 85
          ++FV  IP+S  E DL + F E+G +  +++++DK TG+SKG  +   F K ++AA+
Sbjct: 3  RLFV-VIPKSYTEEDLREKFKEFGDIEYVSIVKDKNTGESKGFGY-VKFHKPSQAAV 57


>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein
          PTB-binding raver-1, raver-2 and similar proteins.
          This subfamily corresponds to the RRM2 of raver-1 and
          raver-2. Raver-1 is a ubiquitously expressed
          heterogeneous nuclear ribonucleoprotein (hnRNP) that
          serves as a co-repressor of the nucleoplasmic splicing
          repressor polypyrimidine tract-binding protein
          (PTB)-directed splicing of select mRNAs. It shuttles
          between the cytoplasm and the nucleus and can
          accumulate in the perinucleolar compartment, a dynamic
          nuclear substructure that harbors PTB. Raver-1 also
          modulates focal adhesion assembly by binding to the
          cytoskeletal proteins, including alpha-actinin,
          vinculin, and metavinculin (an alternatively spliced
          isoform of vinculin) at adhesion complexes,
          particularly in differentiated muscle tissue. Raver-2
          is a novel member of the heterogeneous nuclear
          ribonucleoprotein (hnRNP) family. It shows high
          sequence homology to raver-1. Raver-2 exerts a
          spatio-temporal expression pattern during embryogenesis
          and is mainly limited to differentiated neurons and
          glia cells. Although it displays nucleo-cytoplasmic
          shuttling in heterokaryons, raver2 localizes to the
          nucleus in glia cells and neurons. Raver-2 can interact
          with PTB and may participate in PTB-mediated
          RNA-processing. However, there is no evidence
          indicating that raver-2 can bind to cytoplasmic
          proteins. Both, raver-1 and raver-2, contain three
          N-terminal RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), two putative nuclear localization signals
          (NLS) at the N- and C-termini, a central leucine-rich
          region, and a C-terminal region harboring two
          [SG][IL]LGxxP motifs. They binds to RNA through the
          RRMs. In addition, the two [SG][IL]LGxxP motifs serve
          as the PTB-binding motifs in raver1. However, raver-2
          interacts with PTB through the SLLGEPP motif only. .
          Length = 77

 Score = 41.9 bits (99), Expect = 1e-06
 Identities = 11/41 (26%), Positives = 21/41 (51%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          + VG +P    +    ++ S +G V    ++  + TG+SKG
Sbjct: 2  LCVGNLPLEFTDEQFRELVSPFGAVERCFLVYSESTGESKG 42


>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces
          cerevisiae nucleolar protein 6 (Nop6) and similar
          proteins.  This subfamily corresponds to the RRM of
          Nop6, also known as Ydl213c, a component of 90S
          pre-ribosomal particles in yeast S. cerevisiae. It is
          enriched in the nucleolus and is required for 40S
          ribosomal subunit biogenesis. Nop6 is a non-essential
          putative RNA-binding protein with two N-terminal
          putative nuclear localisation sequences (NLS-1 and
          NLS-2) and an RNA recognition motif (RRM), also termed
          RBD (RNA binding domain) or RNP (ribonucleoprotein
          domain). It binds to the pre-rRNA early during
          transcription and plays an essential role in pre-rRNA
          processing. .
          Length = 74

 Score = 41.2 bits (97), Expect = 2e-06
 Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 5/58 (8%)

Query: 27 FIKMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIFEAAFLKIARAA 84
          FI +FVG +P      DL   F   G   ++ +L DK TG+SKG     AF++   A 
Sbjct: 1  FI-LFVGNLPYDTTAEDLLAHFKNAGAPPSVRLLTDKKTGKSKG----CAFVEFDTAE 53


>gnl|CDD|241220 cd12776, RRM2_HuC, RNA recognition motif 2 in vertebrate
          Hu-antigen C (HuC).  This subgroup corresponds to the
          RRM2 of HuC, also termed ELAV-like protein 3 (ELAV-3),
          or paraneoplastic cerebellar degeneration-associated
          antigen, or paraneoplastic limbic encephalitis antigen
          21 (PLE21), one of the neuronal members of the Hu
          family. The neuronal Hu proteins play important roles
          in neuronal differentiation, plasticity and memory.
          Like other Hu proteins, HuC contains three RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          RRM1 and RRM2 may cooperate in binding to an AU-rich
          RNA element (ARE). The AU-rich element binding of HuC
          can be inhibited by flavonoids. RRM3 may help to
          maintain the stability of the RNA-protein complex, and
          might also bind to poly(A) tails or be involved in
          protein-protein interactions. .
          Length = 81

 Score = 41.5 bits (97), Expect = 2e-06
 Identities = 16/44 (36%), Positives = 31/44 (70%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          ++V  +P++M + ++ ++FS+YGR+    +L D+VTG S+G  F
Sbjct: 4  LYVSGLPKTMSQKEMEQLFSQYGRIITSRILVDQVTGISRGVGF 47


>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia
          (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE.
          This subfamily corresponds to the RRM domain of two
          Deleted in AZoospermia (DAZ) autosomal homologs, DAZL
          (DAZ-like) and BOULE. BOULE is the founder member of
          the family and DAZL arose from BOULE in an ancestor of
          vertebrates. The DAZ gene subsequently originated from
          a duplication transposition of the DAZL gene.
          Invertebrates contain a single DAZ homolog, BOULE,
          while vertebrates, other than catarrhine primates,
          possess both BOULE and DAZL genes. The catarrhine
          primates possess BOULE, DAZL, and DAZ genes. The family
          members encode closely related RNA-binding proteins
          that are required for fertility in numerous organisms.
          These proteins contain an RNA recognition motif (RRM),
          also known as RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), and a varying number of
          copies of a DAZ motif, believed to mediate
          protein-protein interactions. DAZL and BOULE contain a
          single copy of the DAZ motif, while DAZ proteins can
          contain 8-24 copies of this repeat. Although their
          specific biochemical functions remain to be
          investigated, DAZL proteins may interact with
          poly(A)-binding proteins (PABPs), and act as
          translational activators of specific mRNAs during
          gametogenesis.  .
          Length = 80

 Score = 41.1 bits (97), Expect = 2e-06
 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          ++FVG IP    E +L   FS +G V ++ ++ D+  G SKG
Sbjct: 4  RIFVGGIPPDTTEEELRDFFSRFGSVKDVKIITDR-AGVSKG 44


>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily.  RRM,
          also known as RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), is a highly abundant domain
          in eukaryotes found in proteins involved in
          post-transcriptional gene expression processes
          including mRNA and rRNA processing, RNA export, and RNA
          stability. This domain is 90 amino acids in length and
          consists of a four-stranded beta-sheet packed against
          two alpha-helices. RRM usually interacts with ssRNA,
          but is also known to interact with ssDNA as well as
          proteins. RRM binds a variable number of nucleotides,
          ranging from two to eight. The active site includes
          three aromatic side-chains located within the conserved
          RNP1 and RNP2 motifs of the domain. The RRM domain is
          found in a variety heterogeneous nuclear
          ribonucleoproteins (hnRNPs), proteins implicated in
          regulation of alternative splicing, and protein
          components of small nuclear ribonucleoproteins
          (snRNPs).
          Length = 72

 Score = 41.1 bits (97), Expect = 2e-06
 Identities = 18/43 (41%), Positives = 29/43 (67%), Gaps = 1/43 (2%)

Query: 31 FVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          FVG +P    E DL ++FS++G + ++ ++RDK  G+SKG  F
Sbjct: 2  FVGNLPPDTTEEDLRELFSKFGEIESVRIVRDK-DGKSKGFAF 43


>gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding
          protein 45 (RBM45) and similar proteins.  This
          subfamily corresponds to the RRM1 of RBM45, also termed
          developmentally-regulated RNA-binding protein 1 (DRB1),
          a new member of RNA recognition motif (RRM)-type neural
          RNA-binding proteins, which expresses under
          spatiotemporal control. It is encoded by gene drb1 that
          is expressed in neurons, not in glial cells. RBM45
          predominantly localizes in cytoplasm of cultured cells
          and specifically binds to poly(C) RNA. It could play an
          important role during neurogenesis. RBM45 carries four
          RRMs, also known as RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). .
          Length = 81

 Score = 41.2 bits (97), Expect = 3e-06
 Identities = 18/47 (38%), Positives = 31/47 (65%), Gaps = 4/47 (8%)

Query: 37 RSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIFEAAFLKIARA 83
          +S+ E DL + F+ +G + +I V++DK T +SKG     A++K A+A
Sbjct: 12 KSVTEDDLREAFAPFGEIQDIWVVKDKQTKESKG----VAYVKFAKA 54


>gnl|CDD|241218 cd12774, RRM2_HuD, RNA recognition motif 2 in vertebrate
          Hu-antigen D (HuD).  This subgroup corresponds to the
          RRM2 of HuD, also termed ELAV-like protein 4 (ELAV-4),
          or paraneoplastic encephalomyelitis antigen HuD, one of
          the neuronal members of the Hu family. The neuronal Hu
          proteins play important roles in neuronal
          differentiation, plasticity and memory. HuD has been
          implicated in various aspects of neuronal function,
          such as the commitment and differentiation of neuronal
          precursors as well as synaptic remodeling in mature
          neurons. HuD also functions as an important regulator
          of mRNA expression in neurons by interacting with
          AU-rich RNA element (ARE) and stabilizing multiple
          transcripts. Moreover, HuD regulates the nuclear
          processing/stability of N-myc pre-mRNA in neuroblastoma
          cells and also regulates the neurite elongation and
          morphological differentiation. HuD specifically binds
          poly(A) RNA. Like other Hu proteins, HuD contains three
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          RRM1 and RRM2 may cooperate in binding to an ARE. RRM3
          may help to maintain the stability of the RNA-protein
          complex, and might also bind to poly(A) tails or be
          involved in protein-protein interactions. .
          Length = 81

 Score = 40.9 bits (95), Expect = 4e-06
 Identities = 17/44 (38%), Positives = 31/44 (70%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          ++V  +P++M + +L ++FS+YGR+    +L D+VTG S+G  F
Sbjct: 5  LYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGF 48


>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic
          translation initiation factor 3 subunit G (eIF-3G) and
          similar proteins.  This subfamily corresponds to the
          RRM of eIF-3G and similar proteins. eIF-3G, also termed
          eIF-3 subunit 4, or eIF-3-delta, or eIF3-p42, or
          eIF3-p44, is the RNA-binding subunit of eIF3, a large
          multisubunit complex that plays a central role in the
          initiation of translation by binding to the 40 S
          ribosomal subunit and promoting the binding of
          methionyl-tRNAi and mRNA. eIF-3G binds 18 S rRNA and
          beta-globin mRNA, and therefore appears to be a
          nonspecific RNA-binding protein. eIF-3G is one of the
          cytosolic targets and interacts with mature
          apoptosis-inducing factor (AIF). eIF-3G contains one
          RNA recognition motif (RRM), also termed RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain). This
          family also includes yeast eIF3-p33, a homolog of
          vertebrate eIF-3G, plays an important role in the
          initiation phase of protein synthesis in yeast. It
          binds both, mRNA and rRNA, fragments due to an RRM near
          its C-terminus. .
          Length = 77

 Score = 40.6 bits (96), Expect = 4e-06
 Identities = 14/39 (35%), Positives = 23/39 (58%)

Query: 32 VGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          V  +    DE DL ++F  +G +  + + +DK TGQS+G
Sbjct: 4  VTNLSEDADEDDLRELFRPFGPISRVYLAKDKETGQSRG 42


>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple
          RNA-binding domain-containing protein 1 (MRD1) and
          similar proteins.  This subgroup corresponds to the
          RRM2 of MRD1 which is encoded by a novel yeast gene
          MRD1 (multiple RNA-binding domain). It is
          well-conserved in yeast and its homologs exist in all
          eukaryotes. MRD1 is present in the nucleolus and the
          nucleoplasm. It interacts with the 35 S precursor rRNA
          (pre-rRNA) and U3 small nucleolar RNAs (snoRNAs). It is
          essential for the initial processing at the A0-A2
          cleavage sites in the 35 S pre-rRNA. MRD1 contains 5
          conserved RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), which may play an important structural role
          in organizing specific rRNA processing events. .
          Length = 79

 Score = 40.5 bits (95), Expect = 4e-06
 Identities = 18/42 (42%), Positives = 29/42 (69%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          ++FV  +P S  E DL K+FS++G +  ++V  DK +G+SKG
Sbjct: 4  RLFVRNLPYSCKEDDLEKLFSKFGELSEVHVAIDKKSGKSKG 45


>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a.k.a. RRM, RBD, or RNP
          domain). 
          Length = 69

 Score = 39.8 bits (94), Expect = 5e-06
 Identities = 13/33 (39%), Positives = 22/33 (66%)

Query: 31 FVGQIPRSMDEADLTKMFSEYGRVYNINVLRDK 63
          +V  +P S+ E DL + FS YG+V  + ++R+K
Sbjct: 2  YVRNLPPSVTEEDLREFFSPYGKVEGVRLVRNK 34


>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins
          family.  This subfamily corresponds to the RRM3 of the
          Hu proteins family which represent a group of
          RNA-binding proteins involved in diverse biological
          processes. Since the Hu proteins share high homology
          with the Drosophila embryonic lethal abnormal vision
          (ELAV) protein, the Hu family is sometimes referred to
          as the ELAV family. Drosophila ELAV is exclusively
          expressed in neurons and is required for the correct
          differentiation and survival of neurons in flies. The
          neuronal members of the Hu family include Hu-antigen B
          (HuB or ELAV-2 or Hel-N1), Hu-antigen C (HuC or ELAV-3
          or PLE21), and Hu-antigen D (HuD or ELAV-4), which play
          important roles in neuronal differentiation, plasticity
          and memory. HuB is also expressed in gonads. Hu-antigen
          R (HuR or ELAV-1 or HuA) is the ubiquitously expressed
          Hu family member. It has a variety of biological
          functions mostly related to the regulation of cellular
          response to DNA damage and other types of stress. Hu
          proteins perform their cytoplasmic and nuclear
          molecular functions by coordinately regulating
          functionally related mRNAs. In the cytoplasm, Hu
          proteins recognize and bind to AU-rich RNA elements
          (AREs) in the 3' untranslated regions (UTRs) of certain
          target mRNAs, such as GAP-43, vascular epithelial
          growth factor (VEGF), the glucose transporter GLUT1,
          eotaxin and c-fos, and stabilize those ARE-containing
          mRNAs. They also bind and regulate the translation of
          some target mRNAs, such as neurofilament M, GLUT1, and
          p27. In the nucleus, Hu proteins function as regulators
          of polyadenylation and alternative splicing. Each Hu
          protein contains three RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). RRM1 and RRM2 may
          cooperate in binding to an ARE. RRM3 may help to
          maintain the stability of the RNA-protein complex, and
          might also bind to poly(A) tails or be involved in
          protein-protein interactions. .
          Length = 78

 Score = 40.4 bits (95), Expect = 5e-06
 Identities = 17/41 (41%), Positives = 26/41 (63%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          +FV  +P   DE+ L ++FS +G V N+ V+RD  T + KG
Sbjct: 4  IFVYNLPPDADESLLWQLFSPFGAVTNVKVIRDLTTNKCKG 44


>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins
          family, Drosophila sex-lethal (SXL), and similar
          proteins.  This subfamily corresponds to the RRM1 of Hu
          proteins and SXL. The Hu proteins family represents a
          group of RNA-binding proteins involved in diverse
          biological processes. Since the Hu proteins share high
          homology with the Drosophila embryonic lethal abnormal
          vision (ELAV) protein, the Hu family is sometimes
          referred to as the ELAV family. Drosophila ELAV is
          exclusively expressed in neurons and is required for
          the correct differentiation and survival of neurons in
          flies. The neuronal members of the Hu family include
          Hu-antigen B (HuB or ELAV-2 or Hel-N1), Hu-antigen C
          (HuC or ELAV-3 or PLE21), and Hu-antigen D (HuD or
          ELAV-4), which play important roles in neuronal
          differentiation, plasticity and memory. HuB is also
          expressed in gonads. Hu-antigen R (HuR or ELAV-1 or
          HuA) is ubiquitously expressed Hu family member. It has
          a variety of biological functions mostly related to the
          regulation of cellular response to DNA damage and other
          types of stress. Hu proteins perform their cytoplasmic
          and nuclear molecular functions by coordinately
          regulating functionally related mRNAs. In the
          cytoplasm, Hu proteins recognize and bind to AU-rich
          RNA elements (AREs) in the 3' untranslated regions
          (UTRs) of certain target mRNAs, such as GAP-43,
          vascular epithelial growth factor (VEGF), the glucose
          transporter GLUT1, eotaxin and c-fos, and stabilize
          those ARE-containing mRNAs. They also bind and regulate
          the translation of some target mRNAs, such as
          neurofilament M, GLUT1, and p27. In the nucleus, Hu
          proteins function as regulators of polyadenylation and
          alternative splicing. Each Hu protein contains three
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          RRM1 and RRM2 may cooperate in binding to an ARE. RRM3
          may help to maintain the stability of the RNA-protein
          complex, and might also bind to poly(A) tails or be
          involved in protein-protein interactions. This family
          also includes the sex-lethal protein (SXL) from
          Drosophila melanogaster. SXL governs sexual
          differentiation and X chromosome dosage compensation in
          flies. It induces female-specific alternative splicing
          of the transformer (tra) pre-mRNA by binding to the tra
          uridine-rich polypyrimidine tract at the
          non-sex-specific 3' splice site during the
          sex-determination process. SXL binds to its own
          pre-mRNA and promotes female-specific alternative
          splicing. It contains an N-terminal Gly/Asn-rich domain
          that may be responsible for the protein-protein
          interaction, and tandem RRMs that show high preference
          to bind single-stranded, uridine-rich target RNA
          transcripts. .
          Length = 77

 Score = 40.0 bits (94), Expect = 5e-06
 Identities = 14/42 (33%), Positives = 25/42 (59%)

Query: 32 VGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          V  +P+ M + +L  +F   G + +  ++RD++TGQS G  F
Sbjct: 5  VNYLPQDMTQEELRSLFEAIGPIESCKIVRDRITGQSLGYGF 46


>gnl|CDD|240926 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in vertebrate
          heterogeneous nuclear ribonucleoprotein R (hnRNP R).
          This subgroup corresponds to the RRM1 of hnRNP R, which
          is a ubiquitously expressed nuclear RNA-binding protein
          that specifically binds mRNAs with a preference for
          poly(U) stretches. Upon binding of RNA, hnRNP R forms
          oligomers, most probably dimers. hnRNP R has been
          implicated in mRNA processing and mRNA transport, and
          also acts as a regulator to modify binding to ribosomes
          and RNA translation. It is predominantly located in
          axons of motor neurons and to a much lower degree in
          sensory axons. In axons of motor neurons, it also
          functions as a cytosolic protein and interacts with
          wild type of survival motor neuron (SMN) proteins
          directly, further providing a molecular link between
          SMN and the spliceosome. Moreover, hnRNP R plays an
          important role in neural differentiation and
          development, and in retinal development and
          light-elicited cellular activities. hnRNP R contains an
          acidic auxiliary N-terminal region, followed by two
          well defined and one degenerated RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a C-terminal RGG
          motif; it binds RNA through its RRM domains. .
          Length = 79

 Score = 40.3 bits (94), Expect = 6e-06
 Identities = 15/45 (33%), Positives = 32/45 (71%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          ++FVG+IPR + E +L  +F + G ++++ ++ D ++GQ++G  F
Sbjct: 3  EVFVGKIPRDLYEDELVPLFEKAGPIWDLRLMMDPLSGQNRGYAF 47


>gnl|CDD|241219 cd12775, RRM2_HuB, RNA recognition motif 2 in vertebrate
          Hu-antigen B (HuB).  This subgroup corresponds to the
          RRM2 of HuB, also termed ELAV-like protein 2 (ELAV-2),
          or ELAV-like neuronal protein 1, or nervous
          system-specific RNA-binding protein Hel-N1 (Hel-N1),
          one of the neuronal members of the Hu family. The
          neuronal Hu proteins play important roles in neuronal
          differentiation, plasticity and memory. HuB is also
          expressed in gonads. It is up-regulated during neuronal
          differentiation of embryonic carcinoma P19 cells. Like
          other Hu proteins, HuB contains three RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains). RRM1 and RRM2 may
          cooperate in binding to an AU-rich RNA element (ARE).
          RRM3 may help to maintain the stability of the
          RNA-protein complex, and might also bind to poly(A)
          tails or be involved in protein-protein interactions. .
          Length = 90

 Score = 40.2 bits (93), Expect = 7e-06
 Identities = 17/44 (38%), Positives = 31/44 (70%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          ++V  +P++M + +L ++FS+YGR+    +L D+VTG S+G  F
Sbjct: 8  LYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGF 51


>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I
          polyadenylate-binding proteins.  This subfamily
          corresponds to the RRM1 of type I poly(A)-binding
          proteins (PABPs), highly conserved proteins that bind
          to the poly(A) tail present at the 3' ends of most
          eukaryotic mRNAs. They have been implicated in the
          regulation of poly(A) tail length during the
          polyadenylation reaction, translation initiation, mRNA
          stabilization by influencing the rate of deadenylation
          and inhibition of mRNA decapping. The family represents
          type I polyadenylate-binding proteins (PABPs),
          including polyadenylate-binding protein 1 (PABP-1 or
          PABPC1), polyadenylate-binding protein 3 (PABP-3 or
          PABPC3), polyadenylate-binding protein 4 (PABP-4 or
          APP-1 or iPABP), polyadenylate-binding protein 5
          (PABP-5 or PABPC5), polyadenylate-binding protein
          1-like (PABP-1-like or PABPC1L), polyadenylate-binding
          protein 1-like 2 (PABPC1L2 or RBM32),
          polyadenylate-binding protein 4-like (PABP-4-like or
          PABPC4L), yeast polyadenylate-binding protein,
          cytoplasmic and nuclear (PABP or ACBP-67), and similar
          proteins. PABP-1 is a ubiquitously expressed
          multifunctional protein that may play a role in 3' end
          formation of mRNA, translation initiation, mRNA
          stabilization, protection of poly(A) from nuclease
          activity, mRNA deadenylation, inhibition of mRNA
          decapping, and mRNP maturation. Although PABP-1 is
          thought to be a cytoplasmic protein, it is also found
          in the nucleus. PABP-1 may be involved in
          nucleocytoplasmic trafficking and utilization of mRNP
          particles. PABP-1 contains four copies of RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains), a
          less well conserved linker region, and a proline-rich
          C-terminal conserved domain (CTD). PABP-3 is a
          testis-specific poly(A)-binding protein specifically
          expressed in round spermatids. It is mainly found in
          mammalian and may play an important role in the
          testis-specific regulation of mRNA homeostasis. PABP-3
          shows significant sequence similarity to PABP-1.
          However, it binds to poly(A) with a lower affinity than
          PABP-1. Moreover, PABP-1 possesses an A-rich sequence
          in its 5'-UTR and allows binding of PABP and blockage
          of translation of its own mRNA. In contrast, PABP-3
          lacks the A-rich sequence in its 5'-UTR. PABP-4 is an
          inducible poly(A)-binding protein (iPABP) that is
          primarily localized to the cytoplasm. It shows
          significant sequence similarity to PABP-1 as well. The
          RNA binding properties of PABP-1 and PABP-4 appear to
          be identical. PABP-5 is encoded by PABPC5 gene within
          the X-specific subinterval, and expressed in fetal
          brain and in a range of adult tissues in mammals, such
          as ovary and testis. It may play an important role in
          germ cell development. Moreover, unlike other PABPs,
          PABP-5 contains only four RRMs, but lacks both the
          linker region and the CTD. PABP-1-like and PABP-1-like
          2 are the orthologs of PABP-1. PABP-4-like is the
          ortholog of PABP-5. Their cellular functions remain
          unclear. The family also includes yeast PABP, a
          conserved poly(A) binding protein containing poly(A)
          tails that can be attached to the 3'-ends of mRNAs. The
          yeast PABP and its homologs may play important roles in
          the initiation of translation and in mRNA decay. Like
          vertebrate PABP-1, the yeast PABP contains four RRMs, a
          linker region, and a proline-rich CTD as well. The
          first two RRMs are mainly responsible for specific
          binding to poly(A). The proline-rich region may be
          involved in protein-protein interactions. .
          Length = 80

 Score = 39.8 bits (94), Expect = 7e-06
 Identities = 16/40 (40%), Positives = 24/40 (60%)

Query: 31 FVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          +VG +   + EA L ++FS  G V +I V RD +T +S G
Sbjct: 3  YVGDLHPDVTEAMLYEIFSPAGPVLSIRVCRDLITRRSLG 42


>gnl|CDD|241023 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in heterogeneous
          nuclear ribonucleoprotein A0 (hnRNP A0) and similar
          proteins.  This subgroup corresponds to the RRM2 of
          hnRNP A0, a low abundance hnRNP protein that has been
          implicated in mRNA stability in mammalian cells. It has
          been identified as the substrate for MAPKAP-K2 and may
          be involved in the lipopolysaccharide (LPS)-induced
          post-transcriptional regulation of tumor necrosis
          factor-alpha (TNF-alpha), cyclooxygenase 2 (COX-2) and
          macrophage inflammatory protein 2 (MIP-2). hnRNP A0
          contains two RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), followed by a long glycine-rich region at the
          C-terminus. .
          Length = 80

 Score = 39.5 bits (92), Expect = 1e-05
 Identities = 18/42 (42%), Positives = 27/42 (64%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          K+FVG +   + E DLT+ FS++G V    V+ DK TG+ +G
Sbjct: 1  KLFVGGLKGDVGEGDLTEHFSQFGPVEKAEVIADKQTGKKRG 42


>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear
          ribonucleoprotein 70 kDa (U1-70K) and similar proteins.
           This subfamily corresponds to the RRM of U1-70K, also
          termed snRNP70, a key component of the U1 snRNP
          complex, which is one of the key factors facilitating
          the splicing of pre-mRNA via interaction at the 5'
          splice site, and is involved in regulation of
          polyadenylation of some viral and cellular genes,
          enhancing or inhibiting efficient poly(A) site usage.
          U1-70K plays an essential role in targeting the U1
          snRNP to the 5' splice site through protein-protein
          interactions with regulatory RNA-binding splicing
          factors, such as the RS protein ASF/SF2. Moreover,
          U1-70K protein can specifically bind to stem-loop I of
          the U1 small nuclear RNA (U1 snRNA) contained in the U1
          snRNP complex. It also mediates the binding of U1C,
          another U1-specific protein, to the U1 snRNP complex.
          U1-70K contains a conserved RNA recognition motif
          (RRM), also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), followed by an adjacent
          glycine-rich region at the N-terminal half, and two
          serine/arginine-rich (SR) domains at the C-terminal
          half. The RRM is responsible for the binding of
          stem-loop I of U1 snRNA molecule. Additionally, the
          most prominent immunodominant region that can be
          recognized by auto-antibodies from autoimmune patients
          may be located within the RRM. The SR domains are
          involved in protein-protein interaction with SR
          proteins that mediate 5' splice site recognition. For
          instance, the first SR domain is necessary and
          sufficient for ASF/SF2 Binding. The family also
          includes Drosophila U1-70K that is an essential
          splicing factor required for viability in flies, but
          its SR domain is dispensable. The yeast U1-70k doesn't
          contain easily recognizable SR domains and shows low
          sequence similarity in the RRM region with other U1-70k
          proteins and therefore not included in this family. The
          RRM domain is dispensable for yeast U1-70K function.
          Length = 91

 Score = 39.5 bits (93), Expect = 1e-05
 Identities = 16/44 (36%), Positives = 26/44 (59%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          +FV ++     E+ L + F EYG +  I ++RDK TG+ +G  F
Sbjct: 4  LFVARLNYDTTESKLRREFEEYGPIKRIRLVRDKKTGKPRGYAF 47


>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large
          nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa
          subunit (U2AF65) and similar proteins.  This subfamily
          corresponds to the RRM2 of U2AF65 and dU2AF50. U2AF65,
          also termed U2AF2, is the large subunit of U2 small
          nuclear ribonucleoprotein (snRNP) auxiliary factor
          (U2AF), which has been implicated in the recruitment of
          U2 snRNP to pre-mRNAs and is a highly conserved
          heterodimer composed of large and small subunits.
          U2AF65 specifically recognizes the intron
          polypyrimidine tract upstream of the 3' splice site and
          promotes binding of U2 snRNP to the pre-mRNA
          branchpoint. U2AF65 also plays an important role in the
          nuclear export of mRNA. It facilitates the formation of
          a messenger ribonucleoprotein export complex,
          containing both the NXF1 receptor and the RNA
          substrate. Moreover, U2AF65 interacts directly and
          specifically with expanded CAG RNA, and serves as an
          adaptor to link expanded CAG RNA to NXF1 for RNA
          export. U2AF65 contains an N-terminal RS domain rich in
          arginine and serine, followed by a proline-rich segment
          and three C-terminal RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). The N-terminal RS domain
          stabilizes the interaction of U2 snRNP with the branch
          point (BP) by contacting the branch region, and further
          promotes base pair interactions between U2 snRNA and
          the BP. The proline-rich segment mediates
          protein-protein interactions with the RRM domain of the
          small U2AF subunit (U2AF35 or U2AF1). The RRM1 and RRM2
          are sufficient for specific RNA binding, while RRM3 is
          responsible for protein-protein interactions. The
          family also includes Splicing factor U2AF 50 kDa
          subunit (dU2AF50), the Drosophila ortholog of U2AF65.
          dU2AF50 functions as an essential pre-mRNA splicing
          factor in flies. It associates with intronless mRNAs
          and plays a significant and unexpected role in the
          nuclear export of a large number of intronless mRNAs.
          Length = 77

 Score = 39.1 bits (92), Expect = 1e-05
 Identities = 14/45 (31%), Positives = 27/45 (60%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          K+F+G +P  + E  + ++   +G++   N+++D  TG SKG  F
Sbjct: 2  KIFIGGLPNYLSEDQVKELLESFGKLKAFNLVKDSATGLSKGYAF 46


>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor.  This
           model describes the sex-lethal family of splicing
           factors found in Dipteran insects. The sex-lethal
           phenotype, however, may be limited to the Melanogasters
           and closely related species. In Drosophila the protein
           acts as an inhibitor of splicing. This subfamily is most
           closely related to the ELAV/HUD subfamily of splicing
           factors (TIGR01661).
          Length = 346

 Score = 41.2 bits (96), Expect = 1e-05
 Identities = 16/44 (36%), Positives = 29/44 (65%)

Query: 30  MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
           ++V  +PR++ +  L  +F +YG++   N+LRDK+TG  +G  F
Sbjct: 196 LYVTNLPRTITDDQLDTIFGKYGQIVQKNILRDKLTGTPRGVAF 239



 Score = 26.9 bits (59), Expect = 1.4
 Identities = 13/44 (29%), Positives = 22/44 (50%)

Query: 30  MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
           + V  +P+ M + +L  +F   G +    ++RD  TG S G  F
Sbjct: 110 LIVNYLPQDMTDRELYALFRTIGPINTCRIMRDYKTGYSFGYAF 153


>gnl|CDD|240690 cd12244, RRM2_MSSP, RNA recognition motif 2 in the c-myc gene
          single-strand binding proteins (MSSP) family.  This
          subfamily corresponds to the RRM2 of c-myc gene
          single-strand binding proteins (MSSP) family, including
          single-stranded DNA-binding protein MSSP-1 (also termed
          RBMS1 or SCR2) and MSSP-2 (also termed RBMS2 or SCR3).
          All MSSP family members contain two RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), both of which are
          responsible for the specific DNA binding activity.
          Both, MSSP-1 and -2, have been identified as protein
          factors binding to a putative DNA replication
          origin/transcriptional enhancer sequence present
          upstream from the human c-myc gene in both single- and
          double-stranded forms. Thus they have been implied in
          regulating DNA replication, transcription, apoptosis
          induction, and cell-cycle movement, via the interaction
          with C-MYC, the product of protooncogene c-myc.
          Moreover, they family includes a new member termed
          RNA-binding motif, single-stranded-interacting protein
          3 (RBMS3), which is not a transcriptional regulator.
          RBMS3 binds with high affinity to A/U-rich stretches of
          RNA, and to A/T-rich DNA sequences, and functions as a
          regulator of cytoplasmic activity. In addition, a
          putative meiosis-specific RNA-binding protein termed
          sporulation-specific protein 5 (SPO5, or meiotic
          RNA-binding protein 1, or meiotically up-regulated gene
          12 protein), encoded by Schizosaccharomyces pombe
          Spo5/Mug12 gene, is also included in this family. SPO5
          is a novel meiosis I regulator that may function in the
          vicinity of the Mei2 dot. .
          Length = 79

 Score = 39.3 bits (92), Expect = 1e-05
 Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          +++  +P  MDE DL  M   YG+V +  +LRD   GQS+G
Sbjct: 3  LYISNLPLHMDEQDLETMLKPYGQVISTRILRDS-KGQSRG 42


>gnl|CDD|241079 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 in CUGBP
          Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6
          and similar proteins.  This subgroup corresponds to the
          RRM2 of CELF-3, CELF-4, CELF-5, and CELF-6, all of
          which belong to the CUGBP1 and ETR-3-like factors
          (CELF) or BRUNOL (Bruno-like) family of RNA-binding
          proteins that display dual nuclear and cytoplasmic
          localizations and have been implicated in the
          regulation of pre-mRNA splicing and in the control of
          mRNA translation and deadenylation. CELF-3, expressed
          in brain and testis only, is also known as bruno-like
          protein 1 (BRUNOL-1), or CAG repeat protein 4, or
          CUG-BP- and ETR-3-like factor 3, or embryonic lethal
          abnormal vision (ELAV)-type RNA-binding protein 1
          (ETR-1), or expanded repeat domain protein CAG/CTG 4,
          or trinucleotide repeat-containing gene 4 protein
          (TNRC4). It plays an important role in the pathogenesis
          of tauopathies. CELF-3 contains three highly conserved
          RNA recognition motifs (RRMs), also known as RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains):
          two consecutive RRMs (RRM1 and RRM2) situated in the
          N-terminal region followed by a linker region and the
          third RRM (RRM3) close to the C-terminus of the
          protein. The effect of CELF-3 on tau splicing is
          mediated mainly by the RNA-binding activity of RRM2.
          The divergent linker region might mediate the
          interaction of CELF-3 with other proteins regulating
          its activity or involved in target recognition. CELF-4,
          being highly expressed throughout the brain and in
          glandular tissues, moderately expressed in heart,
          skeletal muscle, and liver, is also known as bruno-like
          protein 4 (BRUNOL-4), or CUG-BP- and ETR-3-like factor
          4. Like CELF-3, CELF-4 also contain three highly
          conserved RRMs. The splicing activation or repression
          activity of CELF-4 on some specific substrates is
          mediated by its RRM1/RRM2. On the other hand, both RRM1
          and RRM2 of CELF-4 can activate cardiac troponin T
          (cTNT) exon 5 inclusion. CELF-5, expressed in brain, is
          also known as bruno-like protein 5 (BRUNOL-5), or
          CUG-BP- and ETR-3-like factor 5. Although its
          biological role remains unclear, CELF-5 shares same
          domain architecture with CELF-3. CELF-6, being strongly
          expressed in kidney, brain, and testis, is also known
          as bruno-like protein 6 (BRUNOL-6), or CUG-BP- and
          ETR-3-like factor 6. It activates exon inclusion of a
          cardiac troponin T minigene in transient transfection
          assays in a muscle-specific splicing enhancer
          (MSE)-dependent manner and can activate inclusion via
          multiple copies of a single element, MSE2. CELF-6 also
          promotes skipping of exon 11 of insulin receptor, a
          known target of CELF activity that is expressed in
          kidney. In addition to three highly conserved RRMs,
          CELF-6 also possesses numerous potential
          phosphorylation sites, a potential nuclear localization
          signal (NLS) at the C terminus, and an alanine-rich
          region within the divergent linker region. .
          Length = 81

 Score = 38.6 bits (90), Expect = 2e-05
 Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 10/62 (16%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIFEAAFLKI-----ARA 83
          K+FVG + +   E D+ ++F  +G +    +LR    G SKG     AF+K      A+A
Sbjct: 3  KLFVGMLSKQQTEDDVRRLFEPFGTIEECTILRGP-DGNSKG----CAFVKFSSHAEAQA 57

Query: 84 AI 85
          AI
Sbjct: 58 AI 59


>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein
          RBM8A, RBM8B nd similar proteins.  This subfamily
          corresponds to the RRM of RBM8, also termed binder of
          OVCA1-1 (BOV-1), or RNA-binding protein Y14, which is
          one of the components of the exon-exon junction complex
          (EJC). It has two isoforms, RBM8A and RBM8B, both of
          which are identical except that RBM8B is 16 amino acids
          shorter at its N-terminus. RBM8, together with other
          EJC components (such as Magoh, Aly/REF, RNPS1, Srm160,
          and Upf3), plays critical roles in postsplicing
          processing, including nuclear export and cytoplasmic
          localization of the mRNA, and the nonsense-mediated
          mRNA decay (NMD) surveillance process. RBM8 binds to
          mRNA 20-24 nucleotides upstream of a spliced exon-exon
          junction. It is also involved in spliced mRNA nuclear
          export, and the process of nonsense-mediated decay of
          mRNAs with premature stop codons. RBM8 forms a specific
          heterodimer complex with the EJC protein Magoh which
          then associates with Aly/REF, RNPS1, DEK, and SRm160 on
          the spliced mRNA, and inhibits ATP turnover by
          eIF4AIII, thereby trapping the EJC core onto RNA. RBM8
          contains an N-terminal putative bipartite nuclear
          localization signal, one RNA recognition motif (RRM),
          also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), in the central region, and
          a C-terminal serine-arginine rich region (SR domain)
          and glycine-arginine rich region (RG domain). .
          Length = 88

 Score = 38.7 bits (91), Expect = 3e-05
 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 31 FVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF-EAAFLKIARAAIE 86
          FV  +     E D+   F+E+G + N+++  D+ TG  KG    E    K A+AAIE
Sbjct: 10 FVTGVHEEAQEEDVHDKFAEFGEIKNLHLNLDRRTGFVKGYALIEYETKKEAQAAIE 66


>gnl|CDD|241083 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 in CUGBP
          Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6
          and similar proteins.  This subgroup corresponds to the
          RRM3 of CELF-3, CELF-4, CELF-5, and CELF-6, all of
          which belong to the CUGBP1 and ETR-3-like factors
          (CELF) or BRUNOL (Bruno-like) family of RNA-binding
          proteins that display dual nuclear and cytoplasmic
          localizations and have been implicated in the
          regulation of pre-mRNA splicing and in the control of
          mRNA translation and deadenylation. CELF-3, expressed
          in brain and testis only, is also known as bruno-like
          protein 1 (BRUNOL-1), or CAG repeat protein 4, or
          CUG-BP- and ETR-3-like factor 3, or embryonic lethal
          abnormal vision (ELAV)-type RNA-binding protein 1
          (ETR-1), or expanded repeat domain protein CAG/CTG 4,
          or trinucleotide repeat-containing gene 4 protein
          (TNRC4). It plays an important role in the pathogenesis
          of tauopathies. CELF-3 contains three highly conserved
          RNA recognition motifs (RRMs), also known as RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains):
          two consecutive RRMs (RRM1 and RRM2) situated in the
          N-terminal region followed by a linker region and the
          third RRM (RRM3) close to the C-terminus of the
          protein.The effect of CELF-3 on tau splicing is
          mediated mainly by the RNA-binding activity of RRM2.
          The divergent linker region might mediate the
          interaction of CELF-3 with other proteins regulating
          its activity or involved in target recognition. CELF-4,
          highly expressed throughout the brain and in glandular
          tissues, moderately expressed in heart, skeletal
          muscle, and liver, is also known as bruno-like protein
          4 (BRUNOL-4), or CUG-BP- and ETR-3-like factor 4. Like
          CELF-3, CELF-4 also contains three highly conserved
          RRMs. The splicing activation or repression activity of
          CELF-4 on some specific substrates is mediated by its
          RRM1/RRM2. Both, RRM1 and RRM2 of CELF-4, can activate
          cardiac troponin T (cTNT) exon 5 inclusion. CELF-5,
          expressed in brain, is also known as bruno-like protein
          5 (BRUNOL-5), or CUG-BP- and ETR-3-like factor 5.
          Although its biological role remains unclear, CELF-5
          shares same domain architecture with CELF-3. CELF-6,
          strongly expressed in kidney, brain, and testis, is
          also known as bruno-like protein 6 (BRUNOL-6), or
          CUG-BP- and ETR-3-like factor 6. It activates exon
          inclusion of a cardiac troponin T minigene in transient
          transfection assays in an muscle-specific splicing
          enhancer (MSE)-dependent manner and can activate
          inclusion via multiple copies of a single element,
          MSE2. CELF-6 also promotes skipping of exon 11 of
          insulin receptor, a known target of CELF activity that
          is expressed in kidney. In addition to three highly
          conserved RRMs, CELF-6 also possesses numerous
          potential phosphorylation sites, a potential nuclear
          localization signal (NLS) at the C terminus, and an
          alanine-rich region within the divergent linker region.
          .
          Length = 79

 Score = 38.3 bits (89), Expect = 3e-05
 Identities = 15/45 (33%), Positives = 26/45 (57%)

Query: 25 PDFIKMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSK 69
          P+   +F+  +P+   +A+L +MF  +G V +  V  D+ T QSK
Sbjct: 2  PEGCNLFIYHLPQEFGDAELMQMFLPFGNVISAKVFVDRATNQSK 46


>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins
          family.  This subfamily corresponds to the RRM1 of the
          Hu proteins family which represents a group of
          RNA-binding proteins involved in diverse biological
          processes. Since the Hu proteins share high homology
          with the Drosophila embryonic lethal abnormal vision
          (ELAV) protein, the Hu family is sometimes referred to
          as the ELAV family. Drosophila ELAV is exclusively
          expressed in neurons and is required for the correct
          differentiation and survival of neurons in flies. The
          neuronal members of the Hu family include Hu-antigen B
          (HuB or ELAV-2 or Hel-N1), Hu-antigen C (HuC or ELAV-3
          or PLE21), and Hu-antigen D (HuD or ELAV-4), which play
          important roles in neuronal differentiation, plasticity
          and memory. HuB is also expressed in gonads. Hu-antigen
          R (HuR or ELAV-1 or HuA) is the ubiquitously expressed
          Hu family member. It has a variety of biological
          functions mostly related to the regulation of cellular
          response to DNA damage and other types of stress. HuR
          has an anti-apoptotic function during early cell stress
          response. It binds to mRNAs and enhances the expression
          of several anti-apoptotic proteins, such as p21waf1,
          p53, and prothymosin alpha. HuR also has pro-apoptotic
          function by promoting apoptosis when cell death is
          unavoidable. Furthermore, HuR may be important in
          muscle differentiation, adipogenesis, suppression of
          inflammatory response and modulation of gene expression
          in response to chronic ethanol exposure and amino acid
          starvation. Hu proteins perform their cytoplasmic and
          nuclear molecular functions by coordinately regulating
          functionally related mRNAs. In the cytoplasm, Hu
          proteins recognize and bind to AU-rich RNA elements
          (AREs) in the 3' untranslated regions (UTRs) of certain
          target mRNAs, such as GAP-43, vascular epithelial
          growth factor (VEGF), the glucose transporter GLUT1,
          eotaxin and c-fos, and stabilize those ARE-containing
          mRNAs. They also bind and regulate the translation of
          some target mRNAs, such as neurofilament M, GLUT1, and
          p27. In the nucleus, Hu proteins function as regulators
          of polyadenylation and alternative splicing. Each Hu
          protein contains three RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). RRM1 and RRM2 may
          cooperate in binding to an ARE. RRM3 may help to
          maintain the stability of the RNA-protein complex, and
          might also bind to poly(A) tails or be involved in
          protein-protein interactions. .
          Length = 78

 Score = 38.2 bits (89), Expect = 3e-05
 Identities = 16/44 (36%), Positives = 28/44 (63%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          + V  +P++M + ++  +FS  G + +  ++RDKVTGQS G  F
Sbjct: 4  LIVNYLPQNMTQDEIRSLFSSIGEIESCKLIRDKVTGQSLGYGF 47


>gnl|CDD|241062 cd12618, RRM2_TIA1, RNA recognition motif 2 in nucleolysin TIA-1
          isoform p40 (p40-TIA-1) and similar proteins.  This
          subgroup corresponds to the RRM2 of p40-TIA-1, the
          40-kDa isoform of T-cell-restricted intracellular
          antigen-1 (TIA-1), and a cytotoxic granule-associated
          RNA-binding protein mainly found in the granules of
          cytotoxic lymphocytes. TIA-1 can be phosphorylated by a
          serine/threonine kinase that is activated during
          Fas-mediated apoptosis, and function as the granule
          component responsible for inducing apoptosis in
          cytolytic lymphocyte (CTL) targets. It is composed of
          three N-terminal highly homologous RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), and a
          glutamine-rich C-terminal auxiliary domain containing a
          lysosome-targeting motif. TIA-1 interacts with RNAs
          containing short stretches of uridylates and its RRM2
          can mediate the specific binding to uridylate-rich
          RNAs. .
          Length = 80

 Score = 38.1 bits (88), Expect = 4e-05
 Identities = 17/50 (34%), Positives = 29/50 (58%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIFEAAFLK 79
          +FVG +   +   D+   F+ +GR+ +  V++D  TG+SKG  F + F K
Sbjct: 4  VFVGDLSPEITTDDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNK 53


>gnl|CDD|241025 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 in heterogeneous
          nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and
          similar proteins.  This subgroup corresponds to the
          RRM2 of hnRNP A2/B1, an RNA trafficking response
          element-binding protein that interacts with the hnRNP
          A2 response element (A2RE). Many mRNAs, such as myelin
          basic protein (MBP), myelin-associated oligodendrocytic
          basic protein (MOBP), carboxyanhydrase II (CAII),
          microtubule-associated protein tau, and amyloid
          precursor protein (APP) are trafficked by hnRNP A2/B1.
          hnRNP A2/B1 also functions as a splicing factor that
          regulates alternative splicing of the tumor
          suppressors, such as BIN1, WWOX, the antiapoptotic
          proteins c-FLIP and caspase-9B, the insulin receptor
          (IR), and the RON proto-oncogene among others.
          Overexpression of hnRNP A2/B1 has been described in
          many cancers. It functions as a nuclear matrix protein
          involving in RNA synthesis and the regulation of
          cellular migration through alternatively splicing
          pre-mRNA. It may play a role in tumor cell
          differentiation. hnRNP A2/B1 contains two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          followed by a long glycine-rich region at the
          C-terminus. .
          Length = 80

 Score = 38.1 bits (88), Expect = 4e-05
 Identities = 16/45 (35%), Positives = 26/45 (57%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          K+FVG I    +E  L   F EYG++  I ++ D+ +G+ +G  F
Sbjct: 2  KLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGF 46


>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General
           function prediction only].
          Length = 306

 Score = 39.9 bits (92), Expect = 4e-05
 Identities = 17/45 (37%), Positives = 30/45 (66%)

Query: 29  KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
            +FVG +P  + E DL ++F ++G V  + ++RD+ TG+S+G  F
Sbjct: 117 TLFVGNLPYDVTEEDLRELFKKFGPVKRVRLVRDRETGKSRGFAF 161


>gnl|CDD|240927 cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in vertebrate
          heterogeneous nuclear ribonucleoprotein Q (hnRNP Q). 
          This subgroup corresponds to the RRM1 of hnRNP Q, also
          termed glycine- and tyrosine-rich RNA-binding protein
          (GRY-RBP), or NS1-associated protein 1 (NASP1), or
          synaptotagmin-binding, cytoplasmic RNA-interacting
          protein (SYNCRIP). It is a ubiquitously expressed
          nuclear RNA-binding protein identified as a component
          of the spliceosome complex, as well as a component of
          the apobec-1 editosome. As an alternatively spliced
          version of NSAP, it acts as an interaction partner of a
          multifunctional protein required for viral replication,
          and is implicated in the regulation of specific mRNA
          transport. hnRNP Q has also been identified as SYNCRIP,
          a dual functional protein participating in both viral
          RNA replication and translation. As a
          synaptotagmin-binding protein, hnRNP Q plays a putative
          role in organelle-based mRNA transport along the
          cytoskeleton. Moreover, hnRNP Q has been found in
          protein complexes involved in translationally coupled
          mRNA turnover and mRNA splicing. It functions as a
          wild-type survival motor neuron (SMN)-binding protein
          that may participate in pre-mRNA splicing and modulate
          mRNA transport along microtubuli. hnRNP Q contains an
          acidic auxiliary N-terminal region, followed by two
          well-defined and one degenerated RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a C-terminal RGG
          motif; hnRNP Q binds RNA through its RRM domains.
          Length = 79

 Score = 38.1 bits (88), Expect = 4e-05
 Identities = 15/45 (33%), Positives = 31/45 (68%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          ++FVG+IPR + E +L  +F + G ++++ ++ D +TG ++G  F
Sbjct: 3  EIFVGKIPRDLFEDELVPLFEKAGPIWDLRLMMDPLTGLNRGYAF 47


>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate
          RNA-binding protein RBM23, RBM39 and similar proteins. 
          This subfamily corresponds to the RRM2 of RBM39 (also
          termed HCC1), a nuclear autoantigen that contains an
          N-terminal arginine/serine rich (RS) motif and three
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          An octapeptide sequence called the RS-ERK motif is
          repeated six times in the RS region of RBM39. Although
          the cellular function of RBM23 remains unclear, it
          shows high sequence homology to RBM39 and contains two
          RRMs. It may possibly function as a pre-mRNA splicing
          factor. .
          Length = 73

 Score = 37.6 bits (88), Expect = 5e-05
 Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 1/58 (1%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF-EAAFLKIARAAIE 86
          ++VG +  ++ E DL  +F  +G +  + + RD  TG+SKG  F + A  + A+ A+E
Sbjct: 1  LYVGNLHFNITEDDLRGIFEPFGEIEFVQLQRDPETGRSKGYGFIQFADAEDAKKALE 58


>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in
          RNA-binding protein 19 (RBM19) and RNA recognition
          motif 2 found in multiple RNA-binding domain-containing
          protein 1 (MRD1).  This subfamily corresponds to the
          RRM3 of RBM19 and RRM2 of MRD1. RBM19, also termed
          RNA-binding domain-1 (RBD-1), is a nucleolar protein
          conserved in eukaryotes involved in ribosome biogenesis
          by processing rRNA and is essential for preimplantation
          development. It has a unique domain organization
          containing 6 conserved RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). MRD1 is encoded by a novel
          yeast gene MRD1 (multiple RNA-binding domain). It is
          well conserved in yeast and its homologs exist in all
          eukaryotes. MRD1 is present in the nucleolus and the
          nucleoplasm. It interacts with the 35 S precursor rRNA
          (pre-rRNA) and U3 small nucleolar RNAs (snoRNAs). It is
          essential for the initial processing at the A0-A2
          cleavage sites in the 35 S pre-rRNA. MRD1 contains 5
          conserved RRMs, which may play an important structural
          role in organizing specific rRNA processing events. .
          Length = 74

 Score = 37.7 bits (88), Expect = 5e-05
 Identities = 13/42 (30%), Positives = 26/42 (61%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          ++FV  +P +  E +L ++F  +G +  +++  DK T +SKG
Sbjct: 1  RLFVRNLPFTTTEEELRELFEAFGEISEVHLPLDKETKRSKG 42


>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in
          azoospermia-associated protein 1 (DAZAP1) and similar
          proteins.  This subfamily corresponds to the RRM2 of
          DAZAP1 or DAZ-associated protein 1, also termed
          proline-rich RNA binding protein (Prrp), a
          multi-functional ubiquitous RNA-binding protein
          expressed most abundantly in the testis and essential
          for normal cell growth, development, and
          spermatogenesis. DAZAP1 is a shuttling protein whose
          acetylated is predominantly nuclear and the
          nonacetylated form is in cytoplasm. DAZAP1 also
          functions as a translational regulator that activates
          translation in an mRNA-specific manner. DAZAP1 was
          initially identified as a binding partner of Deleted in
          Azoospermia (DAZ). It also interacts with numerous
          hnRNPs, including hnRNP U, hnRNP U like-1, hnRNPA1,
          hnRNPA/B, and hnRNP D, suggesting DAZAP1 might
          associate and cooperate with hnRNP particles to
          regulate adenylate-uridylate-rich elements (AU-rich
          element or ARE)-containing mRNAs. DAZAP1 contains two
          N-terminal RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), and a C-terminal proline-rich domain. .
          Length = 80

 Score = 37.3 bits (87), Expect = 6e-05
 Identities = 16/42 (38%), Positives = 26/42 (61%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          K+FVG +P ++ E DL K FS++G V  + V+ D    + +G
Sbjct: 4  KIFVGGLPPNVTETDLRKYFSQFGTVTEVVVMYDHEKKRPRG 45


>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2
          and similar proteins.  This subfamily corresponds to
          the RRM2 of yeast protein gar2, a novel nucleolar
          protein required for 18S rRNA and 40S ribosomal subunit
          accumulation. It shares similar domain architecture
          with nucleolin from vertebrates and NSR1 from
          Saccharomyces cerevisiae. The highly phosphorylated
          N-terminal domain of gar2 is made up of highly acidic
          regions separated from each other by basic sequences,
          and contains multiple phosphorylation sites. The
          central domain of gar2 contains two closely adjacent
          N-terminal RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains). The C-terminal RGG (or GAR) domain of gar2 is
          rich in glycine, arginine and phenylalanine residues. .
          Length = 73

 Score = 37.4 bits (87), Expect = 6e-05
 Identities = 13/41 (31%), Positives = 23/41 (56%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          +FVG +    DE  + + F EYG + ++ +  D  +G+ KG
Sbjct: 1  LFVGNLSFDADEDSIYEAFGEYGEISSVRLPTDPDSGRPKG 41


>gnl|CDD|241018 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in Deleted in
          azoospermia-associated protein 1 (DAZAP1) and similar
          proteins.  This subfamily corresponds to the RRM1 of
          DAZAP1 or DAZ-associated protein 1, also termed
          proline-rich RNA binding protein (Prrp), a
          multi-functional ubiquitous RNA-binding protein
          expressed most abundantly in the testis and essential
          for normal cell growth, development, and
          spermatogenesis. DAZAP1 is a shuttling protein whose
          acetylated form is predominantly nuclear and the
          nonacetylated form is in cytoplasm. It also functions
          as a translational regulator that activates translation
          in an mRNA-specific manner. DAZAP1 was initially
          identified as a binding partner of Deleted in
          Azoospermia (DAZ). It also interacts with numerous
          hnRNPs, including hnRNP U, hnRNP U like-1, hnRNPA1,
          hnRNPA/B, and hnRNP D, suggesting DAZAP1 might
          associate and cooperate with hnRNP particles to
          regulate adenylate-uridylate-rich elements (AU-rich
          element or ARE)-containing mRNAs. DAZAP1 contains two
          N-terminal RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), and a C-terminal proline-rich domain. .
          Length = 82

 Score = 37.5 bits (87), Expect = 6e-05
 Identities = 15/42 (35%), Positives = 26/42 (61%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          K+FVG +     +  L + FS+YG V +  +++DK T +S+G
Sbjct: 1  KLFVGGLSWETTQETLRRYFSQYGEVVDCVIMKDKTTNRSRG 42


>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate
          RNA-binding protein 39 (RBM39) and similar proteins.
          This subfamily corresponds to the RRM1 of RNA-binding
          protein 39 (RBM39), RNA-binding protein 23 (RBM23) and
          similar proteins. RBM39 (also termed HCC1) is a nuclear
          autoantigen that contains an N-terminal arginine/serine
          rich (RS) motif and three RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). An octapeptide sequence
          called the RS-ERK motif is repeated six times in the RS
          region of RBM39. Although the cellular function of
          RBM23 remains unclear, it shows high sequence homology
          to RBM39 and contains two RRMs. It may possibly
          function as a pre-mRNA splicing factor. .
          Length = 73

 Score = 37.2 bits (87), Expect = 7e-05
 Identities = 15/40 (37%), Positives = 27/40 (67%)

Query: 31 FVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          FV Q+   + E DL + FS+ G+V ++ ++RD+ + +SKG
Sbjct: 3  FVMQLSLKVRERDLYEFFSKAGKVRDVRIIRDRNSRRSKG 42


>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family.  This model
           represents a subfamily of RNA splicing factors including
           the Pad-1 protein (N. crassa), CAPER (M. musculus) and
           CC1.3 (H.sapiens). These proteins are characterized by
           an N-terminal arginine-rich, low complexity domain
           followed by three (or in the case of 4 H. sapiens
           paralogs, two) RNA recognition domains (rrm: pfam00706).
           These splicing factors are closely related to the U2AF
           splicing factor family (TIGR01642). A homologous gene
           from Plasmodium falciparum was identified in the course
           of the analysis of that genome at TIGR and was included
           in the seed.
          Length = 457

 Score = 39.1 bits (91), Expect = 8e-05
 Identities = 16/46 (34%), Positives = 32/46 (69%)

Query: 25  PDFIKMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
           P+F+K++VG +  ++ E +L ++F  +G + ++ + RD  TG+SKG
Sbjct: 184 PNFLKLYVGNLHFNITEQELRQIFEPFGDIEDVQLHRDPETGRSKG 229



 Score = 36.0 bits (83), Expect = 8e-04
 Identities = 15/50 (30%), Positives = 29/50 (58%)

Query: 21  EQPDPDFIKMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
            + + D   +FV Q+     E DL + FS+ G+V ++  ++D+ + +SKG
Sbjct: 83  TEAERDDRTVFVLQLALKARERDLYEFFSKVGKVRDVQCIKDRNSRRSKG 132


>gnl|CDD|241215 cd12771, RRM1_HuB, RNA recognition motif 1 in vertebrate
          Hu-antigen B (HuB).  This subgroup corresponds to the
          RRM1 of HuB, also termed ELAV-like protein 2 (ELAV-2),
          or ELAV-like neuronal protein 1, or nervous
          system-specific RNA-binding protein Hel-N1 (Hel-N1),
          one of the neuronal members of the Hu family. The
          neuronal Hu proteins play important roles in neuronal
          differentiation, plasticity and memory. HuB is also
          expressed in gonads and is up-regulated during neuronal
          differentiation of embryonic carcinoma P19 cells. Like
          other Hu proteins, HuB contains three RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains). RRM1 and RRM2 may
          cooperate in binding to an AU-rich RNA element (ARE).
          RRM3 may help to maintain the stability of the
          RNA-protein complex, and might also bind to poly(A)
          tails or be involved in protein-protein interactions. .
          Length = 83

 Score = 37.0 bits (85), Expect = 1e-04
 Identities = 15/44 (34%), Positives = 27/44 (61%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          + V  +P++M + +L  +F   G + +  ++RDK+TGQS G  F
Sbjct: 7  LIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGF 50


>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in
          granule-associated RNA binding proteins p40-TIA-1 and
          TIAR.  This subfamily corresponds to the RRM2 of
          nucleolysin TIA-1 isoform p40 (p40-TIA-1 or TIA-1) and
          nucleolysin TIA-1-related protein (TIAR), both of which
          are granule-associated RNA binding proteins involved in
          inducing apoptosis in cytotoxic lymphocyte (CTL) target
          cells. TIA-1 and TIAR share high sequence similarity.
          They are expressed in a wide variety of cell types.
          TIA-1 can be phosphorylated by a serine/threonine
          kinase that is activated during Fas-mediated apoptosis.
          TIAR is mainly localized in the nucleus of
          hematopoietic and nonhematopoietic cells. It is
          translocated from the nucleus to the cytoplasm in
          response to exogenous triggers of apoptosis. Both,
          TIA-1 and TIAR, bind specifically to poly(A) but not to
          poly(C) homopolymers. They are composed of three
          N-terminal highly homologous RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a glutamine-rich
          C-terminal auxiliary domain containing a
          lysosome-targeting motif. TIA-1 and TIAR interact with
          RNAs containing short stretches of uridylates and their
          RRM2 can mediate the specific binding to uridylate-rich
          RNAs. The C-terminal auxiliary domain may be
          responsible for interacting with other proteins. In
          addition, TIA-1 and TIAR share a potential serine
          protease-cleavage site (Phe-Val-Arg) localized at the
          junction between their RNA binding domains and their
          C-terminal auxiliary domains.
          Length = 75

 Score = 36.6 bits (85), Expect = 1e-04
 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIFEAAFLKIARAA 84
          +FVG +   +D   L   F+ +G + +  V++D  TG+SKG  F  +F+K   A 
Sbjct: 2  IFVGDLSPEIDTETLRAAFAPFGEISDARVVKDMQTGKSKGYGF-VSFVKKEDAE 55


>gnl|CDD|240829 cd12383, RRM_RBM42, RNA recognition motif in RNA-binding protein
          42 (RBM42) and similar proteins.  This subfamily
          corresponds to the RRM of RBM42 which has been
          identified as a heterogeneous nuclear ribonucleoprotein
          K (hnRNP K)-binding protein. It also directly binds the
          3' untranslated region of p21 mRNA that is one of the
          target mRNAs for hnRNP K. Both, hnRNP K and RBM42, are
          components of stress granules (SGs). Under nonstress
          conditions, RBM42 predominantly localizes within the
          nucleus and co-localizes with hnRNP K. Under stress
          conditions, hnRNP K and RBM42 form cytoplasmic foci
          where the SG marker TIAR localizes, and may play a role
          in the maintenance of cellular ATP level by protecting
          their target mRNAs. RBM42 contains an RNA recognition
          motif (RRM), also termed RBD (RNA binding domain) or
          RNP (ribonucleoprotein domain). .
          Length = 83

 Score = 36.4 bits (85), Expect = 1e-04
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 21 EQPDPDFIKMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          E P+ DF ++FVG +   + +  L + FS+Y       V+RDK TG+SKG
Sbjct: 1  EWPENDF-RIFVGDLGNEVTDEVLARAFSKYPSFQKAKVVRDKRTGKSKG 49


>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding
          protein 28 (RBM28) and similar proteins.  This
          subfamily corresponds to the RRM3 of RBM28 and Nop4p.
          RBM28 is a specific nucleolar component of the
          spliceosomal small nuclear ribonucleoproteins (snRNPs),
          possibly coordinating their transition through the
          nucleolus. It specifically associates with U1, U2, U4,
          U5, and U6 small nuclear RNAs (snRNAs), and may play a
          role in the maturation of both small nuclear and
          ribosomal RNAs. RBM28 has four RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and an extremely acidic
          region between RRM2 and RRM3. The family also includes
          nucleolar protein 4 (Nop4p or Nop77p) encoded by
          YPL043W from Saccharomyces cerevisiae. It is an
          essential nucleolar protein involved in processing and
          maturation of 27S pre-rRNA and biogenesis of 60S
          ribosomal subunits. Nop4p also contains four RRMs.  .
          Length = 82

 Score = 36.4 bits (85), Expect = 2e-04
 Identities = 16/43 (37%), Positives = 27/43 (62%)

Query: 31 FVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          F+  +P    E +L ++FS++G V    +++DK+TG SKG  F
Sbjct: 4  FIRNLPFDATEEELKELFSQFGEVKYARIVKDKLTGHSKGTAF 46


>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and
          CTD-associated factor 4 (SCAF4), SR-related and
          CTD-associated factor 8 (SCAF8) and similar proteins.
          This subfamily corresponds to the RRM in a new class of
          SCAFs (SR-like CTD-associated factors), including
          SCAF4, SCAF8 and similar proteins. The biological role
          of SCAF4 remains unclear, but it shows high sequence
          similarity to SCAF8 (also termed CDC5L
          complex-associated protein 7, or RNA-binding motif
          protein 16, or CTD-binding SR-like protein RA8). SCAF8
          is a nuclear matrix protein that interacts specifically
          with a highly serine-phosphorylated form of the
          carboxy-terminal domain (CTD) of the largest subunit of
          RNA polymerase II (pol II). The pol II CTD plays a role
          in coupling transcription and pre-mRNA processing. In
          addition, SCAF8 co-localizes primarily with
          transcription sites that are enriched in nuclear matrix
          fraction, which is known to contain proteins involved
          in pre-mRNA processing. Thus, SCAF8 may play a direct
          role in coupling with both, transcription and pre-mRNA
          processing, processes. SCAF8 and SCAF4 both contain a
          conserved N-terminal CTD-interacting domain (CID), an
          atypical RNA recognition motif (RRM), also termed RBD
          (RNA binding domain) or RNPs (ribonucleoprotein
          domain), and serine/arginine-rich motifs.
          Length = 77

 Score = 36.2 bits (84), Expect = 2e-04
 Identities = 9/31 (29%), Positives = 21/31 (67%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVL 60
          +++G + + + E DL  +F EYG + +I+++
Sbjct: 5  LWIGHLSKKVTEEDLKNLFEEYGEIQSIDMI 35


>gnl|CDD|241026 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in heterogeneous
          nuclear ribonucleoprotein A3 (hnRNP A3) and similar
          proteins.  This subgroup corresponds to the RRM2 of
          hnRNP A3, a novel RNA trafficking response
          element-binding protein that interacts with the hnRNP
          A2 response element (A2RE) independently of hnRNP A2
          and participates in the trafficking of A2RE-containing
          RNA. hnRNP A3 can shuttle between the nucleus and the
          cytoplasm. It contains two RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), followed by a long
          glycine-rich region at the C-terminus. .
          Length = 80

 Score = 36.1 bits (83), Expect = 2e-04
 Identities = 16/45 (35%), Positives = 26/45 (57%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          K+FVG I    +E  L   F +YG++  I V+ D+ +G+ +G  F
Sbjct: 2  KIFVGGIKEDTEEYHLRDYFEKYGKIETIEVMEDRQSGKKRGFAF 46


>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding
          protein 43 (TDP-43) and similar proteins.  This
          subfamily corresponds to the RRM1 of TDP-43 (also
          termed TARDBP), a ubiquitously expressed pathogenic
          protein whose normal function and abnormal aggregation
          are directly linked to the genetic disease cystic
          fibrosis, and two neurodegenerative disorders:
          frontotemporal lobar degeneration (FTLD) and
          amyotrophic lateral sclerosis (ALS). TDP-43 binds both
          DNA and RNA, and has been implicated in transcriptional
          repression, pre-mRNA splicing and translational
          regulation. TDP-43 is a dimeric protein with two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          and a C-terminal glycine-rich domain. The RRMs are
          responsible for DNA and RNA binding; they bind to TAR
          DNA and RNA sequences with UG-repeats. The glycine-rich
          domain can interact with the hnRNP family proteins to
          form the hnRNP-rich complex involved in splicing
          inhibition. It is also essential for the cystic
          fibrosis transmembrane conductance regulator (CFTR)
          exon 9-skipping activity. .
          Length = 77

 Score = 35.8 bits (83), Expect = 2e-04
 Identities = 16/42 (38%), Positives = 22/42 (52%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
           + V  +P    E DL   FS +G +  + V +D  TGQSKG
Sbjct: 1  DLIVLGLPWKTTEQDLKDYFSTFGELLMVQVKKDPKTGQSKG 42


>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein
          Musashi homologs Musashi-1, Musashi-2 and similar
          proteins.  This subfamily corresponds to the RRM2.in
          Musashi-1 (also termed Msi1), a neural RNA-binding
          protein putatively expressed in central nervous system
          (CNS) stem cells and neural progenitor cells, and
          associated with asymmetric divisions in neural
          progenitor cells. It is evolutionarily conserved from
          invertebrates to vertebrates. Musashi-1 is a homolog of
          Drosophila Musashi and Xenopus laevis nervous
          system-specific RNP protein-1 (Nrp-1). It has been
          implicated in the maintenance of the stem-cell state,
          differentiation, and tumorigenesis. It translationally
          regulates the expression of a mammalian numb gene by
          binding to the 3'-untranslated region of mRNA of Numb,
          encoding a membrane-associated inhibitor of Notch
          signaling, and further influences neural development.
          Moreover, Musashi-1 represses translation by
          interacting with the poly(A)-binding protein and
          competes for binding of the eukaryotic initiation
          factor-4G (eIF-4G). Musashi-2 (also termed Msi2) has
          been identified as a regulator of the hematopoietic
          stem cell (HSC) compartment and of leukemic stem cells
          after transplantation of cells with loss and gain of
          function of the gene. It influences proliferation and
          differentiation of HSCs and myeloid progenitors, and
          further modulates normal hematopoiesis and promotes
          aggressive myeloid leukemia. Both, Musashi-1 and
          Musashi-2, contain two conserved N-terminal tandem RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          along with other domains of unknown function. .
          Length = 74

 Score = 35.9 bits (83), Expect = 2e-04
 Identities = 15/42 (35%), Positives = 27/42 (64%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          K+FVG +  +  E D+ K FS++G+V +  ++ DK T + +G
Sbjct: 1  KIFVGGLSANTTEDDVKKYFSQFGKVEDAMLMFDKQTNRHRG 42


>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in
          granule-associated RNA binding proteins (p40-TIA-1 and
          TIAR), and yeast nuclear and cytoplasmic polyadenylated
          RNA-binding protein PUB1.  This subfamily corresponds
          to the RRM3 of TIA-1, TIAR, and PUB1. Nucleolysin TIA-1
          isoform p40 (p40-TIA-1 or TIA-1) and nucleolysin
          TIA-1-related protein (TIAR) are granule-associated RNA
          binding proteins involved in inducing apoptosis in
          cytotoxic lymphocyte (CTL) target cells. They share
          high sequence similarity and are expressed in a wide
          variety of cell types. TIA-1 can be phosphorylated by a
          serine/threonine kinase that is activated during
          Fas-mediated apoptosis.TIAR is mainly localized in the
          nucleus of hematopoietic and nonhematopoietic cells. It
          is translocated from the nucleus to the cytoplasm in
          response to exogenous triggers of apoptosis. Both TIA-1
          and TIAR bind specifically to poly(A) but not to
          poly(C) homopolymers. They are composed of three
          N-terminal highly homologous RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a glutamine-rich
          C-terminal auxiliary domain containing a
          lysosome-targeting motif. TIA-1 and TIAR interact with
          RNAs containing short stretches of uridylates and their
          RRM2 can mediate the specific binding to uridylate-rich
          RNAs. The C-terminal auxiliary domain may be
          responsible for interacting with other proteins. In
          addition, TIA-1 and TIAR share a potential serine
          protease-cleavage site (Phe-Val-Arg) localized at the
          junction between their RNA binding domains and their
          C-terminal auxiliary domains. This subfamily also
          includes a yeast nuclear and cytoplasmic polyadenylated
          RNA-binding protein PUB1, termed ARS consensus-binding
          protein ACBP-60, or poly uridylate-binding protein, or
          poly(U)-binding protein, which has been identified as
          both a heterogeneous nuclear RNA-binding protein
          (hnRNP) and a cytoplasmic mRNA-binding protein (mRNP).
          It may be stably bound to a translationally inactive
          subpopulation of mRNAs within the cytoplasm. PUB1 is
          distributed in both, the nucleus and the cytoplasm, and
          binds to poly(A)+ RNA (mRNA or pre-mRNA). Although it
          is one of the major cellular proteins cross-linked by
          UV light to polyadenylated RNAs in vivo, PUB1 is
          nonessential for cell growth in yeast. PUB1 also binds
          to T-rich single stranded DNA (ssDNA); however, there
          is no strong evidence implicating PUB1 in the mechanism
          of DNA replication. PUB1 contains three RRMs, and a GAR
          motif (glycine and arginine rich stretch) that is
          located between RRM2 and RRM3. .
          Length = 73

 Score = 35.7 bits (83), Expect = 3e-04
 Identities = 11/33 (33%), Positives = 20/33 (60%)

Query: 31 FVGQIPRSMDEADLTKMFSEYGRVYNINVLRDK 63
          +VG +P  + E +L + FS +G +  + V +DK
Sbjct: 4  YVGNLPHGLTEEELQRTFSPFGAIEEVRVFKDK 36


>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl
          cis-trans isomerase-like 4 (PPIase) and similar
          proteins.  This subfamily corresponds to the RRM of
          PPIase, also termed cyclophilin-like protein PPIL4, or
          rotamase PPIL4, a novel nuclear RNA-binding protein
          encoded by cyclophilin-like PPIL4 gene. The precise
          role of PPIase remains unclear. PPIase contains a
          conserved N-terminal peptidyl-prolyl cistrans isomerase
          (PPIase) motif, a central RNA recognition motif (RRM),
          also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), followed by a lysine rich
          domain, and a pair of bipartite nuclear targeting
          sequences (NLS) at the C-terminus.
          Length = 83

 Score = 35.7 bits (83), Expect = 3e-04
 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 10/60 (16%)

Query: 36 PRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF---------EAAFLKIARAAIE 86
          P + DE DL  +FS +G++ +  V+RDK TG S    F         E A+ K+    I+
Sbjct: 13 PVTTDE-DLEIIFSRFGKIKSCEVIRDKKTGDSLQYAFIEFETKEDCEEAYFKMDNVLID 71


>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I
          polyadenylate-binding proteins.  This subfamily
          corresponds to the RRM3 of type I poly(A)-binding
          proteins (PABPs), highly conserved proteins that bind
          to the poly(A) tail present at the 3' ends of most
          eukaryotic mRNAs. They have been implicated in the
          regulation of poly(A) tail length during the
          polyadenylation reaction, translation initiation, mRNA
          stabilization by influencing the rate of deadenylation
          and inhibition of mRNA decapping. The family represents
          type I polyadenylate-binding proteins (PABPs),
          including polyadenylate-binding protein 1 (PABP-1 or
          PABPC1), polyadenylate-binding protein 3 (PABP-3 or
          PABPC3), polyadenylate-binding protein 4 (PABP-4 or
          APP-1 or iPABP), polyadenylate-binding protein 5
          (PABP-5 or PABPC5), polyadenylate-binding protein
          1-like (PABP-1-like or PABPC1L), polyadenylate-binding
          protein 1-like 2 (PABPC1L2 or RBM32),
          polyadenylate-binding protein 4-like (PABP-4-like or
          PABPC4L), yeast polyadenylate-binding protein,
          cytoplasmic and nuclear (PABP or ACBP-67), and similar
          proteins. PABP-1 is an ubiquitously expressed
          multifunctional protein that may play a role in 3' end
          formation of mRNA, translation initiation, mRNA
          stabilization, protection of poly(A) from nuclease
          activity, mRNA deadenylation, inhibition of mRNA
          decapping, and mRNP maturation. Although PABP-1 is
          thought to be a cytoplasmic protein, it is also found
          in the nucleus. PABP-1 may be involved in
          nucleocytoplasmic trafficking and utilization of mRNP
          particles. PABP-1 contains four copies of RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains), a
          less well conserved linker region, and a proline-rich
          C-terminal conserved domain (CTD). PABP-3 is a
          testis-specific poly(A)-binding protein specifically
          expressed in round spermatids. It is mainly found in
          mammalian and may play an important role in the
          testis-specific regulation of mRNA homeostasis. PABP-3
          shows significant sequence similarity to PABP-1.
          However, it binds to poly(A) with a lower affinity than
          PABP-1. PABP-1 possesses an A-rich sequence in its
          5'-UTR and allows binding of PABP and blockage of
          translation of its own mRNA. In contrast, PABP-3 lacks
          the A-rich sequence in its 5'-UTR. PABP-4 is an
          inducible poly(A)-binding protein (iPABP) that is
          primarily localized to the cytoplasm. It shows
          significant sequence similarity to PABP-1 as well. The
          RNA binding properties of PABP-1 and PABP-4 appear to
          be identical. PABP-5 is encoded by PABPC5 gene within
          the X-specific subinterval, and expressed in fetal
          brain and in a range of adult tissues in mammalian,
          such as ovary and testis. It may play an important role
          in germ cell development. Moreover, unlike other PABPs,
          PABP-5 contains only four RRMs, but lacks both the
          linker region and the CTD. PABP-1-like and PABP-1-like
          2 are the orthologs of PABP-1. PABP-4-like is the
          ortholog of PABP-5. Their cellular functions remain
          unclear. The family also includes the yeast PABP, a
          conserved poly(A) binding protein containing poly(A)
          tails that can be attached to the 3'-ends of mRNAs. The
          yeast PABP and its homologs may play important roles in
          the initiation of translation and in mRNA decay. Like
          vertebrate PABP-1, the yeast PABP contains four RRMs, a
          linker region, and a proline-rich CTD as well. The
          first two RRMs are mainly responsible for specific
          binding to poly(A). The proline-rich region may be
          involved in protein-protein interactions. .
          Length = 80

 Score = 35.6 bits (83), Expect = 3e-04
 Identities = 14/44 (31%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 27 FIKMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          F  ++V  +   MD+  L ++F +YG++ +  V++D   G+SKG
Sbjct: 1  FTNVYVKNLGEDMDDEKLKELFGKYGKITSAKVMKDD-EGKSKG 43


>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4;
          Provisional.
          Length = 144

 Score = 36.9 bits (85), Expect = 3e-04
 Identities = 15/42 (35%), Positives = 26/42 (61%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          K+F+G +    D+A L   F+ +G V +  V+ D+ TG+S+G
Sbjct: 36 KLFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRETGRSRG 77


>gnl|CDD|241202 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in heterogeneous
          nuclear ribonucleoprotein D-like (hnRNP D-like or hnRNP
          DL) and similar proteins.  This subgroup corresponds to
          the RRM1 of hnRNP DL (or hnRNP D-like), also termed
          AU-rich element RNA-binding factor, or JKT41-binding
          protein (protein laAUF1 or JKTBP), which is a dual
          functional protein that possesses DNA- and RNA-binding
          properties. It has been implicated in mRNA biogenesis
          at the transcriptional and post-transcriptional levels.
          hnRNP DL binds single-stranded DNA (ssDNA) or
          double-stranded DNA (dsDNA) in a non-sequencespecific
          manner, and interacts with poly(G) and poly(A)
          tenaciously. It contains two putative two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          and a glycine- and tyrosine-rich C-terminus. .
          Length = 76

 Score = 35.7 bits (82), Expect = 3e-04
 Identities = 22/75 (29%), Positives = 36/75 (48%), Gaps = 13/75 (17%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG-------------KIFEA 75
          KMF+G +     + DLT+  S +G V +  +  D VTG+S+G             K+ E 
Sbjct: 1  KMFIGGLSWDTSKKDLTEYLSRFGEVLDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLEL 60

Query: 76 AFLKIARAAIEPQKA 90
             K+    I+P++A
Sbjct: 61 KEHKLDGKLIDPKRA 75


>gnl|CDD|241021 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in yeast nuclear
          polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p)
          and similar proteins.  This subfamily corresponds to
          the RRM1 of Hrp1p and similar proteins. Hrp1p or Nab4p,
          also termed cleavage factor IB (CFIB), is a
          sequence-specific trans-acting factor that is essential
          for mRNA 3'-end formation in yeast Saccharomyces
          cerevisiae. It can be UV cross-linked to RNA and
          specifically recognizes the (UA)6 RNA element required
          for both, the cleavage and poly(A) addition, steps.
          Moreover, Hrp1p can shuttle between the nucleus and the
          cytoplasm, and play an additional role in the export of
          mRNAs to the cytoplasm. Hrp1p also interacts with
          Rna15p and Rna14p, two components of CF1A. In addition,
          Hrp1p functions as a factor directly involved in
          modulating the activity of the nonsense-mediated mRNA
          decay (NMD) pathway. It binds specifically to a
          downstream sequence element (DSE)-containing RNA and
          interacts with Upf1p, a component of the surveillance
          complex, further triggering the NMD pathway. Hrp1p
          contains two central RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and an
          arginine-glycine-rich region harboring repeats of the
          sequence RGGF/Y. .
          Length = 76

 Score = 35.6 bits (82), Expect = 4e-04
 Identities = 14/41 (34%), Positives = 24/41 (58%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          MF+G +     +  L + F ++G V +  V+RD  TG+S+G
Sbjct: 1  MFIGGLNWETTDDSLREYFGQFGEVTDCTVMRDSATGRSRG 41


>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras
          GTPase-activating protein-binding protein G3BP1, G3BP2
          and similar proteins.  This subfamily corresponds to
          the RRM domain in the G3BP family of RNA-binding and
          SH3 domain-binding proteins. G3BP acts at the level of
          RNA metabolism in response to cell signaling, possibly
          as RNA transcript stabilizing factors or an RNase.
          Members include G3BP1, G3BP2 and similar proteins.
          These proteins associate directly with the SH3 domain
          of GTPase-activating protein (GAP), which functions as
          an inhibitor of Ras. They all contain an N-terminal
          nuclear transfer factor 2 (NTF2)-like domain, an acidic
          domain, a domain containing PXXP motif(s), an RNA
          recognition motif (RRM), and an Arg-Gly-rich region
          (RGG-rich region, or arginine methylation motif).
          Length = 81

 Score = 35.4 bits (82), Expect = 4e-04
 Identities = 13/45 (28%), Positives = 23/45 (51%)

Query: 25 PDFIKMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSK 69
          PD  ++FVG +P  + E +L + F E+G V  + +      G+  
Sbjct: 1  PDSHQLFVGNLPHDITEDELKEFFKEFGNVLEVRINSKGGGGRLP 45


>gnl|CDD|241116 cd12672, RRM_DAZL, RNA recognition motif in vertebrate deleted in
          azoospermia-like (DAZL) proteins.  This subgroup
          corresponds to the RRM of DAZL, also termed
          SPGY-like-autosomal, encoded by the autosomal homolog
          of DAZ gene, DAZL. It is ancestral to the deleted in
          azoospermia (DAZ) protein. DAZL is germ-cell-specific
          RNA-binding protein that contains a RNA recognition
          motif (RRM), also known as RBD (RNA binding domain) or
          RNP (ribonucleoprotein domain), and a DAZ motif, a
          protein-protein interaction domain. Although their
          specific biochemical functions remain to be
          investigated, DAZL proteins may interact with
          poly(A)-binding proteins (PABPs), and act as
          translational activators of specific mRNAs during
          gametogenesis. .
          Length = 82

 Score = 35.2 bits (81), Expect = 4e-04
 Identities = 18/44 (40%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          +FVG I   MDE ++   F++YG V  + ++ D+ TG SKG  F
Sbjct: 8  VFVGGIDIRMDETEIRSFFAKYGSVKEVKIITDR-TGVSKGYGF 50


>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding
          protein 34 (RBM34) and similar proteins.  This
          subfamily corresponds to the RRM2 of RBM34, a putative
          RNA-binding protein containing two RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains). Although the
          function of RBM34 remains unclear currently, its RRM
          domains may participate in mRNA processing. RBM34 may
          act as an mRNA processing-related protein. .
          Length = 73

 Score = 35.2 bits (82), Expect = 5e-04
 Identities = 16/40 (40%), Positives = 25/40 (62%)

Query: 31 FVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          FVG +P  ++E +L K F + G V  + ++RD+ TG  KG
Sbjct: 3  FVGNLPFDIEEEELRKHFEDCGDVEAVRIVRDRKTGIGKG 42


>gnl|CDD|240917 cd12473, RRM2_MSSP1, RNA recognition motif 2 found in vertebrate
          single-stranded DNA-binding protein MSSP-1.  This
          subgroup corresponds to the RRM2 of MSSP-1, also termed
          RNA-binding motif, single-stranded-interacting protein
          1 (RBMS1), or suppressor of CDC2 with RNA-binding motif
          2 (SCR2). MSSP-1 is a double- and single-stranded DNA
          binding protein that belongs to the c-myc single-strand
          binding proteins (MSSP) family. It specifically
          recognizes the sequence CT(A/T)(A/T)T, and stimulates
          DNA replication in the system using SV40 DNA. MSSP-1 is
          identical with Scr2, a human protein which complements
          the defect of cdc2 kinase in Schizosaccharomyces pombe.
          MSSP-1 has been implied in regulating DNA replication,
          transcription, apoptosis induction, and cell-cycle
          movement, via the interaction with c-MYC, the product
          of protooncogene c-myc. MSSP-1 contains two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          both of which are responsible for the specific DNA
          binding activity as well as induction of apoptosis. .
          Length = 85

 Score = 35.1 bits (80), Expect = 5e-04
 Identities = 16/44 (36%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          +++  +P SMDE +L  M   +G+V +  +LRD  +G S+G  F
Sbjct: 3  LYISNLPLSMDEQELENMLKPFGQVISTRILRDS-SGTSRGVGF 45


>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage
          stimulation factor subunit 2 (CSTF2), cleavage
          stimulation factor subunit 2 tau variant (CSTF2T) and
          similar proteins.  This subgroup corresponds to the RRM
          domain of CSTF2, its tau variant and eukaryotic
          homologs. CSTF2, also termed cleavage stimulation
          factor 64 kDa subunit (CstF64), is the vertebrate
          conterpart of yeast mRNA 3'-end-processing protein
          RNA15. It is expressed in all somatic tissues and is
          one of three cleavage stimulatory factor (CstF)
          subunits required for polyadenylation. CstF64 contains
          an N-terminal RNA recognition motif (RRM), also known
          as RBD (RNA binding domain) or RNP (ribonucleoprotein
          domain), a CstF77-binding domain, a repeated MEARA
          helical region and a conserved C-terminal domain
          reported to bind the transcription factor PC-4. During
          polyadenylation, CstF interacts with the pre-mRNA
          through the RRM of CstF64 at U- or GU-rich sequences
          within 10 to 30 nucleotides downstream of the cleavage
          site. CSTF2T, also termed tauCstF64, is a paralog of
          the X-linked cleavage stimulation factor CstF64 protein
          that supports polyadenylation in most somatic cells. It
          is expressed during meiosis and subsequent haploid
          differentiation in a more limited set of tissues and
          cell types, largely in meiotic and postmeiotic male
          germ cells, and to a lesser extent in brain. The loss
          of CSTF2T will cause male infertility, as it is
          necessary for spermatogenesis and fertilization.
          Moreover, CSTF2T is required for expression of genes
          involved in morphological differentiation of
          spermatids, as well as for genes having products that
          function during interaction of motile spermatozoa with
          eggs. It promotes germ cell-specific patterns of
          polyadenylation by using its RRM to bind to different
          sequence elements downstream of polyadenylation sites
          than does CstF64. .
          Length = 75

 Score = 34.8 bits (80), Expect = 6e-04
 Identities = 18/44 (40%), Positives = 25/44 (56%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          +FVG IP    E  L  +FSE G V +  ++ D+ TG+ KG  F
Sbjct: 1  VFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGF 44


>gnl|CDD|241213 cd12769, RRM1_HuR, RNA recognition motif 1 in vertebrate
          Hu-antigen R (HuR).  This subgroup corresponds to the
          RRM1 of HuR, also termed ELAV-like protein 1 (ELAV-1),
          a ubiquitously expressed Hu family member. It has a
          variety of biological functions mostly related to the
          regulation of cellular response to DNA damage and other
          types of stress. HuR has an anti-apoptotic function
          during early cell stress response; it binds to mRNAs
          and enhances the expression of several anti-apoptotic
          proteins, such as p21waf1, p53, and prothymosin alpha.
          Meanwhile, HuR also has pro-apoptotic function by
          promoting apoptosis when cell death is unavoidable.
          Furthermore, HuR may be important in muscle
          differentiation, adipogenesis, suppression of
          inflammatory response and modulation of gene expression
          in response to chronic ethanol exposure and amino acid
          starvation. Like other Hu proteins, HuR contains three
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          RRM1 and RRM2 may cooperate in binding to an AU-rich
          RNA element (ARE). RRM3 may help to maintain the
          stability of the RNA-protein complex, and might also
          bind to poly(A) tails or be involved in protein-protein
          interactions. .
          Length = 81

 Score = 35.1 bits (80), Expect = 6e-04
 Identities = 16/44 (36%), Positives = 26/44 (59%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          + V  +P++M + +L  +FS  G V +  ++RDKV G S G  F
Sbjct: 4  LIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGF 47


>gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR
          and similar proteins.  This subgroup corresponds to the
          RRM2 of nucleolysin TIAR, also termed TIA-1-related
          protein, a cytotoxic granule-associated RNA-binding
          protein that shows high sequence similarity with 40-kDa
          isoform of T-cell-restricted intracellular antigen-1
          (p40-TIA-1). TIAR is mainly localized in the nucleus of
          hematopoietic and nonhematopoietic cells. It is
          translocated from the nucleus to the cytoplasm in
          response to exogenous triggers of apoptosis. TIAR
          possesses nucleolytic activity against cytolytic
          lymphocyte (CTL) target cells. It can trigger DNA
          fragmentation in permeabilized thymocytes, and thus may
          function as an effector responsible for inducing
          apoptosis. TIAR is composed of three N-terminal, highly
          homologous RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), and a glutamine-rich C-terminal auxiliary
          domain containing a lysosome-targeting motif. It
          interacts with RNAs containing short stretches of
          uridylates and its RRM2 can mediate the specific
          binding to uridylate-rich RNAs. .
          Length = 80

 Score = 34.7 bits (79), Expect = 7e-04
 Identities = 15/51 (29%), Positives = 30/51 (58%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIFEAAFLKI 80
          +FVG +   +   D+   F+ +G++ +  V++D  TG+SKG  F + + K+
Sbjct: 4  VFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKL 54


>gnl|CDD|240918 cd12474, RRM2_MSSP2, RNA recognition motif 2 found in vertebrate
          single-stranded DNA-binding protein MSSP-2.  This
          subgroup corresponds to the RRM2 of MSSP-2, also termed
          RNA-binding motif, single-stranded-interacting protein
          2 (RBMS2), or suppressor of CDC2 with RNA-binding motif
          3 (SCR3). MSSP-2 is a double- and single-stranded DNA
          binding protein that belongs to the c-myc single-strand
          binding proteins (MSSP) family. It specifically
          recognizes the sequence T(C/A)TT, and stimulates DNA
          replication in the system using SV40 DNA. MSSP-2 is
          identical with Scr3, a human protein which complements
          the defect of cdc2 kinase in Schizosaccharomyces pombe.
          MSSP-2 has been implied in regulating DNA replication,
          transcription, apoptosis induction, and cell-cycle
          movement, via the interaction with C-MYC, the product
          of protooncogene c-myc. MSSP-2 contains two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          both of which are responsible for the specific DNA
          binding activity as well as induction of apoptosis. .
          Length = 86

 Score = 35.0 bits (80), Expect = 8e-04
 Identities = 16/44 (36%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          +++  +P SMDE +L  M   +G+V +  +LRD  +G S+G  F
Sbjct: 3  LYISNLPLSMDEQELESMLKPFGQVISTRILRD-ASGTSRGVGF 45


>gnl|CDD|240695 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 in
          heterogeneous nuclear ribonucleoprotein R (hnRNP R) and
          similar proteins.  This subfamily corresponds to the
          RRM1 in hnRNP R, hnRNP Q, APOBEC-1 complementation
          factor (ACF), and dead end protein homolog 1 (DND1).
          hnRNP R is a ubiquitously expressed nuclear RNA-binding
          protein that specifically binds mRNAs with a preference
          for poly(U) stretches. It has been implicated in mRNA
          processing and mRNA transport, and also acts as a
          regulator to modify binding to ribosomes and RNA
          translation. hnRNP Q is also a ubiquitously expressed
          nuclear RNA-binding protein. It has been identified as
          a component of the spliceosome complex, as well as a
          component of the apobec-1 editosome, and has been
          implicated in the regulation of specific mRNA
          transport. ACF is an RNA-binding subunit of a core
          complex that interacts with apoB mRNA to facilitate C
          to U RNA editing. It may also act as an apoB mRNA
          recognition factor and chaperone, and play a key role
          in cell growth and differentiation. DND1 is essential
          for maintaining viable germ cells in vertebrates. It
          interacts with the 3'-untranslated region (3'-UTR) of
          multiple messenger RNAs (mRNAs) and prevents micro-RNA
          (miRNA) mediated repression of mRNA. This family also
          includes two functionally unknown RNA-binding proteins,
          RBM46 and RBM47. All members in this family, except for
          DND1, contain three conserved RNA recognition motifs
          (RRMs); DND1 harbors only two RRMs. .
          Length = 78

 Score = 34.5 bits (80), Expect = 0.001
 Identities = 15/43 (34%), Positives = 27/43 (62%), Gaps = 1/43 (2%)

Query: 31 FVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          FVG+IPR + E +L  +F + G +Y + ++ D  +G ++G  F
Sbjct: 5  FVGKIPRDLFEDELVPLFEKAGPIYELRLMMD-FSGLNRGYAF 46


>gnl|CDD|241024 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in heterogeneous
          nuclear ribonucleoprotein A1 (hnRNP A1) and similar
          proteins.  This subgroup corresponds to the RRM2 of
          hnRNP A1, also termed helix-destabilizing protein, or
          single-strand RNA-binding protein, or hnRNP core
          protein A1, an abundant eukaryotic nuclear RNA-binding
          protein that may modulate splice site selection in
          pre-mRNA splicing. hnRNP A1 has been characterized as a
          splicing silencer, often acting in opposition to an
          activating hnRNP H. It silences exons when bound to
          exonic elements in the alternatively spliced
          transcripts of c-src, HIV, GRIN1, and beta-tropomyosin.
          hnRNP A1 can shuttle between the nucleus and the
          cytoplasm. Thus, it may be involved in transport of
          cellular RNAs, including the packaging of pre-mRNA into
          hnRNP particles and transport of poly A+ mRNA from the
          nucleus to the cytoplasm. The cytoplasmic hnRNP A1 has
          high affinity with AU-rich elements, whereas the
          nuclear hnRNP A1 has high affinity with a
          polypyrimidine stretch bordered by AG at the 3' ends of
          introns. hnRNP A1 is also involved in the replication
          of an RNA virus, such as mouse hepatitis virus (MHV),
          through an interaction with the
          transcription-regulatory region of viral RNA. Moreover,
          hnRNP A1, together with the scaffold protein septin 6,
          serves as host proteins to form a complex with NS5b and
          viral RNA, and further play important roles in the
          replication of Hepatitis C virus (HCV). hnRNP A1
          contains two RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), followed by a long glycine-rich region at the
          C-terminus. The RRMs of hnRNP A1 play an important role
          in silencing the exon and the glycine-rich domain is
          responsible for protein-protein interactions. .
          Length = 77

 Score = 34.2 bits (78), Expect = 0.001
 Identities = 15/45 (33%), Positives = 26/45 (57%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          K+FVG I    +E  L   F +YG++  I ++ D+ +G+ +G  F
Sbjct: 2  KIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAF 46


>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in
          (U)-binding-splicing factor PUF60 and similar proteins.
           This subfamily corresponds to the RRM1 of PUF60, also
          termed FUSE-binding protein-interacting repressor
          (FBP-interacting repressor or FIR), or Ro-binding
          protein 1 (RoBP1), or Siah-binding protein 1
          (Siah-BP1). PUF60 is an essential splicing factor that
          functions as a poly-U RNA-binding protein required to
          reconstitute splicing in depleted nuclear extracts. Its
          function is enhanced through interaction with U2
          auxiliary factor U2AF65. PUF60 also controls human
          c-myc gene expression by binding and inhibiting the
          transcription factor far upstream sequence element
          (FUSE)-binding-protein (FBP), an activator of c-myc
          promoters. PUF60 contains two central RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), and a C-terminal
          U2AF (U2 auxiliary factor) homology motifs (UHM) that
          harbors another RRM and binds to tryptophan-containing
          linear peptide motifs (UHM ligand motifs, ULMs) in
          several nuclear proteins. Research indicates that PUF60
          binds FUSE as a dimer, and only the first two RRM
          domains participate in the single-stranded DNA
          recognition. .
          Length = 76

 Score = 34.3 bits (79), Expect = 0.001
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 6/58 (10%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF------EAAFLKI 80
          +++VG I   + E  + + FS +G + +I++  D VT + KG  F      EAA L +
Sbjct: 2  RVYVGSISFELGEDTIRQAFSPFGPIKSIDMSWDPVTMKHKGFAFVEYEVPEAAQLAL 59


>gnl|CDD|241050 cd12606, RRM1_RBM4, RNA recognition motif 1 in vertebrate
          RNA-binding protein 4 (RBM4).  This subgroup
          corresponds to the RRM1 of RBM4, a ubiquitously
          expressed splicing factor that has two isoforms, RBM4A
          (also known as Lark homolog) and RBM4B (also known as
          RBM30), which are very similar in structure and
          sequence. RBM4 may function as a translational
          regulator of stress-associated mRNAs and also plays a
          role in micro-RNA-mediated gene regulation. RBM4
          contains two N-terminal RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), a CCHC-type zinc finger,
          and three alanine-rich regions within their C-terminal
          regions. The C-terminal region may be crucial for
          nuclear localization and protein-protein interaction.
          The RRMs, in combination with the C-terminal region,
          are responsible for the splicing function of RBM4. .
          Length = 67

 Score = 34.1 bits (78), Expect = 0.001
 Identities = 10/35 (28%), Positives = 23/35 (65%)

Query: 28 IKMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRD 62
          +K+FVG +P    E ++  +F +YG+V   +++++
Sbjct: 1  VKLFVGNLPPEATEQEIRSLFEQYGKVLECDIIKN 35


>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible
          RNA binding protein (CIRBP), RNA binding motif protein
          3 (RBM3) and similar proteins.  This subfamily
          corresponds to the RRM domain of two structurally
          related heterogenous nuclear ribonucleoproteins, CIRBP
          (also termed CIRP or A18 hnRNP) and RBM3 (also termed
          RNPL), both of which belong to a highly conserved cold
          shock proteins family. The cold shock proteins can be
          induced after exposure to a moderate cold-shock and
          other cellular stresses such as UV radiation and
          hypoxia. CIRBP and RBM3 may function in
          posttranscriptional regulation of gene expression by
          binding to different transcripts, thus allowing the
          cell to response rapidly to environmental signals.
          However, the kinetics and degree of cold induction are
          different between CIRBP and RBM3. Tissue distribution
          of their expression is different. CIRBP and RBM3 may be
          differentially regulated under physiological and stress
          conditions and may play distinct roles in cold
          responses of cells. CIRBP, also termed glycine-rich
          RNA-binding protein CIRP, is localized in the nucleus
          and mediates the cold-induced suppression of cell cycle
          progression. CIRBP also binds DNA and possibly serves
          as a chaperone that assists in the folding/unfolding,
          assembly/disassembly and transport of various proteins.
          RBM3 may enhance global protein synthesis and the
          formation of active polysomes while reducing the levels
          of ribonucleoprotein complexes containing microRNAs.
          RBM3 may also serve to prevent the loss of muscle mass
          by its ability to decrease cell death. Furthermore,
          RBM3 may be essential for cell proliferation and
          mitosis. Both, CIRBP and RBM3, contain an N-terminal
          RNA recognition motif (RRM), also termed RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain), that
          is involved in RNA binding, and C-terminal glycine-rich
          domain (RGG motif) that probably enhances RNA-binding
          via protein-protein and/or protein-RNA interactions.
          Like CIRBP, RBM3 can also bind to both RNA and DNA via
          its RRM domain. .
          Length = 80

 Score = 34.4 bits (79), Expect = 0.001
 Identities = 14/42 (33%), Positives = 29/42 (69%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          K+F+G +    +E  L ++FS+YG++  + V++D+ T +S+G
Sbjct: 2  KLFIGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRG 43


>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar
          protein 4 (Nop4p) and similar proteins.  This subgroup
          corresponds to the RRM1 of Nop4p (also known as
          Nop77p), encoded by YPL043W from Saccharomyces
          cerevisiae. It is an essential nucleolar protein
          involved in processing and maturation of 27S pre-rRNA
          and biogenesis of 60S ribosomal subunits. Nop4p has
          four RNA recognition motifs (RRMs), also termed RBDs
          (RNA binding domains) or RNPs (ribonucleoprotein
          domains). .
          Length = 79

 Score = 34.0 bits (78), Expect = 0.001
 Identities = 14/41 (34%), Positives = 24/41 (58%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          +FV  +  S+ + DLT  FS+   + +  V+ D  TG+S+G
Sbjct: 2  LFVRNLAFSVTQEDLTDFFSDVAPIKHAVVVTDPETGESRG 42


>gnl|CDD|241097 cd12653, RRM3_HuR, RNA recognition motif 3 in vertebrate
          Hu-antigen R (HuR).  This subgroup corresponds to the
          RRM3 of HuR, also termed ELAV-like protein 1 (ELAV-1),
          the ubiquitously expressed Hu family member. It has a
          variety of biological functions mostly related to the
          regulation of cellular response to DNA damage and other
          types of stress. HuR has an anti-apoptotic function
          during early cell stress response. It binds to mRNAs
          and enhances the expression of several anti-apoptotic
          proteins, such as p21waf1, p53, and prothymosin alpha.
          HuR also has pro-apoptotic function by promoting
          apoptosis when cell death is unavoidable. Furthermore,
          HuR may be important in muscle differentiation,
          adipogenesis, suppression of inflammatory response and
          modulation of gene expression in response to chronic
          ethanol exposure and amino acid starvation. Like other
          Hu proteins, HuR contains three RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). RRM1 and RRM2 may
          cooperate in binding to an AU-rich RNA element (ARE).
          RRM3 may help to maintain the stability of the
          RNA-protein complex, and might also bind to poly(A)
          tails or be involved in protein-protein interactions. .
          Length = 84

 Score = 34.3 bits (78), Expect = 0.001
 Identities = 15/41 (36%), Positives = 24/41 (58%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          +F+  + +  DE  L +MF  +G V N+ V+RD  T + KG
Sbjct: 4  IFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKG 44


>gnl|CDD|241214 cd12770, RRM1_HuD, RNA recognition motif 1 in vertebrate
          Hu-antigen D (HuD).  This subgroup corresponds to the
          RRM1 of HuD, also termed ELAV-like protein 4 (ELAV-4),
          or paraneoplastic encephalomyelitis antigen HuD, one of
          the neuronal members of the Hu family. The neuronal Hu
          proteins play important roles in neuronal
          differentiation, plasticity and memory. HuD has been
          implicated in various aspects of neuronal function,
          such as the commitment and differentiation of neuronal
          precursors as well as synaptic remodeling in mature
          neurons. HuD also functions as an important regulator
          of mRNA expression in neurons by interacting with
          AU-rich RNA element (ARE) and stabilizing multiple
          transcripts. Moreover, HuD regulates the nuclear
          processing/stability of N-myc pre-mRNA in neuroblastoma
          cells, as well as the neurite elongation and
          morphological differentiation. HuD specifically binds
          poly(A) RNA. Like other Hu proteins, HuD contains three
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          RRM1 and RRM2 may cooperate in binding to an ARE. RRM3
          may help to maintain the stability of the RNA-protein
          complex, and might also bind to poly(A) tails or be
          involved in protein-protein interactions. .
          Length = 83

 Score = 34.3 bits (78), Expect = 0.001
 Identities = 14/44 (31%), Positives = 26/44 (59%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          + V  +P++M + +   +F   G + +  ++RDK+TGQS G  F
Sbjct: 5  LIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGF 48


>gnl|CDD|240929 cd12485, RRM1_RBM47, RNA recognition motif 1 found in vertebrate
          RNA-binding protein 47 (RBM47).  This subgroup
          corresponds to the RRM1 of RBM47, a putative
          RNA-binding protein that shows high sequence homology
          with heterogeneous nuclear ribonucleoprotein R (hnRNP
          R) and heterogeneous nuclear ribonucleoprotein Q (hnRNP
          Q). Its biological function remains unclear. Like hnRNP
          R and hnRNP Q, RBM47 contains two well-defined and one
          degenerated RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains). .
          Length = 78

 Score = 34.2 bits (78), Expect = 0.001
 Identities = 16/45 (35%), Positives = 29/45 (64%), Gaps = 1/45 (2%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          ++FVG+IPR + E +L  +F   GR+Y + ++ D   G+++G  F
Sbjct: 3  EVFVGKIPRDVYEDELVPVFESVGRIYEMRLMMD-FDGKNRGYAF 46


>gnl|CDD|241098 cd12654, RRM3_HuB, RNA recognition motif 3 in vertebrate
          Hu-antigen B (HuB).  This subgroup corresponds to the
          RRM3 of HuB, also termed ELAV-like protein 2 (ELAV-2),
          or ELAV-like neuronal protein 1, or nervous
          system-specific RNA-binding protein Hel-N1 (Hel-N1),
          one of the neuronal members of the Hu family. The
          neuronal Hu proteins play important roles in neuronal
          differentiation, plasticity and memory. HuB is also
          expressed in gonads. It is up-regulated during neuronal
          differentiation of embryonic carcinoma P19 cells. Like
          other Hu proteins, HuB contains three RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains). RRM1 and RRM2 may
          cooperate in binding to an AU-rich RNA element (ARE).
          RRM3 may help to maintain the stability of the
          RNA-protein complex, and might also bind to poly(A)
          tails or be involved in protein-protein interactions. .
          Length = 86

 Score = 34.3 bits (78), Expect = 0.001
 Identities = 16/41 (39%), Positives = 24/41 (58%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          +FV  +    DE+ L +MF  +G V N+ V+RD  T + KG
Sbjct: 6  IFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKG 46


>gnl|CDD|241216 cd12772, RRM1_HuC, RNA recognition motif 1 in vertebrate
          Hu-antigen C (HuC).  This subgroup corresponds to the
          RRM1 of HuC, also termed ELAV-like protein 3 (ELAV-3),
          or paraneoplastic cerebellar degeneration-associated
          antigen, or paraneoplastic limbic encephalitis antigen
          21 (PLE21), one of the neuronal members of the Hu
          family. The neuronal Hu proteins play important roles
          in neuronal differentiation, plasticity and memory.
          Like other Hu proteins, HuC contains three RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          RRM1 and RRM2 may cooperate in binding to an AU-rich
          RNA element (ARE). The AU-rich element binding of HuC
          can be inhibited by flavonoids. RRM3 may help to
          maintain the stability of the RNA-protein complex, and
          might also bind to poly(A) tails or be involved in
          protein-protein interactions. .
          Length = 84

 Score = 34.3 bits (78), Expect = 0.001
 Identities = 14/44 (31%), Positives = 26/44 (59%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          + V  +P++M + +   +F   G + +  ++RDK+TGQS G  F
Sbjct: 6  LIVNYLPQNMTQEEFKSLFGSIGEIESCKLVRDKITGQSLGYGF 49


>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8
          (NOL8) and similar proteins.  This model corresponds to
          the RRM of NOL8 (also termed Nop132) encoded by a novel
          NOL8 gene that is up-regulated in the majority of
          diffuse-type, but not intestinal-type, gastric cancers.
          Thus, NOL8 may be a good molecular target for treatment
          of diffuse-type gastric cancer. Also, NOL8 is a
          phosphorylated protein that contains an N-terminal RNA
          recognition motif (RRM), also known as RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain), suggesting
          NOL8 is likely to function as a novel RNA-binding
          protein. It may be involved in regulation of gene
          expression at the post-transcriptional level or in
          ribosome biogenesis in cancer cells.
          Length = 78

 Score = 33.7 bits (78), Expect = 0.002
 Identities = 14/40 (35%), Positives = 25/40 (62%)

Query: 31 FVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          FVG +  S+ E+DL + FS +G V ++ +++ K  G  +G
Sbjct: 3  FVGGLSPSVTESDLEERFSRFGTVSDVEIIKKKDAGPDRG 42


>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the
          p54nrb/PSF/PSP1 family.  This subfamily corresponds to
          the RRM1 of the p54nrb/PSF/PSP1 family, including 54
          kDa nuclear RNA- and DNA-binding protein (p54nrb or
          NonO or NMT55), polypyrimidine tract-binding protein
          (PTB)-associated-splicing factor (PSF or POMp100),
          paraspeckle protein 1 (PSP1 or PSPC1), which are
          ubiquitously expressed and are conserved in
          vertebrates. p54nrb is a multi-functional protein
          involved in numerous nuclear processes including
          transcriptional regulation, splicing, DNA unwinding,
          nuclear retention of hyperedited double-stranded RNA,
          viral RNA processing, control of cell proliferation,
          and circadian rhythm maintenance. PSF is also a
          multi-functional protein that binds RNA,
          single-stranded DNA (ssDNA), double-stranded DNA
          (dsDNA) and many factors, and mediates diverse
          activities in the cell. PSP1 is a novel nucleolar
          factor that accumulates within a new nucleoplasmic
          compartment, termed paraspeckles, and diffusely
          distributes in the nucleoplasm. The cellular function
          of PSP1 remains unknown currently. This subfamily also
          includes some p54nrb/PSF/PSP1 homologs from
          invertebrate species, such as the Drosophila
          melanogaster gene no-ontransient A (nonA) encoding
          puff-specific protein Bj6 (also termed NONA) and
          Chironomus tentans hrp65 gene encoding protein Hrp65.
          D. melanogaster NONA is involved in eye development and
          behavior, and may play a role in circadian rhythm
          maintenance, similar to vertebrate p54nrb. C. tentans
          Hrp65 is a component of nuclear fibers associated with
          ribonucleoprotein particles in transit from the gene to
          the nuclear pore. All family members contain a DBHS
          domain (for Drosophila behavior, human splicing), which
          comprises two conserved RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a charged
          protein-protein interaction module. PSF has an
          additional large N-terminal domain that differentiates
          it from other family members. .
          Length = 71

 Score = 33.8 bits (78), Expect = 0.002
 Identities = 11/35 (31%), Positives = 23/35 (65%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDK 63
          ++FVG +P  + E +  ++FS+YG V  + + ++K
Sbjct: 3  RLFVGNLPNDITEEEFKELFSKYGEVSEVFLNKEK 37


>gnl|CDD|241117 cd12673, RRM_BOULE, RNA recognition motif in protein BOULE.  This
          subgroup corresponds to the RRM of BOULE, the founder
          member of the human DAZ gene family. Invertebrates
          contain a single BOULE, while vertebrates, other than
          catarrhine primates, possess both BOULE and DAZL genes.
          The catarrhine primates possess BOULE, DAZL, and DAZ
          genes. BOULE encodes an RNA-binding protein containing
          an RNA recognition motif (RRM), also known as RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain), and
          a single copy of the DAZ motif. Although its specific
          biochemical functions remains to be investigated, BOULE
          protein may interact with poly(A)-binding proteins
          (PABPs), and act as translational activators of
          specific mRNAs during gametogenesis. .
          Length = 81

 Score = 34.0 bits (78), Expect = 0.002
 Identities = 19/45 (42%), Positives = 27/45 (60%), Gaps = 1/45 (2%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          ++FVG I    +E DL K FS+YG V  + ++ D+  G SKG  F
Sbjct: 4  RIFVGGIDFKTNENDLRKFFSQYGTVKEVKIVNDR-AGVSKGYGF 47


>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2
          and similar proteins.  This subfamily corresponds to
          the RRM1 of yeast protein gar2, a novel nucleolar
          protein required for 18S rRNA and 40S ribosomal subunit
          accumulation. It shares similar domain architecture
          with nucleolin from vertebrates and NSR1 from
          Saccharomyces cerevisiae. The highly phosphorylated
          N-terminal domain of gar2 is made up of highly acidic
          regions separated from each other by basic sequences,
          and contains multiple phosphorylation sites. The
          central domain of gar2 contains two closely adjacent
          N-terminal RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains). The C-terminal RGG (or GAR) domain of gar2 is
          rich in glycine, arginine and phenylalanine residues. .
          Length = 76

 Score = 33.5 bits (77), Expect = 0.002
 Identities = 15/42 (35%), Positives = 25/42 (59%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
           +FVG +  S+D+  L   F ++G V    V+ D+ TG+S+G
Sbjct: 1  TLFVGNLSWSVDDEWLKAEFEKFGTVVGARVITDRETGRSRG 42


>gnl|CDD|241019 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 in
          heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP
          A/B, hnRNP DL and similar proteins.  This subfamily
          corresponds to the RRM1 in hnRNP D0, hnRNP A/B, hnRNP
          DL and similar proteins. hnRNP D0 is a UUAG-specific
          nuclear RNA binding protein that may be involved in
          pre-mRNA splicing and telomere elongation. hnRNP A/B is
          an RNA unwinding protein with a high affinity for G-
          followed by U-rich regions. hnRNP A/B has also been
          identified as an APOBEC1-binding protein that interacts
          with apolipoprotein B (apoB) mRNA transcripts around
          the editing site and thus plays an important role in
          apoB mRNA editing. hnRNP DL (or hnRNP D-like) is a dual
          functional protein that possesses DNA- and RNA-binding
          properties. It has been implicated in mRNA biogenesis
          at the transcriptional and post-transcriptional levels.
          All members in this family contain two putative RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          and a glycine- and tyrosine-rich C-terminus. .
          Length = 74

 Score = 33.3 bits (76), Expect = 0.002
 Identities = 16/41 (39%), Positives = 25/41 (60%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          MFVG +     + DL + FS++G V +  +  D VTG+S+G
Sbjct: 1  MFVGGLSWDTTKKDLKEYFSKFGEVVDCTIKIDPVTGRSRG 41


>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor
          3B subunit 4 (SF3B4) and similar proteins.  This
          subfamily corresponds to the RRM1 of SF3B4, also termed
          pre-mRNA-splicing factor SF3b 49 kDa (SF3b50), or
          spliceosome-associated protein 49 (SAP 49). SF3B4 a
          component of the multiprotein complex splicing factor
          3b (SF3B), an integral part of the U2 small nuclear
          ribonucleoprotein (snRNP) and the U11/U12 di-snRNP.
          SF3B is essential for the accurate excision of introns
          from pre-messenger RNA, and is involved in the
          recognition of the pre-mRNA's branch site within the
          major and minor spliceosomes. SF3B4 functions to tether
          U2 snRNP with pre-mRNA at the branch site during
          spliceosome assembly. It is an evolutionarily highly
          conserved protein with orthologs across diverse
          species. SF3B4 contains two closely adjacent N-terminal
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          It binds directly to pre-mRNA and also interacts
          directly and highly specifically with another SF3B
          subunit called SAP 145. .
          Length = 74

 Score = 33.3 bits (77), Expect = 0.002
 Identities = 13/43 (30%), Positives = 25/43 (58%)

Query: 31 FVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          +VG +   + E  L ++F + G V N+++ +D+VT   +G  F
Sbjct: 2  YVGNLDEKVTEELLWELFIQAGPVVNVHIPKDRVTQAHQGYGF 44


>gnl|CDD|241099 cd12655, RRM3_HuC, RNA recognition motif 3 in vertebrate
          Hu-antigen C (HuC).  This subgroup corresponds to the
          RRM3 of HuC, also termed ELAV-like protein 3 (ELAV-3),
          or paraneoplastic cerebellar degeneration-associated
          antigen, or paraneoplastic limbic encephalitis antigen
          21 (PLE21), one of the neuronal members of the Hu
          family. The neuronal Hu proteins play important roles
          in neuronal differentiation, plasticity and memory.
          Like other Hu proteins, HuC contains three RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          RRM1 and RRM2 may cooperate in binding to an AU-rich
          RNA element (ARE). The AU-rich element binding of HuC
          can be inhibited by flavonoids. RRM3 may help to
          maintain the stability of the RNA-protein complex, and
          might also bind to poly(A) tails or be involved in
          protein-protein interactions. .
          Length = 85

 Score = 33.5 bits (76), Expect = 0.002
 Identities = 15/41 (36%), Positives = 24/41 (58%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          +FV  +    DE+ L ++F  +G V N+ V+RD  T + KG
Sbjct: 4  IFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTTNKCKG 44


>gnl|CDD|240928 cd12484, RRM1_RBM46, RNA recognition motif 1 found in vertebrate
          RNA-binding protein 46 (RBM46).  This subgroup
          corresponds to the RRM1 of RBM46, also termed
          cancer/testis antigen 68 (CT68), a putative RNA-binding
          protein that shows high sequence homology with
          heterogeneous nuclear ribonucleoprotein R (hnRNP R) and
          heterogeneous nuclear ribonucleoprotein Q (hnRNP Q).
          Its biological function remains unclear. Like hnRNP R
          and hnRNP Q, RBM46 contains two well-defined and one
          degenerated RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains). .
          Length = 78

 Score = 33.3 bits (76), Expect = 0.002
 Identities = 15/45 (33%), Positives = 29/45 (64%), Gaps = 1/45 (2%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          ++FVG+IPR M E +L  +F   G++Y   ++ +  +G+++G  F
Sbjct: 3  EVFVGKIPRDMYEDELVPLFERAGKIYEFRLMME-FSGENRGYAF 46


>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in
          RRM-containing coactivator activator/modulator (CoAA)
          and similar proteins.  This subfamily corresponds to
          the RRM in CoAA (also known as RBM14 or PSP2) and
          RNA-binding protein 4 (RBM4). CoAA is a heterogeneous
          nuclear ribonucleoprotein (hnRNP)-like protein
          identified as a nuclear receptor coactivator. It
          mediates transcriptional coactivation and RNA splicing
          effects in a promoter-preferential manner, and is
          enhanced by thyroid hormone receptor-binding protein
          (TRBP). CoAA contains two N-terminal RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), and a
          TRBP-interacting domain. RBM4 is a ubiquitously
          expressed splicing factor with two isoforms, RBM4A
          (also known as Lark homolog) and RBM4B (also known as
          RBM30), which are very similar in structure and
          sequence. RBM4 may also function as a translational
          regulator of stress-associated mRNAs as well as play a
          role in micro-RNA-mediated gene regulation. RBM4
          contains two N-terminal RRMs, a CCHC-type zinc finger,
          and three alanine-rich regions within their C-terminal
          regions. This family also includes Drosophila
          RNA-binding protein lark (Dlark), a homolog of human
          RBM4. It plays an important role in embryonic
          development and in the circadian regulation of adult
          eclosion. Dlark shares high sequence similarity with
          RBM4 at the N-terminal region. However, Dlark has three
          proline-rich segments instead of three alanine-rich
          segments within the C-terminal region. .
          Length = 66

 Score = 33.0 bits (76), Expect = 0.002
 Identities = 11/34 (32%), Positives = 21/34 (61%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRD 62
          K+FVG +P +    +L  +F +YG V   +V+++
Sbjct: 1  KLFVGNLPDATTSEELRALFEKYGTVTECDVVKN 34


>gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate
          RRM-containing coactivator activator/modulator (CoAA). 
          This subgroup corresponds to the RRM1 of CoAA, also
          termed RNA-binding protein 14 (RBM14), or paraspeckle
          protein 2 (PSP2), or synaptotagmin-interacting protein
          (SYT-interacting protein), a heterogeneous nuclear
          ribonucleoprotein (hnRNP)-like protein identified as a
          nuclear receptor coactivator. It mediates
          transcriptional coactivation and RNA splicing effects
          in a promoter-preferential manner and is enhanced by
          thyroid hormone receptor-binding protein (TRBP). CoAA
          contains two N-terminal RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a TRBP-interacting
          domain. It stimulates transcription through its
          interactions with coactivators, such as TRBP and
          CREB-binding protein CBP/p300, via the TRBP-interacting
          domain and interaction with an RNA-containing complex,
          such as DNA-dependent protein kinase-poly(ADP-ribose)
          polymerase complexes, via the RRMs. .
          Length = 69

 Score = 33.3 bits (76), Expect = 0.003
 Identities = 11/34 (32%), Positives = 19/34 (55%)

Query: 28 IKMFVGQIPRSMDEADLTKMFSEYGRVYNINVLR 61
          +K+FVG +     + +L  +F  YG V +  V+R
Sbjct: 1  VKIFVGNVDEDTSQEELRALFEAYGAVLSCAVMR 34


>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding
          protein 28 (RBM28) and similar proteins.  This
          subfamily corresponds to the RRM1 of RBM28 and Nop4p.
          RBM28 is a specific nucleolar component of the
          spliceosomal small nuclear ribonucleoproteins (snRNPs),
          possibly coordinating their transition through the
          nucleolus. It specifically associates with U1, U2, U4,
          U5, and U6 small nuclear RNAs (snRNAs), and may play a
          role in the maturation of both small nuclear and
          ribosomal RNAs. RBM28 has four RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and an extremely acidic
          region between RRM2 and RRM3. The family also includes
          nucleolar protein 4 (Nop4p or Nop77p) encoded by
          YPL043W from Saccharomyces cerevisiae. It is an
          essential nucleolar protein involved in processing and
          maturation of 27S pre-rRNA and biogenesis of 60S
          ribosomal subunits. Nop4p also contains four RRMs.  .
          Length = 79

 Score = 33.4 bits (77), Expect = 0.003
 Identities = 12/40 (30%), Positives = 21/40 (52%)

Query: 31 FVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          FV  +P    +  L + FSE G +    V++DK + + +G
Sbjct: 3  FVRNLPYDTTDEQLEEFFSEVGPIKRCFVVKDKGSKKCRG 42


>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila
          sex-lethal (SXL) and similar proteins.  This subfamily
          corresponds to the RRM1 of SXL which governs sexual
          differentiation and X chromosome dosage compensation in
          Drosophila melanogaster. It induces female-specific
          alternative splicing of the transformer (tra) pre-mRNA
          by binding to the tra uridine-rich polypyrimidine tract
          at the non-sex-specific 3' splice site during the
          sex-determination process. SXL binds also to its own
          pre-mRNA and promotes female-specific alternative
          splicing. SXL contains an N-terminal Gly/Asn-rich
          domain that may be responsible for the protein-protein
          interaction, and tandem RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), that show high preference
          to bind single-stranded, uridine-rich target RNA
          transcripts. .
          Length = 81

 Score = 33.1 bits (76), Expect = 0.003
 Identities = 12/41 (29%), Positives = 23/41 (56%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          + +  +P+++ + +   +F   G V N  ++RDK TG S G
Sbjct: 3  LIINYLPQTLTDEEFRSLFLAVGPVKNCKIVRDKRTGYSYG 43


>gnl|CDD|240908 cd12462, RRM_SCAF8, RNA recognition motif in SR-related and
          CTD-associated factor 8 (SCAF8) and similar proteins.
          This subgroup corresponds to the RRM of SCAF8 (also
          termed CDC5L complex-associated protein 7, or
          RNA-binding motif protein 16, or CTD-binding SR-like
          protein RA8), a nuclear matrix protein that interacts
          specifically with a highly serine-phosphorylated form
          of the carboxy-terminal domain (CTD) of the largest
          subunit of RNA polymerase II (pol II). The pol II CTD
          plays a role in coupling transcription and pre-mRNA
          processing. SCAF8 co-localizes primarily with
          transcription sites that are enriched in nuclear matrix
          fraction, which is known to contain proteins involved
          in pre-mRNA processing. Thus, SCAF8 may play a direct
          role in coupling with both, transcription and pre-mRNA
          processing, processes. SCAF8, together with SCAF4,
          represents a new class of SCAFs (SR-like CTD-associated
          factors). They contain a conserved N-terminal
          CTD-interacting domain (CID), an atypical RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain), and
          serine/arginine-rich motifs.
          Length = 79

 Score = 33.1 bits (75), Expect = 0.003
 Identities = 11/31 (35%), Positives = 23/31 (74%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVL 60
          ++VGQ+ +   + DLT +F E+G++ +IN++
Sbjct: 5  LWVGQVDKKATQQDLTNLFEEFGQIESINMI 35


>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein
          with serine-rich domain 1 (RNPS1) and similar proteins.
           This subfamily corresponds to the RRM of RNPS1 and its
          eukaryotic homologs. RNPS1, also termed RNA-binding
          protein prevalent during the S phase, or SR-related
          protein LDC2, was originally characterized as a general
          pre-mRNA splicing activator, which activates both
          constitutive and alternative splicing of pre-mRNA in
          vitro.It has been identified as a protein component of
          the splicing-dependent mRNP complex, or exon-exon
          junction complex (EJC), and is directly involved in
          mRNA surveillance. Furthermore, RNPS1 is a splicing
          regulator whose activator function is controlled in
          part by CK2 (casein kinase II) protein kinase
          phosphorylation. It can also function as a
          squamous-cell carcinoma antigen recognized by T cells-3
          (SART3)-binding protein, and is involved in the
          regulation of mRNA splicing. RNPS1 contains an
          N-terminal serine-rich (S) domain, a central RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain), and the
          C-terminal arginine/serine/proline-rich (RS/P) domain.
          .
          Length = 73

 Score = 32.9 bits (76), Expect = 0.003
 Identities = 11/39 (28%), Positives = 25/39 (64%)

Query: 32 VGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          VG++ R++++  L ++FS YG V ++++  D+     +G
Sbjct: 3  VGKLTRNVNKDHLKEIFSNYGTVKDVDLPIDREVNLPRG 41


>gnl|CDD|240910 cd12464, RRM_G3BP2, RNA recognition motif in ras
          GTPase-activating protein-binding protein 2 (G3BP2) and
          similar proteins.  This subgroup corresponds to the RRM
          of G3BP2, also termed GAP SH3 domain-binding protein 2,
          a cytoplasmic protein that interacts with both
          IkappaBalpha and IkappaBalpha/NF-kappaB complexes,
          indicating that G3BP2 may play a role in the control of
          nucleocytoplasmic distribution of IkappaBalpha and
          cytoplasmic anchoring of the IkappaBalpha/NF-kappaB
          complex. G3BP2 contains an N-terminal nuclear transfer
          factor 2 (NTF2)-like domain, an acidic domain, a domain
          containing five PXXP motifs, an RNA recognition motif
          (RRM domain), and an Arg-Gly-rich region (RGG-rich
          region, or arginine methylation motif). It binds to the
          SH3 domain of RasGAP, a multi-functional protein
          controlling Ras activity, through its N-terminal
          NTF2-like domain. The acidic domain is sufficient for
          the interaction of G3BP2 with the IkappaBalpha
          cytoplasmic retention sequence. Furthermore, G3BP2
          might influence stability or translational efficiency
          of particular mRNAs by binding to RNA-containing
          structures within the cytoplasm through its RNA-binding
          domain.
          Length = 83

 Score = 33.0 bits (75), Expect = 0.003
 Identities = 14/43 (32%), Positives = 25/43 (58%)

Query: 25 PDFIKMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQ 67
          PD  ++FVG +P  +DE++L + F  +G V  + +    V G+
Sbjct: 3  PDSHQLFVGNLPHDIDESELKEFFMSFGNVVELRINTKGVGGK 45


>gnl|CDD|241081 cd12637, RRM2_FCA, RNA recognition motif 2 in plant flowering
          time control protein FCA and similar proteins.  This
          subgroup corresponds to the RRM2 of FCA, a gene
          controlling flowering time in Arabidopsis, which
          encodes a flowering time control protein that functions
          in the posttranscriptional regulation of transcripts
          involved in the flowering process. The flowering time
          control protein FCA contains two RNA recognition motifs
          (RRMs), also known as RBDs (RNA binding domains) or RNP
          (ribonucleoprotein domains), and a WW protein
          interaction domain. .
          Length = 80

 Score = 32.9 bits (75), Expect = 0.004
 Identities = 24/63 (38%), Positives = 41/63 (65%), Gaps = 10/63 (15%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIFEAAFLK-----IARA 83
          K+FVG + +   E ++ ++FS YGRV +I ++RD++  QS+G     AF+K     +A+A
Sbjct: 1  KLFVGCLNKQATEKEVEEVFSPYGRVEDIYMMRDEMK-QSRG----CAFVKYSSKEMAQA 55

Query: 84 AIE 86
          AI+
Sbjct: 56 AIK 58


>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in
          RNA-binding protein 5 (RBM5) and similar proteins.
          This subfamily includes the RRM1 and RRM2 of
          RNA-binding protein 5 (RBM5 or LUCA15 or H37) and
          RNA-binding protein 10 (RBM10 or S1-1), and the RRM2 of
          RNA-binding protein 6 (RBM6 or NY-LU-12 or g16 or
          DEF-3). These RBMs share high sequence homology and may
          play an important role in regulating apoptosis. RBM5 is
          a known modulator of apoptosis. It may also act as a
          tumor suppressor or an RNA splicing factor. RBM6 has
          been predicted to be a nuclear factor based on its
          nuclear localization signal. Both, RBM6 and RBM5,
          specifically bind poly(G) RNA. RBM10 is a paralog of
          RBM5. It may play an important role in mRNA generation,
          processing and degradation in several cell types. The
          rat homolog of human RBM10 is protein S1-1, a
          hypothetical RNA binding protein with poly(G) and
          poly(U) binding capabilities. All family members
          contain two RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), two C2H2-type zinc fingers, and a
          G-patch/D111 domain. .
          Length = 84

 Score = 32.9 bits (76), Expect = 0.004
 Identities = 10/38 (26%), Positives = 20/38 (52%), Gaps = 2/38 (5%)

Query: 35 IPRSMDEADLTKMFSEYGR--VYNINVLRDKVTGQSKG 70
          +     E D+ +  S      + ++ ++RDK+TG S+G
Sbjct: 10 LDLLTTEEDILQALSAIASVPIKDVRLIRDKLTGTSRG 47


>gnl|CDD|240919 cd12475, RRM2_RBMS3, RNA recognition motif 2 found in vertebrate
          RNA-binding motif, single-stranded-interacting protein
          3 (RBMS3).  This subgroup corresponds to the RRM2 of
          RBMS3, a new member of the c-myc gene single-strand
          binding proteins (MSSP) family of DNA regulators.
          Unlike other MSSP proteins, RBMS3 is not a
          transcriptional regulator. It binds with high affinity
          to A/U-rich stretches of RNA, and to A/T-rich DNA
          sequences, and functions as a regulator of cytoplasmic
          activity. RBMS3 contain two N-terminal RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), and its C-terminal
          region is acidic and enriched in prolines, glutamines
          and threonines. .
          Length = 88

 Score = 32.8 bits (74), Expect = 0.004
 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          +++  +P SMDE +L  M   +G V +  +LRD   G S+G  F
Sbjct: 4  LYISNLPVSMDEQELENMLKPFGHVISTRILRD-ANGVSRGVGF 46


>gnl|CDD|241053 cd12609, RRM2_CoAA, RNA recognition motif 2 in vertebrate
          RRM-containing coactivator activator/modulator (CoAA). 
          This subgroup corresponds to the RRM2 of CoAA, also
          termed RNA-binding protein 14 (RBM14), or paraspeckle
          protein 2 (PSP2), or synaptotagmin-interacting protein
          (SYT-interacting protein), a heterogeneous nuclear
          ribonucleoprotein (hnRNP)-like protein identified as a
          nuclear receptor coactivator. It mediates
          transcriptional coactivation and RNA splicing effects
          in a promoter-preferential manner and is enhanced by
          thyroid hormone receptor-binding protein (TRBP). CoAA
          contains two N-terminal RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a TRBP-interacting
          domain. It stimulates transcription through its
          interactions with coactivators, such as TRBP and
          CREB-binding protein CBP/p300, via the TRBP-interacting
          domain and interaction with an RNA-containing complex,
          such as DNA-dependent protein kinase-poly(ADP-ribose)
          polymerase complexes, via the RRMs. .
          Length = 68

 Score = 32.5 bits (74), Expect = 0.005
 Identities = 11/34 (32%), Positives = 20/34 (58%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRD 62
          K+FVG +  +    +L  +F E+GRV   + ++D
Sbjct: 2  KIFVGNVSATCTSDELRGLFEEFGRVVECDKVKD 35


>gnl|CDD|241200 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in heterogeneous
          nuclear ribonucleoprotein D0 (hnRNP D0) and similar
          proteins.  This subgroup corresponds to the RRM1 of
          hnRNP D0, also termed AU-rich element RNA-binding
          protein 1, which is a UUAG-specific nuclear RNA binding
          protein that may be involved in pre-mRNA splicing and
          telomere elongation. hnRNP D0 contains two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          in the middle and an RGG box rich in glycine and
          arginine residues in the C-terminal part. Each of RRMs
          can bind solely to the UUAG sequence specifically. .
          Length = 74

 Score = 32.7 bits (74), Expect = 0.005
 Identities = 19/74 (25%), Positives = 35/74 (47%), Gaps = 13/74 (17%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG-------------KIFEAA 76
          MF+G +     + DL   FS++G V +  +  D +TG+S+G             K+ +  
Sbjct: 1  MFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQK 60

Query: 77 FLKIARAAIEPQKA 90
            K+    I+P++A
Sbjct: 61 EHKLNGKVIDPKRA 74


>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding
          protein 19 (RBM19) and similar proteins.  This subgroup
          corresponds to the RRM3 of RBM19, also termed
          RNA-binding domain-1 (RBD-1), which is a nucleolar
          protein conserved in eukaryotes. It is involved in
          ribosome biogenesis by processing rRNA. In addition, it
          is essential for preimplantation development. RBM19 has
          a unique domain organization containing 6 conserved RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains). .
          Length = 79

 Score = 32.4 bits (74), Expect = 0.005
 Identities = 15/45 (33%), Positives = 28/45 (62%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          ++F+  +  +  E DL K+FS+YG +  +++  DK+T + KG  F
Sbjct: 4  RLFIRNLAYTCTEEDLEKLFSKYGPLSEVHLPIDKLTKKPKGFAF 48


>gnl|CDD|233507 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonucleoprotein R, Q
           family.  Sequences in this subfamily include the human
           heterogeneous nuclear ribonucleoproteins (hnRNP) R , Q
           and APOBEC-1 complementation factor (aka APOBEC-1
           stimulating protein). These proteins contain three RNA
           recognition domains (rrm: pfam00076) and a somewhat
           variable C-terminal domain.
          Length = 578

 Score = 33.8 bits (77), Expect = 0.005
 Identities = 16/45 (35%), Positives = 30/45 (66%), Gaps = 1/45 (2%)

Query: 29  KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
           ++FVG+IPR + E +L  +F + G +Y + ++ D  +GQ++G  F
Sbjct: 60  EVFVGKIPRDLYEDELVPLFEKAGPIYELRLMMD-FSGQNRGYAF 103


>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II
          polyadenylate-binding proteins.  This subfamily
          corresponds to the RRM of type II polyadenylate-binding
          proteins (PABPs), including polyadenylate-binding
          protein 2 (PABP-2 or PABPN1), embryonic
          polyadenylate-binding protein 2 (ePABP-2 or PABPN1L)
          and similar proteins. PABPs are highly conserved
          proteins that bind to the poly(A) tail present at the
          3' ends of most eukaryotic mRNAs. They have been
          implicated in the regulation of poly(A) tail length
          during the polyadenylation reaction, translation
          initiation, mRNA stabilization by influencing the rate
          of deadenylation and inhibition of mRNA decapping.
          ePABP-2 is predominantly located in the cytoplasm and
          PABP-2 is located in the nucleus. In contrast to the
          type I PABPs containing four copies of RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), the type II PABPs
          contains a single highly-conserved RRM. This subfamily
          also includes Saccharomyces cerevisiae RBP29 (SGN1,
          YIR001C) gene encoding cytoplasmic mRNA-binding protein
          Rbp29 that binds preferentially to poly(A). Although
          not essential for cell viability, Rbp29 plays a role in
          modulating the expression of cytoplasmic mRNA. Like
          other type II PABPs, Rbp29 contains one RRM only. .
          Length = 73

 Score = 32.3 bits (74), Expect = 0.005
 Identities = 15/40 (37%), Positives = 20/40 (50%)

Query: 31 FVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          FVG +       +L + F   G +  I +L DK TGQ KG
Sbjct: 3  FVGNVDYGTTPEELQEHFKSCGTINRITILCDKFTGQPKG 42


>gnl|CDD|240890 cd12444, RRM1_CPEBs, RNA recognition motif 1 in cytoplasmic
          polyadenylation element-binding protein CPEB-1, CPEB-2,
          CPEB-3, CPEB-4 and similar protiens.  This subfamily
          corresponds to the RRM1 of the CPEB family of proteins
          that bind to defined groups of mRNAs and act as either
          translational repressors or activators to regulate
          their translation. CPEB proteins are well conserved in
          both, vertebrates and invertebrates. Based on sequence
          similarity, RNA-binding specificity, and functional
          regulation of translation, the CPEB proteins have been
          classified into two subfamilies. The first subfamily
          includes CPEB-1 and related proteins. CPEB-1 is an
          RNA-binding protein that interacts with the cytoplasmic
          polyadenylation element (CPE), a short U-rich motif in
          the 3' untranslated regions (UTRs) of certain mRNAs. It
          functions as a translational regulator that plays a
          major role in the control of maternal CPE-containing
          mRNA in oocytes, as well as of subsynaptic
          CPE-containing mRNA in neurons. Once phosphorylated and
          recruiting the polyadenylation complex, CPEB-1 may
          function as a translational activator stimulating
          polyadenylation and translation. Otherwise, it may
          function as a translational inhibitor when
          dephosphorylated and bind to a protein such as maskin
          or neuroguidin, which blocks translation initiation
          through interfering with the assembly of eIF-4E and
          eIF-4G. Although CPEB-1 is mainly located in cytoplasm,
          it can shuttle between nucleus and cytoplasm. The
          second subfamily includes CPEB-2, CPEB-3, CPEB-4, and
          related protiens. Due to high sequence similarity,
          members in this subfamily may share similar expression
          patterns and functions. CPEB-2 is an RNA-binding
          protein that is abundantly expressed in testis and
          localized in cytoplasm in transfected HeLa cells. It
          preferentially binds to poly(U) RNA oligomers and may
          regulate the translation of stored mRNAs during
          spermiogenesis. CPEB-2 impedes target RNA translation
          at elongation; it directly interacts with the
          elongation factor, eEF2, to reduce
          eEF2/ribosome-activated GTP hydrolysis in vitro and
          inhibit peptide elongation of CPEB2-bound RNA in vivo.
          CPEB-3 is a sequence-specific translational regulatory
          protein that regulates translation in a
          polyadenylation-independent manner. It functions as a
          translational repressor that governs the synthesis of
          the AMPA receptor GluR2 through binding GluR2 mRNA. It
          also represses translation of a reporter RNA in
          transfected neurons and stimulates translation in
          response to NMDA. CPEB-4 is an RNA-binding protein that
          mediates meiotic mRNA cytoplasmic polyadenylation and
          translation. It is essential for neuron survival and
          present on the endoplasmic reticulum (ER). It is
          accumulated in the nucleus upon ischemia or the
          depletion of ER calcium. CPEB-4 is overexpressed in a
          large variety of tumors and is associated with many
          mRNAs in cancer cells. All CPEB proteins are
          nucleus-cytoplasm shuttling proteins. They contain an
          N-terminal unstructured region, followed by two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          and a Zn-finger motif. CPEB-2, -3, and -4 have
          conserved nuclear export signals that are not present
          in CPEB-1. .
          Length = 112

 Score = 33.0 bits (75), Expect = 0.005
 Identities = 10/25 (40%), Positives = 15/25 (60%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGR 53
          K+FVG +P  + EAD+   F  +G 
Sbjct: 2  KVFVGGLPWDITEADILNSFRRFGS 26


>gnl|CDD|241100 cd12656, RRM3_HuD, RNA recognition motif 3 in vertebrate
          Hu-antigen D (HuD).  This subgroup corresponds to the
          RRM3 of HuD, also termed ELAV-like protein 4 (ELAV-4),
          or paraneoplastic encephalomyelitis antigen HuD, one of
          the neuronal members of the Hu family. The neuronal Hu
          proteins play important roles in neuronal
          differentiation, plasticity and memory. HuD has been
          implicated in various aspects of neuronal function,
          such as the commitment and differentiation of neuronal
          precursors as well as synaptic remodeling in mature
          neurons. HuD also functions as an important regulator
          of mRNA expression in neurons by interacting with
          AU-rich RNA element (ARE) and stabilizing multiple
          transcripts. Moreover, HuD regulates the nuclear
          processing/stability of N-myc pre-mRNA in neuroblastoma
          cells. And it also regulates the neurite elongation and
          morphological differentiation. HuD specifically bound
          poly(A) RNA. Like other Hu proteins, HuD contains three
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          RRM1 and RRM2 may cooperate in binding to an ARE. RRM3
          may help to maintain the stability of the RNA-protein
          complex, and might also bind to poly(A) tails or be
          involved in protein-protein interactions. .
          Length = 86

 Score = 32.4 bits (73), Expect = 0.006
 Identities = 15/41 (36%), Positives = 24/41 (58%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          +FV  +    DE+ L ++F  +G V N+ V+RD  T + KG
Sbjct: 6  IFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKG 46


>gnl|CDD|241201 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in heterogeneous
          nuclear ribonucleoprotein A/B (hnRNP A/B) and similar
          proteins.  This subgroup corresponds to the RRM1 of
          hnRNP A/B, also termed APOBEC1-binding protein 1
          (ABBP-1), which is an RNA unwinding protein with a high
          affinity for G- followed by U-rich regions. hnRNP A/B
          has also been identified as an APOBEC1-binding protein
          that interacts with apolipoprotein B (apoB) mRNA
          transcripts around the editing site and thus plays an
          important role in apoB mRNA editing. hnRNP A/B contains
          two RNA recognition motifs (RRMs), also termed RBDs
          (RNA binding domains) or RNPs (ribonucleoprotein
          domains), followed by a long C-terminal glycine-rich
          domain that contains a potential ATP/GTP binding loop.
          .
          Length = 75

 Score = 32.3 bits (73), Expect = 0.007
 Identities = 15/42 (35%), Positives = 24/42 (57%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          KMFVG +     + DL   F+++G V +  +  D  TG+S+G
Sbjct: 1  KMFVGGLSWDTSKKDLKDYFTKFGEVTDCTIKMDPNTGRSRG 42


>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein
          homolog TRA2-alpha, TRA2-beta and similar proteins.
          This subfamily corresponds to the RRM of two mammalian
          homologs of Drosophila transformer-2 (Tra2),
          TRA2-alpha, TRA2-beta (also termed SFRS10), and similar
          proteins found in eukaryotes. TRA2-alpha is a 40-kDa
          serine/arginine-rich (SR) protein that specifically
          binds to gonadotropin-releasing hormone (GnRH) exonic
          splicing enhancer on exon 4 (ESE4) and is necessary for
          enhanced GnRH pre-mRNA splicing. It strongly stimulates
          GnRH intron A excision in a dose-dependent manner. In
          addition, TRA2-alpha can interact with either 9G8 or
          SRp30c, which may also be crucial for ESE-dependent
          GnRH pre-mRNA splicing. TRA2-beta is a
          serine/arginine-rich (SR) protein that controls the
          pre-mRNA alternative splicing of the
          calcitonin/calcitonin gene-related peptide (CGRP), the
          survival motor neuron 1 (SMN1) protein and the tau
          protein. Both, TRA2-alpha and TRA2-beta, contains a
          well conserved RNA recognition motif (RRM), also termed
          RBD (RNA binding domain) or RNP (ribonucleoprotein
          domain), flanked by the N- and C-terminal
          arginine/serine (RS)-rich regions. .
          Length = 78

 Score = 31.8 bits (73), Expect = 0.008
 Identities = 13/31 (41%), Positives = 21/31 (67%)

Query: 40 DEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
           E DL ++FS YG +  + V+ D+ TG+S+G
Sbjct: 12 TERDLREVFSRYGPIEKVQVVYDQKTGRSRG 42


>gnl|CDD|241086 cd12642, RRM_TRA2A, RNA recognition motif in transformer-2
          protein homolog alpha (TRA-2 alpha) and similar
          proteins.  This subgroup corresponds to the RRM of
          TRA2-alpha or TRA-2-alpha, also termed transformer-2
          protein homolog A, a mammalian homolog of Drosophila
          transformer-2 (Tra2). TRA2-alpha is a 40-kDa
          serine/arginine-rich (SR) protein (SRp40) that
          specifically binds to gonadotropin-releasing hormone
          (GnRH) exonic splicing enhancer on exon 4 (ESE4) and is
          necessary for enhanced GnRH pre-mRNA splicing. It
          strongly stimulates GnRH intron A excision in a
          dose-dependent manner. In addition, TRA2-alpha can
          interact with either 9G8 or SRp30c, which may also be
          crucial for ESE-dependent GnRH pre-mRNA splicing.
          TRA2-alpha contains a well conserved RNA recognition
          motif (RRM), also termed RBD (RNA binding domain) or
          RNP (ribonucleoprotein domain), flanked by the N- and
          C-terminal arginine/serine (RS)-rich regions. .
          Length = 79

 Score = 32.2 bits (73), Expect = 0.008
 Identities = 15/33 (45%), Positives = 23/33 (69%)

Query: 41 EADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          E DL ++FS YG +  +NV+ D+ TG+S+G  F
Sbjct: 13 ERDLREVFSRYGPLAGVNVVYDQRTGRSRGFAF 45


>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1,
           2, 3, 4 family.  These eukaryotic proteins recognize the
           poly-A of mRNA and consists of four tandem RNA
           recognition domains at the N-terminus (rrm: pfam00076)
           followed by a PABP-specific domain (pfam00658) at the
           C-terminus. The protein is involved in the transport of
           mRNA's from the nucleus to the cytoplasm. There are four
           paralogs in Homo sapiens which are expressed in testis
           (GP:11610605_PABP3 ), platelets (SP:Q13310_PABP4 ),
           broadly expressed (SP:P11940_PABP1) and of unknown
           tissue range (SP:Q15097_PABP2).
          Length = 562

 Score = 33.2 bits (76), Expect = 0.008
 Identities = 14/51 (27%), Positives = 31/51 (60%), Gaps = 1/51 (1%)

Query: 23  PDPDFIKMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
           P   F  ++V  +  S++E  L ++F+++G + +  V++D  +G+S+G  F
Sbjct: 174 PLKKFTNLYVKNLDPSVNEDKLRELFAKFGEITSAAVMKDG-SGRSRGFAF 223



 Score = 33.2 bits (76), Expect = 0.010
 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 6/57 (10%)

Query: 22  QPDPDFIK-----MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
           Q DP   +     +FV  + +S+D   L   FS++G + +  V  D   G+S+G  F
Sbjct: 78  QRDPSLRRSGVGNIFVKNLDKSVDNKALFDTFSKFGNILSCKVATD-ENGKSRGYGF 133



 Score = 31.7 bits (72), Expect = 0.027
 Identities = 10/33 (30%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 38  SMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
           ++ +  L ++FSE G + +  V+ D+  G S+G
Sbjct: 296 TVTDEKLRELFSECGEITSAKVMLDE-KGVSRG 327



 Score = 31.7 bits (72), Expect = 0.033
 Identities = 15/41 (36%), Positives = 24/41 (58%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          ++VG +   + EA L  +F  +G V ++ V RD VT +S G
Sbjct: 3  LYVGDLDPDVTEAKLYDLFKPFGPVLSVRVCRDSVTRRSLG 43


>gnl|CDD|240875 cd12429, RRM_DNAJC17, RNA recognition motif in the DnaJ homolog
          subfamily C member 17.  The CD corresponds to the RRM
          of some eukaryotic DnaJ homolog subfamily C member 17
          and similar proteins. DnaJ/Hsp40 (heat shock protein
          40) proteins are highly conserved and play crucial
          roles in protein translation, folding, unfolding,
          translocation, and degradation. They act primarily by
          stimulating the ATPase activity of Hsp70s, an important
          chaperonine family. Members in this family contains an
          N-terminal DnaJ domain or J-domain, which mediates the
          interaction with Hsp70. They also contains a RNA
          recognition motif (RRM), also known as RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain), at the
          C-terminus, which may play an essential role in RNA
          binding. .
          Length = 74

 Score = 31.9 bits (73), Expect = 0.008
 Identities = 20/49 (40%), Positives = 27/49 (55%), Gaps = 6/49 (12%)

Query: 39 MDEADLTKMFSEYGRVYNINVLRDKVTGQSKGK-IFEAAFLKIARAAIE 86
            E +L K+FS+YG V ++ V+  K     KG  I E A  K A AA+E
Sbjct: 16 YSEDELRKIFSKYGDVSDV-VVSSK----KKGSAIVEFASKKAAEAAVE 59


>gnl|CDD|241203 cd12759, RRM1_MSI1, RNA recognition motif 1 in RNA-binding
          protein Musashi homolog 1 (Musashi-1) and similar
          proteins.  This subgroup corresponds to the RRM1 of
          Musashi-1. The mammalian MSI1 gene encoding Musashi-1
          (also termed Msi1) is a neural RNA-binding protein
          putatively expressed in central nervous system (CNS)
          stem cells and neural progenitor cells and associated
          with asymmetric divisions in neural progenitor cells.
          Musashi-1 is evolutionarily conserved from
          invertebrates to vertebrates. It is a homolog of
          Drosophila Musashi and Xenopus laevis nervous
          system-specific RNP protein-1 (Nrp-1). Musashi-1 has
          been implicated in the maintenance of the stem-cell
          state, differentiation, and tumorigenesis. It
          translationally regulates the expression of a mammalian
          numb gene by binding to the 3'-untranslated region of
          mRNA of Numb, encoding a membrane-associated inhibitor
          of Notch signaling, and further influences neural
          development. Moreover, it represses translation by
          interacting with the poly(A)-binding protein and
          competes for binding of the eukaryotic initiation
          factor-4G (eIF-4G). Musashi-1 contains two conserved
          N-terminal tandem RNA recognition motifs (RRMs), also
          termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), along with other domains
          of unknown function. .
          Length = 77

 Score = 31.9 bits (72), Expect = 0.008
 Identities = 14/42 (33%), Positives = 24/42 (57%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          KMF+G +     +  L + F ++G V    V+RD +T +S+G
Sbjct: 2  KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRG 43


>gnl|CDD|240840 cd12394, RRM1_RBM34, RNA recognition motif 1 in RNA-binding
          protein 34 (RBM34) and similar proteins.  This
          subfamily corresponds to the RRM1 of RBM34, a putative
          RNA-binding protein containing two RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains). Although the
          function of RBM34 remains unclear currently, its RRM
          domains may participate in mRNA processing. RBM34 may
          act as an mRNA processing-related protein. .
          Length = 91

 Score = 31.8 bits (73), Expect = 0.009
 Identities = 9/27 (33%), Positives = 18/27 (66%)

Query: 31 FVGQIPRSMDEADLTKMFSEYGRVYNI 57
          FVG +P +  + DL K+F ++G + ++
Sbjct: 4  FVGNLPLTTKKKDLKKLFKQFGPIESV 30


>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous
          nuclear ribonucleoprotein C (hnRNP C)-related proteins.
           This subfamily corresponds to the RRM in the hnRNP
          C-related protein family, including hnRNP C proteins,
          Raly, and Raly-like protein (RALYL). hnRNP C proteins,
          C1 and C2, are produced by a single coding sequence.
          They are the major constituents of the heterogeneous
          nuclear RNA (hnRNA) ribonucleoprotein (hnRNP) complex
          in vertebrates. They bind hnRNA tightly, suggesting a
          central role in the formation of the ubiquitous hnRNP
          complex; they are involved in the packaging of the
          hnRNA in the nucleus and in processing of pre-mRNA such
          as splicing and 3'-end formation. Raly, also termed
          autoantigen p542, is an RNA-binding protein that may
          play a critical role in embryonic development. The
          biological role of RALYL remains unclear. It shows high
          sequence homology with hnRNP C proteins and Raly.
          Members of this family are characterized by an
          N-terminal RNA recognition motif (RRM), also termed RBD
          (RNA binding domain) or RNP (ribonucleoprotein domain),
          and a C-terminal auxiliary domain. The Raly proteins
          contain a glycine/serine-rich stretch within the
          C-terminal regions, which is absent in the hnRNP C
          proteins. Thus, the Raly proteins represent a newly
          identified class of evolutionarily conserved
          autoepitopes. .
          Length = 68

 Score = 31.4 bits (72), Expect = 0.009
 Identities = 10/32 (31%), Positives = 21/32 (65%), Gaps = 1/32 (3%)

Query: 31 FVGQIPRS-MDEADLTKMFSEYGRVYNINVLR 61
          FVG +    + + DL ++FS+YG++  I++ +
Sbjct: 4  FVGNLNTDKVSKEDLEEIFSKYGKILGISLHK 35


>gnl|CDD|241032 cd12588, RRM1_p54nrb, RNA recognition motif 1 in vertebrate 54
          kDa nuclear RNA- and DNA-binding protein (p54nrb).
          This subgroup corresponds to the RRM1 of p54nrb, also
          termed non-POU domain-containing octamer-binding
          protein (NonO), or 55 kDa nuclear protein (NMT55), or
          DNA-binding p52/p100 complex 52 kDa subunit. p54nrb is
          a multifunctional protein involved in numerous nuclear
          processes including transcriptional regulation,
          splicing, DNA unwinding, nuclear retention of
          hyperedited double-stranded RNA, viral RNA processing,
          control of cell proliferation, and circadian rhythm
          maintenance. It is ubiquitously expressed and highly
          conserved in vertebrates. p54nrb binds both, single-
          and double-stranded RNA and DNA, and also possesses
          inherent carbonic anhydrase activity. It forms a
          heterodimer with paraspeckle component 1 (PSPC1 or
          PSP1), localizing to paraspeckles in an RNA-dependent
          manneras well as with polypyrimidine tract-binding
          protein-associated-splicing factor (PSF). p54nrb
          contains two conserved RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), at the N-terminus. .
          Length = 71

 Score = 31.8 bits (72), Expect = 0.009
 Identities = 13/38 (34%), Positives = 24/38 (63%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTG 66
          ++FVG +P  + E ++ K+F +YG+   I + +DK  G
Sbjct: 3  RLFVGNLPPDITEEEMRKLFEKYGKAGEIFIHKDKGFG 40


>gnl|CDD|240909 cd12463, RRM_G3BP1, RNA recognition motif found in ras
          GTPase-activating protein-binding protein 1 (G3BP1) and
          similar proteins.  This subgroup corresponds to the RRM
          of G3BP1, also termed ATP-dependent DNA helicase VIII
          (DH VIII), or GAP SH3 domain-binding protein 1, which
          has been identified as a phosphorylation-dependent
          endoribonuclease that interacts with the SH3 domain of
          RasGAP, a multi-functional protein controlling Ras
          activity. The acidic RasGAP binding domain of G3BP1
          harbors an arsenite-regulated phosphorylation site and
          dominantly inhibits stress granule (SG) formation.
          G3BP1 also contains an N-terminal nuclear transfer
          factor 2 (NTF2)-like domain, an RNA recognition motif
          (RRM domain), and an Arg-Gly-rich region (RGG-rich
          region, or arginine methylation motif). The RRM domain
          and RGG-rich region are canonically associated with RNA
          binding. G3BP1 co-immunoprecipitates with mRNAs. It
          binds to and cleaves the 3'-untranslated region
          (3'-UTR) of the c-myc mRNA in a
          phosphorylation-dependent manner. Thus, G3BP1 may play
          a role in coupling extra-cellular stimuli to mRNA
          stability. It has been shown that G3BP1 is a novel
          Dishevelled-associated protein that is methylated upon
          Wnt3a stimulation and that arginine methylation of
          G3BP1 regulates both Ctnnb1 mRNA and canonical
          Wnt/beta-catenin signaling. Furthermore, G3BP1 can be
          associated with the 3'-UTR of beta-F1 mRNA in
          cytoplasmic RNA-granules, demonstrating that G3BP1 may
          specifically repress the translation of the transcript.
          Length = 80

 Score = 31.8 bits (72), Expect = 0.010
 Identities = 12/35 (34%), Positives = 23/35 (65%)

Query: 25 PDFIKMFVGQIPRSMDEADLTKMFSEYGRVYNINV 59
          PD  ++FVG +P  +D+++L + F +YG V  + +
Sbjct: 1  PDSHQLFVGNLPHDVDKSELKEFFQQYGNVVELRI 35


>gnl|CDD|240768 cd12322, RRM2_TDP43, RNA recognition motif 2 in TAR DNA-binding
          protein 43 (TDP-43) and similar proteins.  This
          subfamily corresponds to the RRM2 of TDP-43 (also
          termed TARDBP), a ubiquitously expressed pathogenic
          protein whose normal function and abnormal aggregation
          are directly linked to the genetic disease cystic
          fibrosis, and two neurodegenerative disorders:
          frontotemporal lobar degeneration (FTLD) and
          amyotrophic lateral sclerosis (ALS). TDP-43 binds both
          DNA and RNA, and has been implicated in transcriptional
          repression, pre-mRNA splicing and translational
          regulation. TDP-43 is a dimeric protein with two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          and a C-terminal glycine-rich domain. The RRMs are
          responsible for DNA and RNA binding; they bind to TAR
          DNA and RNA sequences with UG-repeats. The glycine-rich
          domain can interact with the hnRNP family proteins to
          form the hnRNP-rich complex involved in splicing
          inhibition. It is also essential for the cystic
          fibrosis transmembrane conductance regulator (CFTR)
          exon 9-skipping activity. .
          Length = 71

 Score = 31.5 bits (72), Expect = 0.010
 Identities = 12/26 (46%), Positives = 18/26 (69%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRV 54
          K+FVG++   M E DL + FS++G V
Sbjct: 2  KVFVGRLTEDMTEEDLRQYFSQFGEV 27


>gnl|CDD|241084 cd12640, RRM3_Bruno_like, RNA recognition motif 3 in Drosophila
          melanogaster Bruno protein and similar proteins.  This
          subgroup corresponds to the RRM3 of Bruno protein, a
          Drosophila RNA recognition motif (RRM)-containing
          protein that plays a central role in regulation of
          Oskar (Osk) expression. It mediates repression by
          binding to regulatory Bruno response elements (BREs) in
          the Osk mRNA 3' UTR. The full-length Bruno protein
          contains three RRMs, two located in the N-terminal half
          of the protein and the third near the C-terminus,
          separated by a linker region. .
          Length = 79

 Score = 31.9 bits (72), Expect = 0.010
 Identities = 14/45 (31%), Positives = 23/45 (51%)

Query: 25 PDFIKMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSK 69
          P+   +F+  +P+   + DL + F  +G V +  V  DK T  SK
Sbjct: 2  PEGCNLFIYHLPQEFTDTDLAQTFLPFGNVISAKVFIDKQTNLSK 46


>gnl|CDD|240775 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 in
          heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP
          A/B, hnRNP DL and similar proteins.  This subfamily
          corresponds to the RRM2 of hnRNP D0, hnRNP A/B, hnRNP
          DL and similar proteins. hnRNP D0, a UUAG-specific
          nuclear RNA binding protein that may be involved in
          pre-mRNA splicing and telomere elongation. hnRNP A/B is
          an RNA unwinding protein with a high affinity for G-
          followed by U-rich regions. It has also been identified
          as an APOBEC1-binding protein that interacts with
          apolipoprotein B (apoB) mRNA transcripts around the
          editing site and thus plays an important role in apoB
          mRNA editing. hnRNP DL (or hnRNP D-like) is a dual
          functional protein that possesses DNA- and RNA-binding
          properties. It has been implicated in mRNA biogenesis
          at the transcriptional and post-transcriptional levels.
          All memembers in this family contain two putative RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          and a glycine- and tyrosine-rich C-terminus. .
          Length = 75

 Score = 31.6 bits (72), Expect = 0.011
 Identities = 13/45 (28%), Positives = 23/45 (51%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          K+FVG +     E  + + F ++G +  I +  DK T + +G  F
Sbjct: 1  KIFVGGLSPETTEEKIREYFGKFGNIVEIELPMDKKTNKRRGFCF 45


>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic
          RNA-binding protein 18 and similar proteins.  This
          subfamily corresponds to the RRM of RBM18, a putative
          RNA-binding protein containing a well-conserved RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain). The
          biological role of RBM18 remains unclear. .
          Length = 80

 Score = 31.5 bits (72), Expect = 0.011
 Identities = 14/51 (27%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIFEAAFLK 79
          ++++G +   + E  L K+FS+YG++   + L  K +G  KG+     F+ 
Sbjct: 1  RLWIGNLDSRLTEFHLLKLFSKYGKIKKFDFLFHK-SGPLKGQPRGYCFVT 50


>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related
          protein 7 (LARP7) and similar proteins.  This subfamily
          corresponds to the RRM1 of LARP7, also termed La
          ribonucleoprotein domain family member 7, or
          P-TEFb-interaction protein for 7SK stability (PIP7S),
          an oligopyrimidine-binding protein that binds to the
          highly conserved 3'-terminal U-rich stretch (3'
          -UUU-OH) of 7SK RNA. LARP7 is a stable component of the
          7SK small nuclear ribonucleoprotein (7SK snRNP). It
          intimately associates with all the nuclear 7SK and is
          required for 7SK stability. LARP7 also acts as a
          negative transcriptional regulator of cellular and
          viral polymerase II genes, acting by means of the 7SK
          snRNP system. It plays an essential role in the
          inhibition of positive transcription elongation factor
          b (P-TEFb)-dependent transcription, which has been
          linked to the global control of cell growth and
          tumorigenesis. LARP7 contains a La motif (LAM) and an
          RNA recognition motif (RRM), also termed RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain), at
          the N-terminal region, which mediates binding to the
          U-rich 3' terminus of 7SK RNA. LARP7 also carries
          another putative RRM domain at its C-terminus. .
          Length = 80

 Score = 31.6 bits (72), Expect = 0.011
 Identities = 15/43 (34%), Positives = 24/43 (55%)

Query: 31 FVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          +V  +P++     L  +FS+YG V  +++ R K TG  KG  F
Sbjct: 3  YVECLPKNATHEWLKAVFSKYGTVVYVSLPRYKHTGDIKGFAF 45


>gnl|CDD|240862 cd12416, RRM4_RBM28_like, RNA recognition motif 4 in RNA-binding
          protein 28 (RBM28) and similar proteins.  This
          subfamily corresponds to the RRM4 of RBM28 and Nop4p.
          RBM28 is a specific nucleolar component of the
          spliceosomal small nuclear ribonucleoproteins (snRNPs),
          possibly coordinating their transition through the
          nucleolus. It specifically associates with U1, U2, U4,
          U5, and U6 small nuclear RNAs (snRNAs), and may play a
          role in the maturation of both small nuclear and
          ribosomal RNAs. RBM28 has four RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and an extremely acidic
          region between RRM2 and RRM3. The family also includes
          nucleolar protein 4 (Nop4p or Nop77p) encoded by
          YPL043W from Saccharomyces cerevisiae. It is an
          essential nucleolar protein involved in processing and
          maturation of 27S pre-rRNA and biogenesis of 60S
          ribosomal subunits. Nop4p also contains four RRMs. .
          Length = 98

 Score = 31.8 bits (73), Expect = 0.012
 Identities = 12/51 (23%), Positives = 24/51 (47%), Gaps = 15/51 (29%)

Query: 35 IPRSMDEADLTKMFSEY---------GRVYNINVLRDK------VTGQSKG 70
          +P+S+DE  L ++F +           ++  + ++RD         G+SKG
Sbjct: 8  LPKSVDEKKLKELFLKAVSERAGKKKPKIKQVKIMRDLKRVDPNGKGKSKG 58


>gnl|CDD|241078 cd12634, RRM2_CELF1_2, RNA recognition motif 2 in CUGBP Elav-like
          family member CELF-1, CELF-2 and similar proteins.
          This subgroup corresponds to the RRM2 of CELF-1 (also
          termed BRUNOL-2, or CUG-BP1, or EDEN-BP), CELF-2 (also
          termed BRUNOL-3, or ETR-3, or CUG-BP2, or NAPOR), both
          of which belong to the CUGBP1 and ETR-3-like factors
          (CELF) or BRUNOL (Bruno-like) family of RNA-binding
          proteins that have been implicated in the regulation of
          pre-mRNA splicing and in the control of mRNA
          translation and deadenylation. CELF-1 is strongly
          expressed in all adult and fetal tissues tested. Human
          CELF-1 is a nuclear and cytoplasmic RNA-binding protein
          that regulates multiple aspects of nuclear and
          cytoplasmic mRNA processing, with implications for
          onset of type 1 myotonic dystrophy (DM1), a
          neuromuscular disease associated with an unstable CUG
          triplet expansion in the 3'-UTR (3'-untranslated
          region) of the DMPK (myotonic dystrophy protein kinase)
          gene; it preferentially targets UGU-rich mRNA elements.
          It has been shown to bind to a Bruno response element,
          a cis-element involved in translational control of
          oskar mRNA in Drosophila, and share sequence similarity
          to Bruno, the Drosophila protein that mediates this
          process. The Xenopus homolog embryo deadenylation
          element-binding protein (EDEN-BP) mediates
          sequence-specific deadenylation of Eg5 mRNA. It binds
          specifically to the EDEN motif in the 3'-untranslated
          regions of maternal mRNAs and targets these mRNAs for
          deadenylation and translational repression. CELF-1
          contains three highly conserved RNA recognition motifs
          (RRMs), also known as RBDs (RNA binding domains) or
          RNPs (ribonucleoprotein domains): two consecutive RRMs
          (RRM1 and RRM2) situated in the N-terminal region
          followed by a linker region and the third RRM (RRM3)
          close to the C-terminus of the protein. The two
          N-terminal RRMs of EDEN-BP are necessary for the
          interaction with EDEN as well as a part of the linker
          region (between RRM2 and RRM3). Oligomerization of
          EDEN-BP is required for specific mRNA deadenylation and
          binding. CELF-2 is expressed in all tissues at some
          level, but highest in brain, heart, and thymus. It has
          been implicated in the regulation of nuclear and
          cytoplasmic RNA processing events, including
          alternative splicing, RNA editing, stability and
          translation. CELF-2 shares high sequence identity with
          CELF-1, but shows different binding specificity; it
          preferentially binds to sequences with UG repeats and
          UGUU motifs. It has been shown to bind to a Bruno
          response element, a cis-element involved in
          translational control of oskar mRNA in Drosophila, and
          share sequence similarity to Bruno, the Drosophila
          protein that mediates this process. It also binds to
          the 3'-UTR of cyclooxygenase-2 messages, affecting both
          translation and mRNA stability, and binds to apoB mRNA,
          regulating its C to U editing. CELF-2 also contains
          three highly conserved RRMs. It binds to RNA via the
          first two RRMs, which are also important for
          localization in the cytoplasm. The splicing activation
          or repression activity of CELF-2 on some specific
          substrates is mediated by RRM1/RRM2. Both, RRM1 and
          RRM2 of CELF-2, can activate cardiac troponin T (cTNT)
          exon 5 inclusion. In addition, CELF-2 possesses a
          typical arginine and lysine-rich nuclear localization
          signal (NLS) in the C-terminus, within RRM3. .
          Length = 81

 Score = 31.6 bits (71), Expect = 0.013
 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 1/45 (2%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          K+F+G + +  +E D+  MFS +G++    +LR    G S+G  F
Sbjct: 3  KLFIGMVSKKCNENDIRVMFSPFGQIEECRILRGP-DGLSRGCAF 46


>gnl|CDD|240671 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 and 2 (RRM1,
          RRM2) in Arabidopsis thaliana CTC-interacting domain
          protein CID8, CID9, CID10, CID11, CID12, CID 13 and
          similar proteins.  This subgroup corresponds to the RRM
          domains found in A. thaliana CID8, CID9, CID10, CID11,
          CID12, CID 13 and mainly their plant homologs. These
          highly related RNA-binding proteins contain an
          N-terminal PAM2 domain (PABP-interacting motif 2), two
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          and a basic region that resembles a bipartite nuclear
          localization signal. The biological role of this family
          remains unclear.
          Length = 77

 Score = 31.2 bits (71), Expect = 0.015
 Identities = 12/32 (37%), Positives = 16/32 (50%)

Query: 31 FVGQIPRSMDEADLTKMFSEYGRVYNINVLRD 62
           VG I  S+ E DL + FS  G V  + +  D
Sbjct: 4  HVGGIDGSLSEDDLKEFFSNCGEVTRVRLCGD 35


>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in
          nucleolin-like proteins mainly from plants.  This
          subfamily corresponds to the RRM1 of a group of plant
          nucleolin-like proteins, including nucleolin 1 (also
          termed protein nucleolin like 1) and nucleolin 2 (also
          termed protein nucleolin like 2, or protein parallel
          like 1). They play roles in the regulation of ribosome
          synthesis and in the growth and development of plants.
          Like yeast nucleolin, nucleolin-like proteins possess
          two RNA recognition motifs (RRMs), also termed RBDs
          (RNA binding domains) or RNPs (ribonucleoprotein
          domains).  .
          Length = 77

 Score = 31.1 bits (71), Expect = 0.017
 Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          +FVG +  S ++ DL + F E G V ++ + +D   G+SKG
Sbjct: 2  LFVGNLSWSAEQDDLEEFFKECGEVVDVRIAQDD-DGRSKG 41


>gnl|CDD|241120 cd12676, RRM3_Nop4p, RNA recognition motif 3 in yeast nucleolar
          protein 4 (Nop4p) and similar proteins.  This subgroup
          corresponds to the RRM3 of Nop4p (also known as
          Nop77p), encoded by YPL043W from Saccharomyces
          cerevisiae. It is an essential nucleolar protein
          involved in processing and maturation of 27S pre-rRNA
          and biogenesis of 60S ribosomal subunits. Nop4p has
          four RNA recognition motifs (RRMs), also termed RBDs
          (RNA binding domains) or RNPs (ribonucleoprotein
          domains). .
          Length = 107

 Score = 31.4 bits (71), Expect = 0.019
 Identities = 16/48 (33%), Positives = 23/48 (47%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIFEAAF 77
          +FV  +P    E  L   FS++G V     + DK TG++KG  F    
Sbjct: 4  LFVRNLPYDATEESLAPHFSKFGSVRYALPVIDKSTGRAKGTGFVCFK 51


>gnl|CDD|241005 cd12561, RRM1_RBM5_like, RNA recognition motif 1 in RNA-binding
          protein 5 (RBM5) and similar proteins.  This subgroup
          corresponds to the RRM1 of RNA-binding protein 5 (RBM5
          or LUCA15 or H37), RNA-binding protein 10 (RBM10 or
          S1-1) and similar proteins. RBM5 is a known modulator
          of apoptosis. It may also act as a tumor suppressor or
          an RNA splicing factor; it specifically binds poly(G)
          RNA. RBM10, a paralog of RBM5, may play an important
          role in mRNA generation, processing and degradation in
          several cell types. The rat homolog of human RBM10 is
          protein S1-1, a hypothetical RNA binding protein with
          poly(G) and poly(U) binding capabilities. Both, RBM5
          and RBM10, contain two RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), two C2H2-type zinc
          fingers, and a G-patch/D111 domain. .
          Length = 81

 Score = 30.8 bits (70), Expect = 0.020
 Identities = 16/57 (28%), Positives = 28/57 (49%), Gaps = 2/57 (3%)

Query: 35 IPRSMDEADLTKMFSEYGRVY-NINVLRDKVTGQSKGKIF-EAAFLKIARAAIEPQK 89
          +P S+ E D+      +G    ++ ++R K TG S+G  F E   L+ A   +E  +
Sbjct: 10 LPLSVTEEDIRNALVSHGVEPKDVRLMRRKTTGASRGFAFVEFMSLEEATRWMELNQ 66


>gnl|CDD|240930 cd12486, RRM1_ACF, RNA recognition motif 1 found in vertebrate
          APOBEC-1 complementation factor (ACF).  This subgroup
          corresponds to the RRM1 of ACF, also termed
          APOBEC-1-stimulating protein, an RNA-binding subunit of
          a core complex that interacts with apoB mRNA to
          facilitate C to U RNA editing. It may also act as an
          apoB mRNA recognition factor and chaperone, and play a
          key role in cell growth and differentiation. ACF
          shuttles between the cytoplasm and nucleus. It contains
          three RNA recognition motifs (RRMs), also termed RBDs
          (RNA binding domains) or RNPs (ribonucleoprotein
          domains), which display high affinity for an 11
          nucleotide AU-rich mooring sequence 3' of the edited
          cytidine in apoB mRNA. All three RRMs may be required
          for complementation of editing activity in living
          cells. RRM2/3 are implicated in ACF interaction with
          APOBEC-1. .
          Length = 78

 Score = 30.7 bits (69), Expect = 0.024
 Identities = 12/45 (26%), Positives = 28/45 (62%), Gaps = 1/45 (2%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          ++F+G++PR + E +L  +  + G++Y + ++ D   G ++G  F
Sbjct: 3  EIFIGKLPRDLFEDELIPLCEKIGKIYEMRMMMD-FNGNNRGYAF 46


>gnl|CDD|241082 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in CUGBP Elav-like
          family member CELF-1, CELF-2 and similar proteins.
          This subgroup corresponds to the RRM3 of CELF-1 (also
          termed BRUNOL-2, or CUG-BP1, or EDEN-BP) and CELF-2
          (also termed BRUNOL-3, or ETR-3, or CUG-BP2, or NAPOR),
          both of which belong to the CUGBP1 and ETR-3-like
          factors (CELF) or BRUNOL (Bruno-like) family of
          RNA-binding proteins that have been implicated in the
          regulation of pre-mRNA splicing and in the control of
          mRNA translation and deadenylation. CELF-1 is strongly
          expressed in all adult and fetal tissues tested. Human
          CELF-1 is a nuclear and cytoplasmic RNA-binding protein
          that regulates multiple aspects of nuclear and
          cytoplasmic mRNA processing, with implications for
          onset of type 1 myotonic dystrophy (DM1), a
          neuromuscular disease associated with an unstable CUG
          triplet expansion in the 3'-UTR (3'-untranslated
          region) of the DMPK (myotonic dystrophy protein kinase)
          gene; it preferentially targets UGU-rich mRNA elements.
          It has been shown to bind to a Bruno response element,
          a cis-element involved in translational control of
          oskar mRNA in Drosophila, and share sequence similarity
          to Bruno, the Drosophila protein that mediates this
          process. The Xenopus homolog embryo deadenylation
          element-binding protein (EDEN-BP) mediates
          sequence-specific deadenylation of Eg5 mRNA. It
          specifically binds to the EDEN motif in the
          3'-untranslated regions of maternal mRNAs and targets
          these mRNAs for deadenylation and translational
          repression. CELF-1 contain three highly conserved RNA
          recognition motifs (RRMs), also known as RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains):
          two consecutive RRMs (RRM1 and RRM2) situated in the
          N-terminal region followed by a linker region and the
          third RRM (RRM3) close to the C-terminus of the
          protein. The two N-terminal RRMs of EDEN-BP are
          necessary for the interaction with EDEN as well as a
          part of the linker region (between RRM2 and RRM3).
          Oligomerization of EDEN-BP is required for specific
          mRNA deadenylation and binding. CELF-2 is expressed in
          all tissues at some level, but highest in brain, heart,
          and thymus. It has been implicated in the regulation of
          nuclear and cytoplasmic RNA processing events,
          including alternative splicing, RNA editing, stability
          and translation. CELF-2 shares high sequence identity
          with CELF-1, but shows different binding specificity;
          it binds preferentially to sequences with UG repeats
          and UGUU motifs. It has been shown to bind to a Bruno
          response element, a cis-element involved in
          translational control of oskar mRNA in Drosophila, and
          share sequence similarity to Bruno, the Drosophila
          protein that mediates this process. It also binds to
          the 3'-UTR of cyclooxygenase-2 messages, affecting both
          translation and mRNA stability, and binds to apoB mRNA,
          regulating its C to U editing. CELF-2 also contain
          three highly conserved RRMs. It binds to RNA via the
          first two RRMs, which are important for localization in
          the cytoplasm. The splicing activation or repression
          activity of CELF-2 on some specific substrates is
          mediated by RRM1/RRM2. Both, RRM1 and RRM2 of CELF-2,
          can activate cardiac troponin T (cTNT) exon 5
          inclusion. In addition, CELF-2 possesses a typical
          arginine and lysine-rich nuclear localization signal
          (NLS) in the C-terminus, within RRM3. .
          Length = 92

 Score = 30.8 bits (69), Expect = 0.027
 Identities = 15/45 (33%), Positives = 24/45 (53%)

Query: 25 PDFIKMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSK 69
          P+   +F+  +P+   + DL +MF  +G V +  V  DK T  SK
Sbjct: 5  PEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSK 49


>gnl|CDD|240794 cd12348, RRM1_SHARP, RNA recognition motif 1 in
          SMART/HDAC1-associated repressor protein (SHARP) and
          similar proteins.  This subfamily corresponds to the
          RRM1 of SHARP, also termed Msx2-interacting protein
          (MINT), or SPEN homolog, an estrogen-inducible
          transcriptional repressor that interacts directly with
          the nuclear receptor corepressor SMRT, histone
          deacetylases (HDACs) and components of the NuRD
          complex. SHARP recruits HDAC activity and binds to the
          steroid receptor RNA coactivator SRA through four
          conserved N-terminal RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), further suppressing
          SRA-potentiated steroid receptor transcription
          activity. Thus, SHARP has the capacity to modulate both
          liganded and nonliganded nuclear receptors. SHARP also
          has been identified as a component of transcriptional
          repression complexes in Notch/RBP-Jkappa signaling
          pathways. In addition to the N-terminal RRMs, SHARP
          possesses a C-terminal SPOC domain (Spen paralog and
          ortholog C-terminal domain), which is highly conserved
          among Spen proteins.  .
          Length = 75

 Score = 30.5 bits (69), Expect = 0.029
 Identities = 10/32 (31%), Positives = 21/32 (65%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLR 61
          ++VG +P ++ E  +++ F  YGRV ++ +L 
Sbjct: 2  LWVGNLPENVREERISEHFKRYGRVESVKILP 33


>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding
          protein 28 (RBM28) and similar proteins.  This
          subfamily corresponds to the RRM2 of RBM28 and Nop4p.
          RBM28 is a specific nucleolar component of the
          spliceosomal small nuclear ribonucleoproteins (snRNPs),
          possibly coordinating their transition through the
          nucleolus. It specifically associates with U1, U2, U4,
          U5, and U6 small nuclear RNAs (snRNAs), and may play a
          role in the maturation of both small nuclear and
          ribosomal RNAs. RBM28 has four RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and an extremely acidic
          region between RRM2 and RRM3. The family also includes
          nucleolar protein 4 (Nop4p or Nop77p) encoded by
          YPL043W from Saccharomyces cerevisiae. It is an
          essential nucleolar protein involved in processing and
          maturation of 27S pre-rRNA and biogenesis of 60S
          ribosomal subunits. Nop4p also contains four RRMs.  .
          Length = 76

 Score = 30.3 bits (69), Expect = 0.031
 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 2/49 (4%)

Query: 36 PRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIFEAAFLKIARAA 84
          P    EADL K+FS +G V+ + + R    G+ KG  F   F   A A 
Sbjct: 8  PFKCTEADLKKLFSPFGFVWEVTIPRKP-DGKKKGFAF-VQFTSKADAE 54


>gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor
          3B subunit 4 (SF3B4) and similar proteins.  This
          subfamily corresponds to the RRM2 of SF3B4, also termed
          pre-mRNA-splicing factor SF3b 49 kDa (SF3b50), or
          spliceosome-associated protein 49 (SAP 49). SF3B4 is a
          component of the multiprotein complex splicing factor
          3b (SF3B), an integral part of the U2 small nuclear
          ribonucleoprotein (snRNP) and the U11/U12 di-snRNP.
          SF3B is essential for the accurate excision of introns
          from pre-messenger RNA, and is involved in the
          recognition of the pre-mRNA's branch site within the
          major and minor spliceosomes. SF3B4 functions to tether
          U2 snRNP with pre-mRNA at the branch site during
          spliceosome assembly. It is an evolutionarily highly
          conserved protein with orthologs across diverse
          species. SF3B4 contains two closely adjacent N-terminal
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          It binds directly to pre-mRNA and also interacts
          directly and highly specifically with another SF3B
          subunit called SAP 145. .
          Length = 83

 Score = 30.3 bits (69), Expect = 0.032
 Identities = 22/64 (34%), Positives = 31/64 (48%), Gaps = 12/64 (18%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGR-VYNINVLRDKVTGQSKG------KIFEAAFLKIAR 82
          +F+G +   +DE  L   FS +G  +    ++RD  TG SKG        FEA     + 
Sbjct: 4  LFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGFAFISYDSFEA-----SD 58

Query: 83 AAIE 86
          AAIE
Sbjct: 59 AAIE 62


>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in
          serine/arginine-rich splicing factor SRSF2, SRSF8 and
          similar proteins.  This subfamily corresponds to the
          RRM of SRSF2 and SRSF8. SRSF2, also termed protein
          PR264, or splicing component, 35 kDa (splicing factor
          SC35 or SC-35), is a prototypical SR protein that plays
          important roles in the alternative splicing of
          pre-mRNA. It is also involved in transcription
          elongation by directly or indirectly mediating the
          recruitment of elongation factors to the C-terminal
          domain of polymerase II. SRSF2 is exclusively localized
          in the nucleus and is restricted to nuclear processes.
          It contains a single N-terminal RNA recognition motif
          (RRM), also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), followed by a C-terminal RS
          domain rich in serine-arginine dipeptides. The RRM is
          responsible for the specific recognition of 5'-SSNG-3'
          (S=C/G) RNA. In the regulation of alternative splicing
          events, it specifically binds to cis-regulatory
          elements on the pre-mRNA. The RS domain modulates SRSF2
          activity through phosphorylation, directly contacts
          RNA, and promotes protein-protein interactions with the
          spliceosome. SRSF8, also termed SRP46 or SFRS2B, is a
          novel mammalian SR splicing factor encoded by a
          PR264/SC35 functional retropseudogene. SRSF8 is
          localized in the nucleus and does not display the same
          activity as PR264/SC35. It functions as an essential
          splicing factor in complementing a HeLa cell S100
          extract deficient in SR proteins. Like SRSF2, SRSF8
          contains a single N-terminal RRM and a C-terminal RS
          domain. .
          Length = 73

 Score = 30.3 bits (69), Expect = 0.032
 Identities = 13/42 (30%), Positives = 23/42 (54%)

Query: 32 VGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          V  +       DL ++F +YG V ++ + RD+ T +S+G  F
Sbjct: 3  VDNLTYRTTPDDLRRVFEKYGEVGDVYIPRDRYTRESRGFAF 44


>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic
          activator RIM4 and similar proteins.  This subfamily
          corresponds to the RRM2 of RIM4, also termed regulator
          of IME2 protein 4, a putative RNA binding protein that
          is expressed at elevated levels early in meiosis. It
          functions as a meiotic activator required for both the
          IME1- and IME2-dependent pathways of meiotic gene
          expression, as well as early events of meiosis, such as
          meiotic division and recombination, in Saccharomyces
          cerevisiae. RIM4 contains two RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). The family also includes a
          putative RNA-binding protein termed multicopy
          suppressor of sporulation protein Msa1. It is a
          putative RNA-binding protein encoded by a novel gene,
          msa1, from the fission yeast Schizosaccharomyces pombe.
          Msa1 may be involved in the inhibition of sexual
          differentiation by controlling the expression of
          Ste11-regulated genes, possibly through the
          pheromone-signaling pathway. Like RIM4, Msa1 also
          contains two RRMs, both of which are essential for the
          function of Msa1. .
          Length = 80

 Score = 30.4 bits (69), Expect = 0.032
 Identities = 14/54 (25%), Positives = 28/54 (51%), Gaps = 6/54 (11%)

Query: 31 FVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIFEAAFLKIARAA 84
          FVGQ+   + + +L + FS +G++  +N+++      +    F  AF+K  R  
Sbjct: 7  FVGQLSPDVTKEELNERFSRHGKILEVNLIKR----ANHTNAF--AFIKFEREQ 54


>gnl|CDD|241030 cd12586, RRM1_PSP1, RNA recognition motif 1 in vertebrate
          paraspeckle protein 1 (PSP1).  This subgroup
          corresponds to the RRM1 of PSPC1, also termed
          paraspeckle component 1 (PSPC1), a novel nucleolar
          factor that accumulates within a new nucleoplasmic
          compartment, termed paraspeckles, and diffusely
          distributes in the nucleoplasm. It is ubiquitously
          expressed and highly conserved in vertebrates. Its
          cellular function remains unknown currently, however,
          PSPC1 forms a novel heterodimer with the nuclear
          protein p54nrb, also known as non-POU domain-containing
          octamer-binding protein (NonO), which localizes to
          paraspeckles in an RNA-dependent manner. PSPC1 contains
          two conserved RNA recognition motifs (RRMs), also
          termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), at the N-terminus. .
          Length = 71

 Score = 30.3 bits (68), Expect = 0.034
 Identities = 13/38 (34%), Positives = 22/38 (57%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTG 66
          ++FVG +P  + E D  K+F +YG    + + RD+  G
Sbjct: 3  RLFVGNLPTDITEEDFKKLFEKYGEPSEVFINRDRGFG 40


>gnl|CDD|240749 cd12303, RRM_spSet1p_like, RNA recognition motif in fission yeast
          Schizosaccharomyces pombe SET domain-containing protein
          1 (spSet1p) and similar proteins.  This subfamily
          corresponds to the RRM of spSet1p, also termed H3
          lysine-4 specific histone-lysine N-methyltransferase,
          or COMPASS component SET1, or lysine
          N-methyltransferase 2, or Set1 complex component, is
          encoded by SET1 from the fission yeast S. pombe. It is
          essential for the H3 lysine-4 methylation. in vivo, and
          plays an important role in telomere maintenance and DNA
          repair in an ATM kinase Rad3-dependent pathway. spSet1p
          is the homology counterpart of Saccharomyces cerevisiae
          Set1p (scSet1p). However, it is more closely related to
          Set1 found in mammalian. Moreover, unlike scSet1p,
          spSet1p is not required for heterochromatin assembly in
          fission yeast. spSet1p contains an N-terminal RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain), followed by
          a conserved SET domain that may play a role in DNA
          repair and telomere function. .
          Length = 86

 Score = 30.4 bits (69), Expect = 0.034
 Identities = 12/63 (19%), Positives = 21/63 (33%), Gaps = 3/63 (4%)

Query: 31 FVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGK---IFEAAFLKIARAAIEP 87
           +  +        +   F  +G +    +  D  TGQS G     F    L+ + A    
Sbjct: 2  LITGLSPLTTPKQIRMHFRPFGEIEESELKLDPRTGQSLGICRVTFRGDPLRPSAAHEAA 61

Query: 88 QKA 90
          + A
Sbjct: 62 KAA 64


>gnl|CDD|240788 cd12342, RRM_Nab3p, RNA recognition motif in yeast nuclear
          polyadenylated RNA-binding protein 3 (Nab3p) and
          similar proteins.  This subfamily corresponds to the
          RRM of Nab3p, an acidic nuclear polyadenylated
          RNA-binding protein encoded by Saccharomyces cerevisiae
          NAB3 gene that is essential for cell viability. Nab3p
          is predominantly localized within the nucleoplasm and
          essential for growth in yeast. It may play an important
          role in packaging pre-mRNAs into ribonucleoprotein
          structures amenable to efficient nuclear RNA
          processing. Nab3p contains an N-terminal
          aspartic/glutamic acid-rich region, a central RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain), and a
          C-terminal region rich in glutamine and proline
          residues. .
          Length = 71

 Score = 30.1 bits (68), Expect = 0.035
 Identities = 10/32 (31%), Positives = 21/32 (65%), Gaps = 1/32 (3%)

Query: 29 KMFVGQIP-RSMDEADLTKMFSEYGRVYNINV 59
          ++F+G +P + + + DL ++FS YG +  I +
Sbjct: 1  RLFIGNLPTKRVSKEDLFRIFSTYGELAQIVL 32


>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell
          carcinoma antigen recognized by T-cells 3 (SART3) and
          similar proteins.  This subfamily corresponds to the
          RRM2 of SART3, also termed Tat-interacting protein of
          110 kDa (Tip110), is an RNA-binding protein expressed
          in the nucleus of the majority of proliferating cells,
          including normal cells and malignant cells, but not in
          normal tissues except for the testes and fetal liver.
          It is involved in the regulation of mRNA splicing
          probably via its complex formation with RNA-binding
          protein with a serine-rich domain (RNPS1), a
          pre-mRNA-splicing factor. SART3 has also been
          identified as a nuclear Tat-interacting protein that
          regulates Tat transactivation activity through direct
          interaction and functions as an important cellular
          factor for HIV-1 gene expression and viral replication.
          In addition, SART3 is required for U6 snRNP targeting
          to Cajal bodies. It binds specifically and directly to
          the U6 snRNA, interacts transiently with the U6 and
          U4/U6 snRNPs, and promotes the reassembly of U4/U6
          snRNPs after splicing in vitro. SART3 contains an
          N-terminal half-a-tetratricopeptide repeat (HAT)-rich
          domain, a nuclearlocalization signal (NLS) domain, and
          two C-terminal RNA recognition motifs (RRMs), also
          termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). .
          Length = 81

 Score = 30.5 bits (69), Expect = 0.035
 Identities = 13/42 (30%), Positives = 29/42 (69%), Gaps = 1/42 (2%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          K+FV  +P S+ + +L K+F ++G V ++ ++ ++ +G+ KG
Sbjct: 4  KLFVSGLPFSVTKEELEKLFKKHGVVKSVRLVTNR-SGKPKG 44


>gnl|CDD|241017 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA-binding
          protein Musashi homolog 2 (Musashi-2) and similar
          proteins.  This subgroup corresponds to the RRM2 of
          Musashi-2 (also termed Msi2) which has been identified
          as a regulator of the hematopoietic stem cell (HSC)
          compartment and of leukemic stem cells after
          transplantation of cells with loss and gain of function
          of the gene. It influences proliferation and
          differentiation of HSCs and myeloid progenitors, and
          further modulates normal hematopoiesis and promotes
          aggressive myeloid leukemia. Musashi-2 contains two
          conserved N-terminal tandem RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), along with other domains
          of unknown function. .
          Length = 79

 Score = 30.4 bits (68), Expect = 0.039
 Identities = 19/75 (25%), Positives = 36/75 (48%), Gaps = 13/75 (17%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG-------------KIFEA 75
          K+FVG +  +    D+ + F ++G+V +  ++ DK T + +G             K+ E 
Sbjct: 5  KIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEI 64

Query: 76 AFLKIARAAIEPQKA 90
           F +I    +E +KA
Sbjct: 65 HFHEINNKMVECKKA 79


>gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and
          cytoplasmic polyadenylated RNA-binding protein PUB1 and
          similar proteins.  This subgroup corresponds to the
          RRM2 of yeast protein PUB1, also termed ARS
          consensus-binding protein ACBP-60, or poly
          uridylate-binding protein, or poly(U)-binding protein.
          PUB1 has been identified as both, a heterogeneous
          nuclear RNA-binding protein (hnRNP) and a cytoplasmic
          mRNA-binding protein (mRNP), which may be stably bound
          to a translationally inactive subpopulation of mRNAs
          within the cytoplasm. It is distributed in both, the
          nucleus and the cytoplasm, and binds to poly(A)+ RNA
          (mRNA or pre-mRNA). Although it is one of the major
          cellular proteins cross-linked by UV light to
          polyadenylated RNAs in vivo, PUB1 is nonessential for
          cell growth in yeast. PUB1 also binds to T-rich single
          stranded DNA (ssDNA). However, there is no strong
          evidence implicating PUB1 in the mechanism of DNA
          replication. PUB1 contains three RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a GAR motif (glycine
          and arginine rich stretch) that is located between RRM2
          and RRM3. .
          Length = 75

 Score = 30.2 bits (68), Expect = 0.040
 Identities = 12/41 (29%), Positives = 22/41 (53%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          +FVG +   + +A L   FS +    +  V+ D  +G+S+G
Sbjct: 2  IFVGDLSPEVTDATLFAAFSAFPSCSDARVMWDMKSGRSRG 42


>gnl|CDD|240743 cd12297, RRM2_Prp24, RNA recognition motif 2 in fungal
          pre-messenger RNA splicing protein 24 (Prp24) and
          similar proteins.  This subfamily corresponds to the
          RRM2 of Prp24, also termed U4/U6
          snRNA-associated-splicing factor PRP24 (U4/U6 snRNP),
          an RNA-binding protein with four well conserved RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          It facilitates U6 RNA base-pairing with U4 RNA during
          spliceosome assembly. Prp24 specifically binds free U6
          RNA primarily with RRMs 1 and 2 and facilitates pairing
          of U6 RNA bases with U4 RNA bases. Additionally, it may
          also be involved in dissociation of the U4/U6 complex
          during spliceosome activation. .
          Length = 78

 Score = 30.2 bits (69), Expect = 0.042
 Identities = 9/27 (33%), Positives = 17/27 (62%)

Query: 31 FVGQIPRSMDEADLTKMFSEYGRVYNI 57
          +V   P S D++D+  +F +YG + +I
Sbjct: 4  WVTNFPPSFDQSDIRDLFEQYGEILSI 30


>gnl|CDD|240899 cd12453, RRM1_RIM4_like, RNA recognition motif 1 in yeast meiotic
          activator RIM4 and similar proteins.  This subfamily
          corresponds to the RRM1 of RIM4, also termed regulator
          of IME2 protein 4, a putative RNA binding protein that
          is expressed at elevated levels early in meiosis. It
          functions as a meiotic activator required for both the
          IME1- and IME2-dependent pathways of meiotic gene
          expression, as well as early events of meiosis, such as
          meiotic division and recombination, in Saccharomyces
          cerevisiae. RIM4 contains two RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). The family also includes a
          putative RNA-binding protein termed multicopy
          suppressor of sporulation protein Msa1. It is a
          putative RNA-binding protein encoded by a novel gene,
          msa1, from the fission yeast Schizosaccharomyces pombe.
          Msa1 may be involved in the inhibition of sexual
          differentiation by controlling the expression of
          Ste11-regulated genes, possibly through the
          pheromone-signaling pathway. Like RIM4, Msa1 also
          contains two RRMs, both of which are essential for the
          function of Msa1. .
          Length = 86

 Score = 30.1 bits (68), Expect = 0.043
 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 4/37 (10%)

Query: 30 MFVGQIPRSMDEADL----TKMFSEYGRVYNINVLRD 62
          +FV  +P S  + +L    T+ FS+YG +  + VLRD
Sbjct: 5  VFVASLPASKSDDELEAAVTEHFSKYGTLVFVKVLRD 41


>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I
          polyadenylate-binding proteins.  This subfamily
          corresponds to the RRM4 of type I poly(A)-binding
          proteins (PABPs), highly conserved proteins that bind
          to the poly(A) tail present at the 3' ends of most
          eukaryotic mRNAs. They have been implicated in theThe
          CD corresponds to the RRM. regulation of poly(A) tail
          length during the polyadenylation reaction, translation
          initiation, mRNA stabilization by influencing the rate
          of deadenylation and inhibition of mRNA decapping. The
          family represents type I polyadenylate-binding proteins
          (PABPs), including polyadenylate-binding protein 1
          (PABP-1 or PABPC1), polyadenylate-binding protein 3
          (PABP-3 or PABPC3), polyadenylate-binding protein 4
          (PABP-4 or APP-1 or iPABP), polyadenylate-binding
          protein 5 (PABP-5 or PABPC5), polyadenylate-binding
          protein 1-like (PABP-1-like or PABPC1L),
          polyadenylate-binding protein 1-like 2 (PABPC1L2 or
          RBM32), polyadenylate-binding protein 4-like
          (PABP-4-like or PABPC4L), yeast polyadenylate-binding
          protein, cytoplasmic and nuclear (PABP or ACBP-67), and
          similar proteins. PABP-1 is an ubiquitously expressed
          multifunctional protein that may play a role in 3' end
          formation of mRNA, translation initiation, mRNA
          stabilization, protection of poly(A) from nuclease
          activity, mRNA deadenylation, inhibition of mRNA
          decapping, and mRNP maturation. Although PABP-1 is
          thought to be a cytoplasmic protein, it is also found
          in the nucleus. PABP-1 may be involved in
          nucleocytoplasmic trafficking and utilization of mRNP
          particles. PABP-1 contains four copies of RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains), a
          less well conserved linker region, and a proline-rich
          C-terminal conserved domain (CTD). PABP-3 is a
          testis-specific poly(A)-binding protein specifically
          expressed in round spermatids. It is mainly found in
          mammalian and may play an important role in the
          testis-specific regulation of mRNA homeostasis. PABP-3
          shows significant sequence similarity to PABP-1.
          However, it binds to poly(A) with a lower affinity than
          PABP-1. Moreover, PABP-1 possesses an A-rich sequence
          in its 5'-UTR and allows binding of PABP and blockage
          of translation of its own mRNA. In contrast, PABP-3
          lacks the A-rich sequence in its 5'-UTR. PABP-4 is an
          inducible poly(A)-binding protein (iPABP) that is
          primarily localized to the cytoplasm. It shows
          significant sequence similarity to PABP-1 as well. The
          RNA binding properties of PABP-1 and PABP-4 appear to
          be identical. PABP-5 is encoded by PABPC5 gene within
          the X-specific subinterval, and expressed in fetal
          brain and in a range of adult tissues in mammalian,
          such as ovary and testis. It may play an important role
          in germ cell development. Moreover, unlike other PABPs,
          PABP-5 contains only four RRMs, but lacks both the
          linker region and the CTD. PABP-1-like and PABP-1-like
          2 are the orthologs of PABP-1. PABP-4-like is the
          ortholog of PABP-5. Their cellular functions remain
          unclear. The family also includes the yeast PABP, a
          conserved poly(A) binding protein containing poly(A)
          tails that can be attached to the 3'-ends of mRNAs. The
          yeast PABP and its homologs may play important roles in
          the initiation of translation and in mRNA decay. Like
          vertebrate PABP-1, the yeast PABP contains four RRMs, a
          linker region, and a proline-rich CTD as well. The
          first two RRMs are mainly responsible for specific
          binding to poly(A). The proline-rich region may be
          involved in protein-protein interactions. .
          Length = 79

 Score = 29.9 bits (68), Expect = 0.045
 Identities = 13/43 (30%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 28 IKMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          + ++V  +  S+D+  L + FS +G + +  V+ D+  G+SKG
Sbjct: 2  VNLYVKNLDDSIDDERLREEFSPFGTITSAKVMTDE-KGRSKG 43


>gnl|CDD|240966 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA-binding
          protein MRN1 and similar proteins.  This subgroup
          corresponds to the RRM4 of MRN1, also termed multicopy
          suppressor of RSC-NHP6 synthetic lethality protein 1,
          or post-transcriptional regulator of 69 kDa, which is a
          RNA-binding protein found in yeast. Although its
          specific biological role remains unclear, MRN1 might be
          involved in translational regulation. Members in this
          family contain four copies of conserved RNA recognition
          motif (RRM), also known as RBD (RNA binding domain) or
          RNP (ribonucleoprotein domain). .
          Length = 79

 Score = 29.7 bits (67), Expect = 0.053
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 31 FVGQIPRSMDEADLTKMFSEYGRVYNINVLRDK 63
          ++G I  S+ E  L   FS+YG + ++N LR+K
Sbjct: 7  YIGNIDDSLTEEKLRNDFSQYGEIESVNYLREK 39


>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in
          serine/arginine-rich splicing factor 3 (SRSF3) and
          similar proteins.  This subfamily corresponds to the
          RRM of two serine/arginine (SR) proteins,
          serine/arginine-rich splicing factor 3 (SRSF3) and
          serine/arginine-rich splicing factor 7 (SRSF7). SRSF3,
          also termed pre-mRNA-splicing factor SRp20, modulates
          alternative splicing by interacting with RNA
          cis-elements in a concentration- and cell
          differentiation-dependent manner. It is also involved
          in termination of transcription, alternative RNA
          polyadenylation, RNA export, and protein translation.
          SRSF3 is critical for cell proliferation, and tumor
          induction and maintenance. It can shuttle between the
          nucleus and cytoplasm. SRSF7, also termed splicing
          factor 9G8, plays a crucial role in both constitutive
          splicing and alternative splicing of many pre-mRNAs.
          Its localization and functions are tightly regulated by
          phosphorylation. SRSF7 is predominantly present in the
          nuclear and can shuttle between nucleus and cytoplasm.
          It cooperates with the export protein, Tap/NXF1, helps
          mRNA export to the cytoplasm, and enhances the
          expression of unspliced mRNA. Moreover, SRSF7 inhibits
          tau E10 inclusion through directly interacting with the
          proximal downstream intron of E10, a clustering region
          for frontotemporal dementia with Parkinsonism (FTDP)
          mutations. Both SRSF3 and SRSF7 contain a single
          N-terminal RNA recognition motif (RRM), also termed RBD
          (RNA binding domain) or RNP (ribonucleoprotein domain),
          and a C-terminal RS domain rich in serine-arginine
          dipeptides. The RRM domain is involved in RNA binding,
          and the RS domain has been implicated in protein
          shuttling and protein-protein interactions. .
          Length = 73

 Score = 29.5 bits (67), Expect = 0.054
 Identities = 9/33 (27%), Positives = 18/33 (54%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLR 61
          K++VG +     + +L   F +YG + ++ V R
Sbjct: 1  KVYVGNLGPRATKRELEDEFEKYGPLRSVWVAR 33


>gnl|CDD|241204 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA-binding
          protein Musashi homolog 2 (Musashi-2 ) and similar
          proteins.  This subgroup corresponds to the RRM2 of
          Musashi-2 (also termed Msi2) which has been identified
          as a regulator of the hematopoietic stem cell (HSC)
          compartment and of leukemic stem cells after
          transplantation of cells with loss and gain of function
          of the gene. It influences proliferation and
          differentiation of HSCs and myeloid progenitors, and
          further modulates normal hematopoiesis and promotes
          aggressive myeloid leukemia. Musashi-2 contains two
          conserved N-terminal tandem RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), along with other domains
          of unknown function. .
          Length = 76

 Score = 29.7 bits (66), Expect = 0.059
 Identities = 14/42 (33%), Positives = 22/42 (52%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          KMF+G +        L   FS++G +    V+RD  T +S+G
Sbjct: 1  KMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRG 42


>gnl|CDD|240897 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nucleolin-like
          proteins mainly from plants.  This subfamily
          corresponds to the RRM2 of a group of plant
          nucleolin-like proteins, including nucleolin 1 (also
          termed protein nucleolin like 1) and nucleolin 2 (also
          termed protein nucleolin like 2, or protein parallel
          like 1). They play roles in the regulation of ribosome
          synthesis and in the growth and development of plants.
          Like yeast nucleolin, nucleolin-like proteins possess
          two RNA recognition motifs (RRMs), also termed RBDs
          (RNA binding domains) or RNPs (ribonucleoprotein
          domains).  .
          Length = 79

 Score = 29.7 bits (67), Expect = 0.063
 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 4/46 (8%)

Query: 29 KMFVGQIPRSMDEAD----LTKMFSEYGRVYNINVLRDKVTGQSKG 70
           +FV     S+ E D    LT+ FS  G +  +++  D+ TG SKG
Sbjct: 1  TIFVKGFDSSLGEDDIRRSLTEHFSSCGEITRVSIPTDRETGASKG 46


>gnl|CDD|241142 cd12698, RRM3_PTBPH3, RNA recognition motif 3 in plant
          polypyrimidine tract-binding protein homolog 3
          (PTBPH3).  This subgroup corresponds to the RRM3 of
          PTBPH3. Although its biological roles remain unclear,
          PTBPH3 shows significant sequence similarity to
          polypyrimidine tract binding protein (PTB) that is an
          important negative regulator of alternative splicing in
          mammalian cells and also functions at several other
          aspects of mRNA metabolism, including mRNA
          localization, stabilization, polyadenylation, and
          translation. Like PTB, PTBPH3 contains four RNA
          recognition motifs (RRM), also known as RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain). .
          Length = 76

 Score = 29.5 bits (66), Expect = 0.074
 Identities = 10/28 (35%), Positives = 15/28 (53%)

Query: 36 PRSMDEADLTKMFSEYGRVYNINVLRDK 63
          P  +D   L  +FS YG +  I +L +K
Sbjct: 11 PEKIDADKLFNLFSNYGNIVRIKLLHNK 38


>gnl|CDD|240689 cd12243, RRM1_MSSP, RNA recognition motif 1 in the c-myc gene
          single-strand binding proteins (MSSP) family.  This
          subfamily corresponds to the RRM1 of c-myc gene
          single-strand binding proteins (MSSP) family, including
          single-stranded DNA-binding protein MSSP-1 (also termed
          RBMS1 or SCR2) and MSSP-2 (also termed RBMS2 or SCR3).
          All MSSP family members contain two RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), both of which are
          responsible for the specific DNA binding activity.
          Both, MSSP-1 and -2, have been identified as protein
          factors binding to a putative DNA replication
          origin/transcriptional enhancer sequence present
          upstream from the human c-myc gene in both single- and
          double-stranded forms. Thus, they have been implied in
          regulating DNA replication, transcription, apoptosis
          induction, and cell-cycle movement, via the interaction
          with c-MYC, the product of protooncogene c-myc.
          Moreover, the family includes a new member termed
          RNA-binding motif, single-stranded-interacting protein
          3 (RBMS3), which is not a transcriptional regulator.
          RBMS3 binds with high affinity to A/U-rich stretches of
          RNA, and to A/T-rich DNA sequences, and functions as a
          regulator of cytoplasmic activity. In addition, a
          putative meiosis-specific RNA-binding protein termed
          sporulation-specific protein 5 (SPO5, or meiotic
          RNA-binding protein 1, or meiotically up-regulated gene
          12 protein), encoded by Schizosaccharomyces pombe
          Spo5/Mug12 gene, is also included in this family. SPO5
          is a novel meiosis I regulator that may function in the
          vicinity of the Mei2 dot. .
          Length = 71

 Score = 29.1 bits (66), Expect = 0.084
 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 3/53 (5%)

Query: 36 PRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIFEAAF--LKIARAAIE 86
          P +  + DL K+   +G++ +   + DK T + KG  F   F   + A  AIE
Sbjct: 9  PPNTTDEDLEKLCQPFGKIISTKAILDKKTNKCKGYGF-VDFDSPEAALKAIE 60


>gnl|CDD|240791 cd12345, RRM2_SECp43_like, RNA recognition motif 2 in tRNA
          selenocysteine-associated protein 1 (SECp43) and
          similar proteins.  This subfamily corresponds to the
          RRM2 in tRNA selenocysteine-associated protein 1
          (SECp43), yeast negative growth regulatory protein NGR1
          (RBP1), yeast protein NAM8, and similar proteins.
          SECp43 is an RNA-binding protein associated
          specifically with eukaryotic selenocysteine tRNA
          [tRNA(Sec)]. It may play an adaptor role in the
          mechanism of selenocysteine insertion. SECp43 is
          located primarily in the nucleus and contains two
          N-terminal RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), and a C-terminal polar/acidic region. Yeast
          proteins, NGR1 and NAM8, show high sequence similarity
          with SECp43. NGR1 is a putative glucose-repressible
          protein that binds both RNA and single-stranded DNA
          (ssDNA). It may function in regulating cell growth in
          early log phase, possibly through its participation in
          RNA metabolism. NGR1 contains three RRMs, two of which
          are followed by a glutamine-rich stretch that may be
          involved in transcriptional activity. In addition, NGR1
          has an asparagine-rich region near the C-terminus which
          also harbors a methionine-rich region. NAM8 is a
          putative RNA-binding protein that acts as a suppressor
          of mitochondrial splicing deficiencies when
          overexpressed in yeast. It may be a non-essential
          component of the mitochondrial splicing machinery. NAM8
          also contains three RRMs.  .
          Length = 80

 Score = 29.2 bits (66), Expect = 0.094
 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 1/42 (2%)

Query: 30 MFVGQIPRSMDEADLTKMFSE-YGRVYNINVLRDKVTGQSKG 70
          +FVG +   + +  L + F   Y  V    V+ D VTG+SKG
Sbjct: 4  IFVGDLAPDVTDYMLQETFRARYPSVRGAKVVMDPVTGRSKG 45


>gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in
          heterogeneous nuclear ribonucleoprotein A subfamily.
          This subfamily corresponds to the RRM1 in hnRNP A0,
          hnRNP A1, hnRNP A2/B1, hnRNP A3 and similar proteins.
          hnRNP A0 is a low abundance hnRNP protein that has been
          implicated in mRNA stability in mammalian cells. It has
          been identified as the substrate for MAPKAP-K2 and may
          be involved in the lipopolysaccharide (LPS)-induced
          post-transcriptional regulation of tumor necrosis
          factor-alpha (TNF-alpha), cyclooxygenase 2 (COX-2) and
          macrophage inflammatory protein 2 (MIP-2). hnRNP A1 is
          an abundant eukaryotic nuclear RNA-binding protein that
          may modulate splice site selection in pre-mRNA
          splicing. hnRNP A2/B1 is an RNA trafficking response
          element-binding protein that interacts with the hnRNP
          A2 response element (A2RE). Many mRNAs, such as myelin
          basic protein (MBP), myelin-associated oligodendrocytic
          basic protein (MOBP), carboxyanhydrase II (CAII),
          microtubule-associated protein tau, and amyloid
          precursor protein (APP) are trafficked by hnRNP A2/B1.
          hnRNP A3 is also a RNA trafficking response
          element-binding protein that participates in the
          trafficking of A2RE-containing RNA. The hnRNP A
          subfamily is characterized by two RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), followed by a long
          glycine-rich region at the C-terminus. .
          Length = 78

 Score = 29.3 bits (66), Expect = 0.099
 Identities = 12/42 (28%), Positives = 24/42 (57%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          K+F+G +     +  L   FS++G + +  V++D  T +S+G
Sbjct: 1  KLFIGGLSYETTDDSLKNYFSQWGEITDCVVMKDPNTKRSRG 42


>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33
          (Cyp33) and similar proteins.  This subfamily
          corresponds to the RRM of Cyp33, also termed
          peptidyl-prolyl cis-trans isomerase E (PPIase E), or
          cyclophilin E, or rotamase E. Cyp33 is a nuclear
          RNA-binding cyclophilin with an N-terminal RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain), and a
          C-terminal PPIase domain. Cyp33 possesses RNA-binding
          activity and preferentially binds to polyribonucleotide
          polyA and polyU, but hardly to polyG and polyC. It
          binds specifically to mRNA, which can stimulate its
          PPIase activity. Moreover, Cyp33 interacts with the
          third plant homeodomain (PHD3) zinc finger cassette of
          the mixed lineage leukemia (MLL) proto-oncoprotein and
          a poly-A RNA sequence through its RRM domain. It
          further mediates downregulation of the expression of
          MLL target genes HOXC8, HOXA9, CDKN1B, and C-MYC, in a
          proline isomerase-dependent manner. Cyp33 also
          possesses a PPIase activity that catalyzes cis-trans
          isomerization of the peptide bond preceding a proline,
          which has been implicated in the stimulation of folding
          and conformational changes in folded and unfolded
          proteins. The PPIase activity can be inhibited by the
          immunosuppressive drug cyclosporin A. .
          Length = 73

 Score = 28.7 bits (65), Expect = 0.14
 Identities = 11/41 (26%), Positives = 21/41 (51%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          ++VG +   +DE  L   F  +G + +I +  D  T + +G
Sbjct: 1  LYVGGLAEEVDEKVLHAAFIPFGDIKDIQIPLDYETQKHRG 41


>gnl|CDD|240777 cd12331, RRM_NRD1_SEB1_like, RNA recognition motif in
          Saccharomyces cerevisiae protein Nrd1,
          Schizosaccharomyces pombe Rpb7-binding protein seb1 and
          similar proteins.  This subfamily corresponds to the
          RRM of Nrd1 and Seb1. Nrd1 is a novel heterogeneous
          nuclear ribonucleoprotein (hnRNP)-like RNA-binding
          protein encoded by gene NRD1 (for nuclear pre-mRNA
          down-regulation) from yeast S. cerevisiae. It is
          implicated in 3' end formation of small nucleolar and
          small nuclear RNAs transcribed by polymerase II, and
          plays a critical role in pre-mRNA metabolism. Nrd1
          contains an RNA recognition motif (RRM), also termed
          RBD (RNA binding domain) or RNP (ribonucleoprotein
          domain), a short arginine-, serine-, and glutamate-rich
          segment similar to the regions rich in RE and RS
          dipeptides (RE/RS domains) in many metazoan splicing
          factors, and a proline- and glutamine-rich C-terminal
          domain (P+Q domain) similar to domains found in several
          yeast hnRNPs. Disruption of NRD1 gene is lethal to
          yeast cells. Its N-terminal domain is sufficient for
          viability, which may facilitate interactions with RNA
          polymerase II where Nrd1 may function as an auxiliary
          factor. By contrast, the RRM, RE/RS domains, and P+Q
          domain are dispensable. Seb1 is an RNA-binding protein
          encoded by gene seb1 (for seven binding) from fission
          yeast S. pombe. It is essential for cell viability and
          bound directly to Rpb7 subunit of RNA polymerase II.
          Seb1 is involved in processing of polymerase II
          transcripts. It also contains one RRM motif and a
          region rich in arginine-serine dipeptides (RS domain).
          Length = 79

 Score = 28.7 bits (64), Expect = 0.14
 Identities = 11/34 (32%), Positives = 17/34 (50%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDK 63
          +F G +  +M E DL   F  +G V +  +  DK
Sbjct: 6  LFPGGVTFNMIEYDLRSGFGRFGEVQSCILNNDK 39


>gnl|CDD|240916 cd12472, RRM1_RBMS3, RNA recognition motif 1 found in vertebrate
          RNA-binding motif, single-stranded-interacting protein
          3 (RBMS3).  This subgroup corresponds to the RRM1 of
          RBMS3, a new member of the c-myc gene single-strand
          binding proteins (MSSP) family of DNA regulators.
          Unlike other MSSP proteins, RBMS3 is not a
          transcriptional regulator. It binds with high affinity
          to A/U-rich stretches of RNA, and to A/T-rich DNA
          sequences, and functions as a regulator of cytoplasmic
          activity. RBMS3 contains two N-terminal RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), and its C-terminal
          region is acidic and enriched in prolines, glutamines
          and threonines. .
          Length = 80

 Score = 28.6 bits (63), Expect = 0.14
 Identities = 13/44 (29%), Positives = 23/44 (52%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          +++  +P    + DL K+   YG++ +   + DK T Q KG  F
Sbjct: 7  LYIRGLPPGTTDQDLIKLCQPYGKIVSTKAILDKNTNQCKGYGF 50


>gnl|CDD|240967 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA-binding
          protein MRN1 and similar proteins.  This subgroup
          corresponds to the RRM2 of MRN1, also termed multicopy
          suppressor of RSC-NHP6 synthetic lethality protein 1,
          or post-transcriptional regulator of 69 kDa, which is a
          RNA-binding protein found in yeast. Although its
          specific biological role remains unclear, MRN1 might be
          involved in translational regulation. Members in this
          family contain four copies of conserved RNA recognition
          motif (RRM), also known as RBD (RNA binding domain) or
          RNP (ribonucleoprotein domain). .
          Length = 78

 Score = 28.6 bits (64), Expect = 0.18
 Identities = 8/34 (23%), Positives = 21/34 (61%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDK 63
          +++G +P S  E +L +   ++G +  I ++++K
Sbjct: 6  VYIGNLPESYSEEELREDLEKFGPIDQIKIVKEK 39


>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I
          polyadenylate-binding proteins.  This subfamily
          corresponds to the RRM2 of type I poly(A)-binding
          proteins (PABPs), highly conserved proteins that bind
          to the poly(A) tail present at the 3' ends of most
          eukaryotic mRNAs. They have been implicated in the
          regulation of poly(A) tail length during the
          polyadenylation reaction, translation initiation, mRNA
          stabilization by influencing the rate of deadenylation
          and inhibition of mRNA decapping. The family represents
          type I polyadenylate-binding proteins (PABPs),
          including polyadenylate-binding protein 1 (PABP-1 or
          PABPC1), polyadenylate-binding protein 3 (PABP-3 or
          PABPC3), polyadenylate-binding protein 4 (PABP-4 or
          APP-1 or iPABP), polyadenylate-binding protein 5
          (PABP-5 or PABPC5), polyadenylate-binding protein
          1-like (PABP-1-like or PABPC1L), polyadenylate-binding
          protein 1-like 2 (PABPC1L2 or RBM32),
          polyadenylate-binding protein 4-like (PABP-4-like or
          PABPC4L), yeast polyadenylate-binding protein,
          cytoplasmic and nuclear (PABP or ACBP-67), and similar
          proteins. PABP-1 is a ubiquitously expressed
          multifunctional protein that may play a role in 3' end
          formation of mRNA, translation initiation, mRNA
          stabilization, protection of poly(A) from nuclease
          activity, mRNA deadenylation, inhibition of mRNA
          decapping, and mRNP maturation. Although PABP-1 is
          thought to be a cytoplasmic protein, it is also found
          in the nucleus. PABP-1 may be involved in
          nucleocytoplasmic trafficking and utilization of mRNP
          particles. PABP-1 contains four copies of RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains), a
          less well conserved linker region, and a proline-rich
          C-terminal conserved domain (CTD). PABP-3 is a
          testis-specific poly(A)-binding protein specifically
          expressed in round spermatids. It is mainly found in
          mammalian and may play an important role in the
          testis-specific regulation of mRNA homeostasis. PABP-3
          shows significant sequence similarity to PABP-1.
          However, it binds to poly(A) with a lower affinity than
          PABP-1. Moreover, PABP-1 possesses an A-rich sequence
          in its 5'-UTR and allows binding of PABP and blockage
          of translation of its own mRNA. In contrast, PABP-3
          lacks the A-rich sequence in its 5'-UTR. PABP-4 is an
          inducible poly(A)-binding protein (iPABP) that is
          primarily localized to the cytoplasm. It shows
          significant sequence similarity to PABP-1 as well. The
          RNA binding properties of PABP-1 and PABP-4 appear to
          be identical. PABP-5 is encoded by PABPC5 gene within
          the X-specific subinterval, and expressed in fetal
          brain and in a range of adult tissues in mammalian,
          such as ovary and testis. It may play an important role
          in germ cell development. Unlike other PABPs, PABP-5
          contains only four RRMs, but lacks both the linker
          region and the CTD. PABP-1-like and PABP-1-like 2 are
          the orthologs of PABP-1. PABP-4-like is the ortholog of
          PABP-5. Their cellular functions remain unclear. The
          family also includes the yeast PABP, a conserved
          poly(A) binding protein containing poly(A) tails that
          can be attached to the 3'-ends of mRNAs. The yeast PABP
          and its homologs may play important roles in the
          initiation of translation and in mRNA decay. Like
          vertebrate PABP-1, the yeast PABP contains four RRMs, a
          linker region, and a proline-rich CTD as well. The
          first two RRMs are mainly responsible for specific
          binding to poly(A). The proline-rich region may be
          involved in protein-protein interactions. .
          Length = 77

 Score = 28.3 bits (64), Expect = 0.19
 Identities = 20/62 (32%), Positives = 28/62 (45%), Gaps = 12/62 (19%)

Query: 31 FVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF------EAAFLKIARAA 84
          F+  + +S+D   L   FS +G + +  V  D+  G SKG  F      EA     A  A
Sbjct: 6  FIKNLDKSIDNKALYDTFSAFGNILSCKVATDE-NGGSKGYGFVHFETEEA-----AVRA 59

Query: 85 IE 86
          IE
Sbjct: 60 IE 61


>gnl|CDD|240847 cd12401, RRM_eIF4H, RNA recognition motif in eukaryotic
          translation initiation factor 4H (eIF-4H) and similar
          proteins.  This subfamily corresponds to the RRM of
          eIF-4H, also termed Williams-Beuren syndrome
          chromosomal region 1 protein, which, together with
          elf-4B/eIF-4G, serves as the accessory protein of RNA
          helicase eIF-4A. eIF-4H contains a well conserved RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain). It
          stimulates protein synthesis by enhancing the helicase
          activity of eIF-4A in the initiation step of mRNA
          translation. .
          Length = 76

 Score = 28.4 bits (64), Expect = 0.20
 Identities = 14/40 (35%), Positives = 24/40 (60%), Gaps = 1/40 (2%)

Query: 31 FVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          FVG +P +  + DL  +F +   V ++ ++RDK T + KG
Sbjct: 5  FVGNLPFNTVQGDLDAIFKDL-SVKSVRLVRDKETDKFKG 43


>gnl|CDD|240914 cd12470, RRM1_MSSP1, RNA recognition motif 1 in vertebrate
          single-stranded DNA-binding protein MSSP-1.  This
          subgroup corresponds to the RRM1 of MSSP-1, also termed
          RNA-binding motif, single-stranded-interacting protein
          1 (RBMS1), or suppressor of CDC2 with RNA-binding motif
          2 (SCR2), a double- and single-stranded DNA binding
          protein that belongs to the c-myc single-strand binding
          proteins (MSSP) family. It specifically recognizes the
          sequence CT(A/T)(A/T)T, and stimulates DNA replication
          in the system using SV40 DNA. MSSP-1 is identical with
          Scr2, a human protein which complements the defect of
          cdc2 kinase in Schizosaccharomyces pombe. MSSP-1 has
          been implied in regulating DNA replication,
          transcription, apoptosis induction, and cell-cycle
          movement, via the interaction with C-MYC, the product
          of protooncogene c-myc. MSSP-1 contains two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          both of which are responsible for the specific DNA
          binding activity as well as induction of apoptosis. .
          Length = 86

 Score = 28.6 bits (63), Expect = 0.20
 Identities = 12/44 (27%), Positives = 24/44 (54%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          +++  +P +  + DL K+   YG++ +   + DK T + KG  F
Sbjct: 10 LYIRGLPPNTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYGF 53


>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated
          protein SR140 and similar proteins.  This subgroup
          corresponds to the RRM of SR140 (also termed U2
          snRNP-associated SURP motif-containing protein
          orU2SURP, or 140 kDa Ser/Arg-rich domain protein) which
          is a putative splicing factor mainly found in higher
          eukaryotes. Although it is initially identified as one
          of the 17S U2 snRNP-associated proteins, the molecular
          and physiological function of SR140 remains unclear.
          SR140 contains an N-terminal RNA recognition motif
          (RRM), also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), a SWAP/SURP domain that is
          found in a number of pre-mRNA splicing factors in the
          middle region, and a C-terminal arginine/serine-rich
          domain (RS domain).
          Length = 84

 Score = 28.4 bits (64), Expect = 0.22
 Identities = 6/31 (19%), Positives = 17/31 (54%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVL 60
          ++VG +   + E  L + F  +G + ++ ++
Sbjct: 4  LYVGNLNPKVTEEVLCQEFGRFGPLASVKIM 34


>gnl|CDD|241042 cd12598, RRM1_SRSF9, RNA recognition motif 1 in vertebrate
          serine/arginine-rich splicing factor 9 (SRSF9).  This
          subgroup corresponds to the RRM1 of SRSF9, also termed
          pre-mRNA-splicing factor SRp30C. SRSF9 is an essential
          splicing regulatory serine/arginine (SR) protein that
          has been implicated in the activity of many elements
          that control splice site selection, the alternative
          splicing of the glucocorticoid receptor beta in
          neutrophils and in the gonadotropin-releasing hormone
          pre-mRNA. SRSF9 can also interact with other proteins
          implicated in alternative splicing, including YB-1,
          rSLM-1, rSLM-2, E4-ORF4, Nop30, and p32. SRSF9 contains
          two N-terminal RNA recognition motifs (RRMs), also
          termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), followed by an unusually
          short C-terminal RS domains rich in serine-arginine
          dipeptides. .
          Length = 72

 Score = 27.8 bits (62), Expect = 0.23
 Identities = 11/29 (37%), Positives = 20/29 (68%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNI 57
          +++VG +P  + E DL  +F +YGR+ +I
Sbjct: 1  RIYVGNLPSDVREKDLEDLFYKYGRIRDI 29


>gnl|CDD|240755 cd12309, RRM2_Spen, RNA recognition motif 2 in the Spen (split
          end) protein family.  This subfamily corresponds to the
          RRM2 domain in the Spen (split end) protein family
          which includes RNA binding motif protein 15 (RBM15),
          putative RNA binding motif protein 15B (RBM15B), and
          similar proteins found in Metazoa. RBM15, also termed
          one-twenty two protein 1 (OTT1), conserved in
          eukaryotes, is a novel mRNA export factor and component
          of the NXF1 pathway. It binds to NXF1 and serves as
          receptor for the RNA export element RTE. It also
          possess mRNA export activity and can facilitate the
          access of DEAD-box protein DBP5 to mRNA at the nuclear
          pore complex (NPC). RNA-binding protein 15B (RBM15B),
          also termed one twenty-two 3 (OTT3), is a paralog of
          RBM15 and therefore has post-transcriptional regulatory
          activity. It is a nuclear protein sharing with RBM15
          the association with the splicing factor compartment
          and the nuclear envelope as well as the binding to mRNA
          export factors NXF1 and Aly/REF. Members in this family
          belong to the Spen (split end) protein family, which
          share a domain architecture comprising of three
          N-terminal RNA recognition motifs (RRMs), also known as
          RBD (RNA binding domain) or RNP (ribonucleoprotein
          domain), and a C-terminal SPOC (Spen paralog and
          ortholog C-terminal) domain. .
          Length = 79

 Score = 28.1 bits (63), Expect = 0.23
 Identities = 10/32 (31%), Positives = 20/32 (62%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLR 61
          +FVG +  ++ E +L + F  YG V ++++ R
Sbjct: 5  LFVGNLEITITEEELRRAFERYGVVEDVDIKR 36


>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit,
           splicing factor.  These splicing factors consist of an
           N-terminal arginine-rich low complexity domain followed
           by three tandem RNA recognition motifs (pfam00076). The
           well-characterized members of this family are auxilliary
           components of the U2 small nuclear ribonuclearprotein
           splicing factor (U2AF). These proteins are closely
           related to the CC1-like subfamily of splicing factors
           (TIGR01622). Members of this subfamily are found in
           plants, metazoa and fungi.
          Length = 509

 Score = 29.1 bits (65), Expect = 0.26
 Identities = 15/60 (25%), Positives = 32/60 (53%), Gaps = 4/60 (6%)

Query: 14  VRSMSLPEQPDPDFIKMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
           V S ++ +  D    ++++G +P  + E  + ++   +G +   N+++D  TG SKG  F
Sbjct: 286 VNSTTVLDSKD----RIYIGNLPLYLGEDQIKELLESFGDLKAFNLIKDIATGLSKGYAF 341


>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in
          (U)-binding-splicing factor PUF60 and similar proteins.
           This subfamily corresponds to the RRM2 of PUF60, also
          termed FUSE-binding protein-interacting repressor
          (FBP-interacting repressor or FIR), or Ro-binding
          protein 1 (RoBP1), or Siah-binding protein 1
          (Siah-BP1). PUF60 is an essential splicing factor that
          functions as a poly-U RNA-binding protein required to
          reconstitute splicing in depleted nuclear extracts. Its
          function is enhanced through interaction with U2
          auxiliary factor U2AF65. PUF60 also controls human
          c-myc gene expression by binding and inhibiting the
          transcription factor far upstream sequence element
          (FUSE)-binding-protein (FBP), an activator of c-myc
          promoters. PUF60 contains two central RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), and a C-terminal
          U2AF (U2 auxiliary factor) homology motifs (UHM) that
          harbors another RRM and binds to tryptophan-containing
          linear peptide motifs (UHM ligand motifs, ULMs) in
          several nuclear proteins. Research indicates that PUF60
          binds FUSE as a dimer, and only the first two RRM
          domains participate in the single-stranded DNA
          recognition. .
          Length = 77

 Score = 28.0 bits (63), Expect = 0.27
 Identities = 10/42 (23%), Positives = 24/42 (57%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          +++V  +   + E D+  +F  +G++ + ++  D  TG+ KG
Sbjct: 2  RIYVASVHPDLSEDDIKSVFEAFGKIKSCSLAPDPETGKHKG 43


>gnl|CDD|240783 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 in
          serine/arginine-rich splicing factor 4 (SRSF4) and
          similar proteins.  This subfamily corresponds to the
          RRM1 in three serine/arginine (SR) proteins:
          serine/arginine-rich splicing factor 4 (SRSF4 or SRp75
          or SFRS4), serine/arginine-rich splicing factor 5
          (SRSF5 or SRp40 or SFRS5 or HRS), serine/arginine-rich
          splicing factor 6 (SRSF6 or SRp55). SRSF4 plays an
          important role in both, constitutive  and alternative,
          splicing of many pre-mRNAs. It can shuttle between the
          nucleus and cytoplasm. SRSF5 regulates both alternative
          splicing and basal splicing. It is the only SR protein
          efficiently selected from nuclear extracts (NE) by the
          splicing enhancer (ESE) and essential for enhancer
          activation. SRSF6 preferentially interacts with a
          number of purine-rich splicing enhancers (ESEs) to
          activate splicing of the ESE-containing exon. It is the
          only protein from HeLa nuclear extract or purified SR
          proteins that specifically binds B element RNA after UV
          irradiation. SRSF6 may also recognize different types
          of RNA sites. Members in this family contain two
          N-terminal RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), followed by a C-terminal RS domains rich in
          serine-arginine dipeptides. .
          Length = 70

 Score = 27.7 bits (62), Expect = 0.27
 Identities = 10/31 (32%), Positives = 20/31 (64%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINV 59
          ++++G++P    E D+ + F  YGR+  IN+
Sbjct: 1  RVYIGRLPYRARERDVERFFKGYGRIREINL 31


>gnl|CDD|240833 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 in
          heterogeneous nuclear ribonucleoprotein M (hnRNP M) and
          similar proteins.  This subfamily corresponds to the
          RRM3 of heterogeneous nuclear ribonucleoprotein M
          (hnRNP M), myelin expression factor 2 (MEF-2 or MyEF-2
          or MST156) and similar proteins. hnRNP M is pre-mRNA
          binding protein that may play an important role in the
          pre-mRNA processing. It also preferentially binds to
          poly(G) and poly(U) RNA homopolymers. hnRNP M is able
          to interact with early spliceosomes, further
          influencing splicing patterns of specific pre-mRNAs.
          hnRNP M functions as the receptor of carcinoembryonic
          antigen (CEA) that contains the penta-peptide sequence
          PELPK signaling motif. In addition, hnRNP M and another
          splicing factor Nova-1 work together as dopamine D2
          receptor (D2R) pre-mRNA-binding proteins. They regulate
          alternative splicing of D2R pre-mRNA in an antagonistic
          manner. hnRNP M contains three RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and an unusual
          hexapeptide-repeat region rich in methionine and
          arginine residues (MR repeat motif). MEF-2 is a
          sequence-specific single-stranded DNA (ssDNA) binding
          protein that binds specifically to ssDNA derived from
          the proximal (MB1) element of the myelin basic protein
          (MBP) promoter and represses transcription of the MBP
          gene. MEF-2 shows high sequence homology with hnRNP M.
          It also contains three RRMs, which may be responsible
          for its ssDNA binding activity. .
          Length = 72

 Score = 27.6 bits (62), Expect = 0.29
 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 6/59 (10%)

Query: 31 FVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGK---IFEAAFLKIARAAIE 86
          FV  +P S+   DL  +F E G V   +V  D   G+SKG    +FE+   + A+ AIE
Sbjct: 2  FVRNLPFSVTWQDLKDLFRECGNVLRADVKTDN-DGRSKGFGTVLFESP--EDAQRAIE 57


>gnl|CDD|240995 cd12551, RRM_II_PABPN1L, RNA recognition motif in vertebrate type
          II embryonic polyadenylate-binding protein 2 (ePABP-2).
           This subgroup corresponds to the RRM of ePABP-2, also
          termed embryonic poly(A)-binding protein 2, or
          poly(A)-binding protein nuclear-like 1 (PABPN1L).
          ePABP-2 is a novel embryonic-specific cytoplasmic type
          II poly(A)-binding protein that is expressed during the
          early stages of vertebrate development and in adult
          ovarian tissue. It may play an important role in the
          poly(A) metabolism of stored mRNAs during early
          vertebrate development. ePABP-2 shows significant
          sequence similarity to the ubiquitously expressed
          nuclear polyadenylate-binding protein 2 (PABP-2 or
          PABPN1). Like PABP-2, ePABP-2 contains one RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain), which is
          responsible for the poly(A) binding. In addition, it
          possesses an acidic N-terminal domain predicted to form
          a coiled-coil and an arginine-rich C-terminal domain. .
          Length = 77

 Score = 27.9 bits (62), Expect = 0.30
 Identities = 12/41 (29%), Positives = 20/41 (48%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          ++VG +       +L   FS  G +  + +L DK +G  KG
Sbjct: 2  VYVGNVDYGSTAEELEAHFSGCGPINRVTILCDKFSGHPKG 42


>gnl|CDD|241206 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 in heterogeneous
          nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and
          similar proteins.  This subgroup corresponds to the
          RRM1 of hnRNP A2/B1 which is an RNA trafficking
          response element-binding protein that interacts with
          the hnRNP A2 response element (A2RE). Many mRNAs, such
          as myelin basic protein (MBP), myelin-associated
          oligodendrocytic basic protein (MOBP), carboxyanhydrase
          II (CAII), microtubule-associated protein tau, and
          amyloid precursor protein (APP) are trafficked by hnRNP
          A2/B1. hnRNP A2/B1 also functions as a splicing factor
          that regulates alternative splicing of the tumor
          suppressors, such as BIN1, WWOX, the antiapoptotic
          proteins c-FLIP and caspase-9B, the insulin receptor
          (IR), and the RON proto-oncogene among others.
          Moreover, the overexpression of hnRNP A2/B1 has been
          described in many cancers. It functions as a nuclear
          matrix protein involving in RNA synthesis and the
          regulation of cellular migration through alternatively
          splicing pre-mRNA. It may play a role in tumor cell
          differentiation. hnRNP A2/B1 contains two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          followed by a long glycine-rich region at the
          C-terminus. .
          Length = 81

 Score = 27.8 bits (61), Expect = 0.30
 Identities = 12/44 (27%), Positives = 25/44 (56%)

Query: 27 FIKMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          F K+F+G +     E  L   + ++G++ +  V+RD  + +S+G
Sbjct: 2  FRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRG 45


>gnl|CDD|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split
          end) protein family.  This subfamily corresponds to the
          RRM3 domain in the Spen (split end) protein family
          which includes RNA binding motif protein 15 (RBM15),
          putative RNA binding motif protein 15B (RBM15B) and
          similar proteins found in Metazoa. RBM15, also termed
          one-twenty two protein 1 (OTT1), conserved in
          eukaryotes, is a novel mRNA export factor and is a
          novel component of the NXF1 pathway. It binds to NXF1
          and serves as receptor for the RNA export element RTE.
          It also possess mRNA export activity and can facilitate
          the access of DEAD-box protein DBP5 to mRNA at the
          nuclear pore complex (NPC). RNA-binding protein 15B
          (RBM15B), also termed one twenty-two 3 (OTT3), is a
          paralog of RBM15 and therefore has post-transcriptional
          regulatory activity. It is a nuclear protein sharing
          with RBM15 the association with the splicing factor
          compartment and the nuclear envelope as well as the
          binding to mRNA export factors NXF1 and Aly/REF.
          Members in this family belong to the Spen (split end)
          protein family, which shares a domain architecture
          comprising of three N-terminal RNA recognition motifs
          (RRMs), also known as RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), and a C-terminal SPOC (Spen
          paralog and ortholog C-terminal) domain. .
          Length = 72

 Score = 27.6 bits (62), Expect = 0.32
 Identities = 7/34 (20%), Positives = 16/34 (47%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDK 63
          ++VG +      A+L + F  +G +  I+    +
Sbjct: 1  LWVGGLGPWTSLAELEREFDRFGAIRRIDYDPGR 34


>gnl|CDD|240803 cd12357, RRM_PPARGC1A_like, RNA recognition motif in the
          peroxisome proliferator-activated receptor gamma
          coactivator 1A (PGC-1alpha) family of regulated
          coactivators.  This subfamily corresponds to the RRM of
          PGC-1alpha, PGC-1beta, and PGC-1-related coactivator
          (PRC), which serve as mediators between environmental
          or endogenous signals and the transcriptional machinery
          governing mitochondrial biogenesis. They play an
          important integrative role in the control of
          respiratory gene expression through interacting with a
          number of transcription factors, such as NRF-1, NRF-2,
          ERR, CREB and YY1. All family members are multi-domain
          proteins containing the N-terminal activation domain,
          an LXXLL coactivator signature, a tetrapeptide motif
          (DHDY) responsible for HCF binding, and an RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain). In contrast
          to PGC-1alpha and PRC, PGC-1beta possesses two
          glutamic/aspartic acid-rich acidic domains, but lacks
          most of the arginine/serine (SR)-rich domain that is
          responsible for the regulation of RNA processing. .
          Length = 89

 Score = 27.7 bits (62), Expect = 0.36
 Identities = 8/30 (26%), Positives = 17/30 (56%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINV 59
          ++VG+IP     ++L + F  +G +  I +
Sbjct: 5  IYVGKIPIDTTRSELRQRFQPFGEIEEITL 34


>gnl|CDD|240742 cd12296, RRM1_Prp24, RNA recognition motif 1 in fungal
          pre-messenger RNA splicing protein 24 (Prp24) and
          similar proteins.  This subfamily corresponds to the
          RRM1 of Prp24, also termed U4/U6
          snRNA-associated-splicing factor PRP24 (U4/U6 snRNP),
          an RNA-binding protein with four well conserved RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          It facilitates U6 RNA base-pairing with U4 RNA during
          spliceosome assembly. Prp24 specifically binds free U6
          RNA primarily with RRMs 1 and 2 and facilitates pairing
          of U6 RNA bases with U4 RNA bases. Additionally, it may
          also be involved in dissociation of the U4/U6 complex
          during spliceosome activation. .
          Length = 71

 Score = 27.2 bits (61), Expect = 0.38
 Identities = 5/32 (15%), Positives = 14/32 (43%)

Query: 31 FVGQIPRSMDEADLTKMFSEYGRVYNINVLRD 62
           V  +P+   E  + + F + G +  + ++  
Sbjct: 4  KVKNLPKDTTENKIRQFFKDCGEIREVKIVES 35


>gnl|CDD|240978 cd12534, RRM_SARFH, RNA recognition motif in Drosophila
          melanogaster RNA-binding protein cabeza and similar
          proteins.  This subgroup corresponds to the RRM in
          cabeza, also termed P19, or sarcoma-associated
          RNA-binding fly homolog (SARFH). It is a putative
          homolog of human RNA-binding proteins FUS (also termed
          TLS or Pigpen or hnRNP P2), EWS (also termed EWSR1),
          TAF15 (also termed hTAFII68 or TAF2N or RPB56), and
          belongs to the of the FET (previously TET) (FUS/TLS,
          EWS, TAF15) family of RNA- and DNA-binding proteins
          whose expression is altered in cancer. It is a nuclear
          RNA binding protein that may play an important role in
          the regulation of RNA metabolism during fly
          development. Cabeza contains one RNA recognition motif
          (RRM), also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain). .
          Length = 83

 Score = 27.8 bits (62), Expect = 0.38
 Identities = 20/67 (29%), Positives = 30/67 (44%), Gaps = 13/67 (19%)

Query: 31 FVGQIPRSMDEADLTKMFSEYGRVY--------NINVLRDKVTGQSKGK---IFEAAFLK 79
          FV  +P +  E DL + F   G +          I + +DK TG+ KG+    ++     
Sbjct: 2  FVSNLPPNTTEQDLAEHFGSIGIIKIDKKTGKPKIWLYKDKDTGEPKGEATVTYDDPH-- 59

Query: 80 IARAAIE 86
           A AAIE
Sbjct: 60 AASAAIE 66


>gnl|CDD|241054 cd12610, RRM1_SECp43, RNA recognition motif 1 in tRNA
          selenocysteine-associated protein 1 (SECp43).  This
          subgroup corresponds to the RRM1 of SECp43, an
          RNA-binding protein associated specifically with
          eukaryotic selenocysteine tRNA [tRNA(Sec)]. It may play
          an adaptor role in the mechanism of selenocysteine
          insertion. SECp43 is located primarily in the nucleus
          and contains two N-terminal RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a C-terminal
          polar/acidic region. .
          Length = 84

 Score = 27.7 bits (62), Expect = 0.41
 Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 1/36 (2%)

Query: 39 MDEADLTKMFSEYGR-VYNINVLRDKVTGQSKGKIF 73
          MDE  + + F+  G  V ++ ++R+K+TG   G  F
Sbjct: 11 MDENFIKRAFASMGETVLSVKIIRNKLTGGPAGYCF 46


>gnl|CDD|241020 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA-binding protein
          Musashi homolog Musashi-1, Musashi-2 and similar
          proteins.  This subfamily corresponds to the RRM1 in
          Musashi-1 and Musashi-2. Musashi-1 (also termed Msi1)
          is a neural RNA-binding protein putatively expressed in
          central nervous system (CNS) stem cells and neural
          progenitor cells, and associated with asymmetric
          divisions in neural progenitor cells. It is
          evolutionarily conserved from invertebrates to
          vertebrates. Musashi-1 is a homolog of Drosophila
          Musashi and Xenopus laevis nervous system-specific RNP
          protein-1 (Nrp-1). It has been implicated in the
          maintenance of the stem-cell state, differentiation,
          and tumorigenesis. It translationally regulates the
          expression of a mammalian numb gene by binding to the
          3'-untranslated region of mRNA of Numb, encoding a
          membrane-associated inhibitor of Notch signaling, and
          further influences neural development. Moreover,
          Musashi-1 represses translation by interacting with the
          poly(A)-binding protein and competes for binding of the
          eukaryotic initiation factor-4G (eIF-4G). Musashi-2
          (also termed Msi2) has been identified as a regulator
          of the hematopoietic stem cell (HSC) compartment and of
          leukemic stem cells after transplantation of cells with
          loss and gain of function of the gene. It influences
          proliferation and differentiation of HSCs and myeloid
          progenitors, and further modulates normal hematopoiesis
          and promotes aggressive myeloid leukemia. Both,
          Musashi-1 and Musashi-2, contain two conserved
          N-terminal tandem RNA recognition motifs (RRMs), also
          termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), along with other domains
          of unknown function. .
          Length = 75

 Score = 27.4 bits (61), Expect = 0.44
 Identities = 13/41 (31%), Positives = 22/41 (53%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          MF+G +        L + FS++G +    V+RD  T +S+G
Sbjct: 1  MFIGGLSWQTTAEGLREYFSKFGEIKECMVMRDPTTKRSRG 41


>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA
          binding protein fox-1 homologs and similar proteins.
          This subfamily corresponds to the RRM of several
          tissue-specific alternative splicing isoforms of
          vertebrate RNA binding protein Fox-1 homologs, which
          show high sequence similarity to the Caenorhabditis
          elegans feminizing locus on X (Fox-1) gene encoding
          Fox-1 protein. RNA binding protein Fox-1 homolog 1
          (RBFOX1), also termed ataxin-2-binding protein 1
          (A2BP1), or Fox-1 homolog A, or
          hexaribonucleotide-binding protein 1 (HRNBP1), is
          predominantly expressed in neurons, skeletal muscle and
          heart. It regulates alternative splicing of
          tissue-specific exons by binding to UGCAUG elements.
          Moreover, RBFOX1 binds to the C-terminus of ataxin-2
          and forms an ataxin-2/A2BP1 complex involved in RNA
          processing. RNA binding protein fox-1 homolog 2
          (RBFOX2), also termed Fox-1 homolog B, or
          hexaribonucleotide-binding protein 2 (HRNBP2), or
          RNA-binding motif protein 9 (RBM9), or repressor of
          tamoxifen transcriptional activity, is expressed in
          ovary, whole embryo, and human embryonic cell lines in
          addition to neurons and muscle. RBFOX2 activates
          splicing of neuron-specific exons through binding to
          downstream UGCAUG elements. RBFOX2 also functions as a
          repressor of tamoxifen activation of the estrogen
          receptor. RNA binding protein Fox-1 homolog 3 (RBFOX3
          or NeuN or HRNBP3), also termed Fox-1 homolog C, is a
          nuclear RNA-binding protein that regulates alternative
          splicing of the RBFOX2 pre-mRNA, producing a message
          encoding a dominant negative form of the RBFOX2
          protein. Its message is detected exclusively in
          post-mitotic regions of embryonic brain. Like RBFOX1,
          both RBFOX2 and RBFOX3 bind to the hexanucleotide
          UGCAUG elements and modulate brain and muscle-specific
          splicing of exon EIIIB of fibronectin, exon N1 of
          c-src, and calcitonin/CGRP. Members in this family also
          harbor one RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains). .
          Length = 76

 Score = 27.4 bits (61), Expect = 0.45
 Identities = 8/32 (25%), Positives = 19/32 (59%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVL 60
          ++ V  IP    + DL +MF ++G + ++ ++
Sbjct: 2  RLHVSNIPFRFRDPDLRQMFGQFGPILDVEII 33


>gnl|CDD|241016 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA-binding
          protein Musashi homolog 1 (Musashi-1) and similar
          proteins.  This subgroup corresponds to the RRM2 of
          Musashi-1. The mammalian MSI1 gene encoding Musashi-1
          (also termed Msi1) is a neural RNA-binding protein
          putatively expressed in central nervous system (CNS)
          stem cells and neural progenitor cells, and associated
          with asymmetric divisions in neural progenitor cells.
          Musashi-1 is evolutionarily conserved from
          invertebrates to vertebrates. It is a homolog of
          Drosophila Musashi and Xenopus laevis nervous
          system-specific RNP protein-1 (Nrp-1) and has been
          implicated in the maintenance of the stem-cell state,
          differentiation, and tumorigenesis. It translationally
          regulates the expression of a mammalian numb gene by
          binding to the 3'-untranslated region of mRNA of Numb,
          encoding a membrane-associated inhibitor of Notch
          signaling, and further influences neural development.
          It represses translation by interacting with the
          poly(A)-binding protein and competes for binding of the
          eukaryotic initiation factor-4G (eIF-4G). Musashi-1
          contains two conserved N-terminal tandem RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          along with other domains of unknown function. .
          Length = 74

 Score = 27.3 bits (60), Expect = 0.52
 Identities = 12/42 (28%), Positives = 25/42 (59%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          K+FVG +  +    D+ + F ++G+V +  ++ DK T + +G
Sbjct: 1  KIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRG 42


>gnl|CDD|241029 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in heterogeneous
          nuclear ribonucleoprotein D-like (hnRNP DL) and similar
          proteins.  This subgroup corresponds to the RRM2 of
          hnRNP DL (or hnRNP D-like), also termed AU-rich element
          RNA-binding factor, or JKT41-binding protein (protein
          laAUF1 or JKTBP), is a dual functional protein that
          possesses DNA- and RNA-binding properties. It has been
          implicated in mRNA biogenesis at the transcriptional
          and post-transcriptional levels. hnRNP DL binds
          single-stranded DNA (ssDNA) or double-stranded DNA
          (dsDNA) in a non-sequencespecific manner, and interacts
          with poly(G) and poly(A) tenaciously. It contains two
          putative two RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), and a glycine- and tyrosine-rich C-terminus.
          .
          Length = 75

 Score = 27.3 bits (60), Expect = 0.55
 Identities = 13/45 (28%), Positives = 22/45 (48%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          K+FVG +     E  + + F  +G + NI +  D  T + +G  F
Sbjct: 1  KVFVGGLSPDTTEEQIKEYFGAFGEIENIELPMDTKTNERRGFCF 45


>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in
          RNA-binding protein 19 (RBM19 or RBD-1) and RNA
          recognition motif 5 in multiple RNA-binding
          domain-containing protein 1 (MRD1).  This subfamily
          corresponds to the RRM6 of RBM19 and RRM5 of MRD1.
          RBM19, also termed RNA-binding domain-1 (RBD-1), is a
          nucleolar protein conserved in eukaryotes. It is
          involved in ribosome biogenesis by processing rRNA and
          is essential for preimplantation development. It has a
          unique domain organization containing 6 conserved RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          MRD1 is encoded by a novel yeast gene MRD1 (multiple
          RNA-binding domain). It is well-conserved in yeast and
          its homologs exist in all eukaryotes. MRD1 is present
          in the nucleolus and the nucleoplasm. It interacts with
          the 35 S precursor rRNA (pre-rRNA) and U3 small
          nucleolar RNAs (snoRNAs). It is essential for the
          initial processing at the A0-A2 cleavage sites in the
          35 S pre-rRNA. MRD1 contains 5 conserved RRMs, which
          may play an important structural role in organizing
          specific rRNA processing events. .
          Length = 76

 Score = 26.8 bits (60), Expect = 0.59
 Identities = 16/59 (27%), Positives = 32/59 (54%), Gaps = 2/59 (3%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF-EAAFLKIARAAIE 86
          K+ V  +P    + +L ++FS +G+V ++ + + K  G  +G  F E    + A+ A+E
Sbjct: 2  KLIVRNVPFEATKKELRELFSPFGQVKSVRLPK-KFDGSHRGFAFVEFVTKQEAQNAME 59


>gnl|CDD|241039 cd12595, RRM1_SRSF5, RNA recognition motif 1 in vertebrate
          serine/arginine-rich splicing factor 5 (SRSF5).  This
          subgroup corresponds to the RRM1 of SRSF5, also termed
          delayed-early protein HRS, or pre-mRNA-splicing factor
          SRp40, or splicing factor, arginine/serine-rich 5
          (SFRS5). SFSF5 is an essential splicing regulatory
          serine/arginine (SR) protein that regulates both
          alternative splicing and basal splicing. It is the only
          SR protein efficiently selected from nuclear extracts
          (NE) by the splicing enhancer (ESE) and it is necessary
          for enhancer activation. SRSF5 also functions as a
          factor required for insulin-regulated splice site
          selection for protein kinase C (PKC) betaII mRNA. It is
          involved in the regulation of PKCbetaII exon inclusion
          by insulin via its increased phosphorylation by a
          phosphatidylinositol 3-kinase (PI 3-kinase) signaling
          pathway. Moreover, SRSF5 can regulate alternative
          splicing in exon 9 of glucocorticoid receptor pre-mRNA
          in a dose-dependent manner. SRSF5 contains two
          N-terminal RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), followed by a C-terminal RS domains rich in
          serine-arginine dipeptides. The specific RNA binding by
          SRSF5 requires the phosphorylation of its SR domain.  .
          Length = 70

 Score = 26.8 bits (59), Expect = 0.65
 Identities = 10/33 (30%), Positives = 22/33 (66%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLR 61
          ++F+G++  +  E D+ + F  YGR+ +I++ R
Sbjct: 1  RVFIGRLNPAAREKDVERFFKGYGRIRDIDLKR 33


>gnl|CDD|240721 cd12275, RRM1_MEI2_EAR1_like, RNA recognition motif 1 in
          Mei2-like proteins and terminal EAR1-like proteins.
          This subfamily corresponds to the RRM1 of Mei2-like
          proteins from plant and fungi, terminal EAR1-like
          proteins from plant, and other eukaryotic homologs.
          Mei2-like proteins represent an ancient eukaryotic
          RNA-binding protein family whose corresponding
          Mei2-like genes appear to have arisen early in
          eukaryote evolution, been lost from some lineages such
          as Saccharomyces cerevisiae and metazoans, and
          diversified in the plant lineage. The plant Mei2-like
          genes may function in cell fate specification during
          development, rather than as stimulators of meiosis. In
          the fission yeast Schizosaccharomyces pombe, the Mei2
          protein is an essential component of the switch from
          mitotic to meiotic growth. S. pombe Mei2 stimulates
          meiosis in the nucleus upon binding a specific
          non-coding RNA. The terminal EAR1-like protein 1 and 2
          (TEL1 and TEL2) are mainly found in land plants. They
          may play a role in the regulation of leaf initiation.
          All members in this family are putative RNA-binding
          proteins carrying three RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). In addition to the RRMs,
          the terminal EAR1-like proteins also contain TEL
          characteristic motifs that allow sequence and putative
          functional discrimination between them and Mei2-like
          proteins. .
          Length = 71

 Score = 26.8 bits (59), Expect = 0.67
 Identities = 18/61 (29%), Positives = 27/61 (44%), Gaps = 7/61 (11%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIFEAAFLKIARAAIEPQK 89
          +FV  +PR + E+ L ++F  YG V  +   R      S+G I    F  I R A    +
Sbjct: 4  LFVINVPRDVTESTLRRLFEVYGDVRGVQTER-----ISEG-IVTVHFYDI-RDAKRAVR 56

Query: 90 A 90
           
Sbjct: 57 E 57


>gnl|CDD|240907 cd12461, RRM_SCAF4, RNA recognition motif found in SR-related and
          CTD-associated factor 4 (SCAF4) and similar proteins.
          The CD corresponds to the RRM of SCAF4 (also termed
          splicing factor, arginine/serine-rich 15 or SFR15, or
          CTD-binding SR-like protein RA4) that belongs to a new
          class of SCAFs (SR-like CTD-associated factors).
          Although its biological function remains unclear, SCAF4
          shows high sequence similarity to SCAF8 that interacts
          specifically with a highly serine-phosphorylated form
          of the carboxy-terminal domain (CTD) of the largest
          subunit of RNA polymerase II (pol II) and may play a
          direct role in coupling with both, transcription and
          pre-mRNA processing, processes. SCAF4 and SCAF8 both
          contain a conserved N-terminal CTD-interacting domain
          (CID), an atypical RNA recognition motif (RRM), also
          termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), and serine/arginine-rich
          motifs.
          Length = 81

 Score = 26.9 bits (59), Expect = 0.71
 Identities = 9/31 (29%), Positives = 21/31 (67%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVL 60
          ++VGQ+ +   + D+T +  E+G + +IN++
Sbjct: 7  LWVGQLDKRTTQQDVTSLLEEFGPIESINMI 37


>gnl|CDD|240969 cd12525, RRM1_MEI2_fungi, RNA recognition motif 1 in fungal
          Mei2-like proteins.  This subgroup corresponds to the
          RRM1 of fungal Mei2-like proteins. The Mei2 protein is
          an essential component of the switch from mitotic to
          meiotic growth in the fission yeast Schizosaccharomyces
          pombe. It is an RNA-binding protein that contains three
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          In the nucleus, S. pombe Mei2 stimulates meiosis upon
          binding a specific non-coding RNA through its
          C-terminal RRM motif. .
          Length = 72

 Score = 26.6 bits (59), Expect = 0.74
 Identities = 8/30 (26%), Positives = 17/30 (56%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINV 59
          + V  +P+ +  ++L ++F + G V  I V
Sbjct: 4  LKVTGVPKDVSTSNLKEIFEKMGDVKGIFV 33


>gnl|CDD|240818 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif of pre-mRNA
          cleavage factor Im 68 kDa subunit (CFIm68 or CPSF6),
          pre-mRNA cleavage factor Im 59 kDa subunit (CFIm59 or
          CPSF7), and similar proteins.  This subfamily
          corresponds to the RRM of cleavage factor Im (CFIm)
          subunits. Cleavage factor Im (CFIm) is a highly
          conserved component of the eukaryotic mRNA 3'
          processing machinery that functions in UGUA-mediated
          poly(A) site recognition, the regulation of alternative
          poly(A) site selection, mRNA export, and mRNA splicing.
          It is a complex composed of a small 25 kDa (CFIm25)
          subunit and a larger 59/68/72 kDa subunit. Two separate
          genes, CPSF6 and CPSF7, code for two isoforms of the
          large subunit, CFIm68 and CFIm59. Structurally related
          CFIm68 and CFIm59, also termed cleavage and
          polyadenylation specificity factor subunit 6 (CPSF7),
          or cleavage and polyadenylation specificity factor 59
          kDa subunit (CPSF59), are functionally redundant. Both
          contains an N-terminal RNA recognition motif (RRM),
          also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), a central proline-rich
          region, and a C-terminal RS-like domain. Their
          N-terminal RRM mediates the interaction with CFIm25,
          and also serves to enhance RNA binding and facilitate
          RNA looping. .
          Length = 76

 Score = 26.9 bits (60), Expect = 0.74
 Identities = 11/32 (34%), Positives = 15/32 (46%), Gaps = 2/32 (6%)

Query: 41 EADLTKMFSEYGR--VYNINVLRDKVTGQSKG 70
          + DL    +E G   V +I     K  G+SKG
Sbjct: 12 DEDLEGALAEAGVVDVKSIKFFEHKANGKSKG 43


>gnl|CDD|240784 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 in
          serine/arginine-rich splicing factor 1 (SRSF1) and
          similar proteins.  This subgroup corresponds to the
          RRM1 in three serine/arginine (SR) proteins:
          serine/arginine-rich splicing factor 1 (SRSF1 or
          ASF-1), serine/arginine-rich splicing factor 9 (SRSF9
          or SRp30C), and plant pre-mRNA-splicing factor SF2
          (SR1). SRSF1 is a shuttling SR protein involved in
          constitutive and alternative splicing,
          nonsense-mediated mRNA decay (NMD), mRNA export and
          translation. It also functions as a splicing-factor
          oncoprotein that regulates apoptosis and proliferation
          to promote mammary epithelial cell transformation.
          SRSF9 has been implicated in the activity of many
          elements that control splice site selection, the
          alternative splicing of the glucocorticoid receptor
          beta in neutrophils and in the gonadotropin-releasing
          hormone pre-mRNA. It can also interact with other
          proteins implicated in alternative splicing, including
          YB-1, rSLM-1, rSLM-2, E4-ORF4, Nop30, and p32. Both,
          SRSF1 and SRSF9, contain two N-terminal RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), and a C-terminal
          RS domains rich in serine-arginine dipeptides. In
          contrast, SF2 contains two N-terminal RRMs and a
          C-terminal PSK domain rich in proline, serine and
          lysine residues.  .
          Length = 72

 Score = 26.6 bits (59), Expect = 0.75
 Identities = 9/31 (29%), Positives = 20/31 (64%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINV 59
          +++VG +P  + E D+  +F +YG +  I++
Sbjct: 1  RIYVGNLPGDIRERDIEDLFYKYGPIKAIDL 31


>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint
           family.  The proteins represented by this model contain
           three RNA recognition motifs (rrm: pfam00076) and have
           been characterized as poly-pyrimidine tract binding
           proteins associated with RNA splicing factors. In the
           case of PUF60 (GP|6176532), in complex with p54, and in
           the presence of U2AF, facilitates association of U2
           snRNP with pre-mRNA.
          Length = 612

 Score = 27.7 bits (61), Expect = 0.81
 Identities = 14/45 (31%), Positives = 25/45 (55%)

Query: 29  KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
           +++VG I   + E  + + F  +G + +IN+  D  TG+ KG  F
Sbjct: 109 RVYVGSISFELREDTIRRAFDPFGPIKSINMSWDPATGKHKGFAF 153


>gnl|CDD|240931 cd12487, RRM1_DND1, RNA recognition motif 1 found in vertebrate
          dead end protein homolog 1 (DND1).  This subgroup
          corresponds to the RRM1 of DND1, also termed
          RNA-binding motif, single-stranded-interacting protein
          4, an RNA-binding protein that is essential for
          maintaining viable germ cells in vertebrates. It
          interacts with the 3'-untranslated region (3'-UTR) of
          multiple messenger RNAs (mRNAs) and prevents micro-RNA
          (miRNA) mediated repression of mRNA. For instance, DND1
          binds cell cycle inhibitor, P27 (p27Kip1, CDKN1B), and
          cell cycle regulator and tumor suppressor, LATS2 (large
          tumor suppressor, homolog 2 of Drosophila). It helps
          maintain their protein expression through blocking the
          inhibitory function of microRNAs (miRNA) from these
          transcripts. DND1 may also impose another level of
          translational regulation to modulate expression of
          critical factors in embryonic stem (ES) cells. DND1
          interacts specifically with apolipoprotein B editing
          complex 3 (APOBEC3), a multi-functional protein
          inhibiting retroviral replication. The DND1-APOBEC3
          interaction may play a role in maintaining viability of
          germ cells and for preventing germ cell tumor
          development. DND1 contains two conserved RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains). .
          Length = 78

 Score = 26.7 bits (59), Expect = 0.82
 Identities = 11/42 (26%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          ++F+G+IP+ + E  L  +F   G +Y   ++    +G ++G
Sbjct: 3  EVFIGKIPQDVYEDRLIPLFQSVGTLYEFRLMMT-FSGLNRG 43


>gnl|CDD|240863 cd12417, RRM_SAFB_like, RNA recognition motif in the scaffold
          attachment factor (SAFB) family.  This subfamily
          corresponds to the RRM domain of the SAFB family,
          including scaffold attachment factor B1 (SAFB1),
          scaffold attachment factor B2 (SAFB2), SAFB-like
          transcriptional modulator (SLTM), and similar proteins,
          which are ubiquitously expressed. SAFB1, SAFB2 and SLTM
          have been implicated in many diverse cellular processes
          including cell growth and transformation, stress
          response, and apoptosis. They share high sequence
          similarities and all contain a scaffold attachment
          factor-box (SAF-box, also known as SAP domain)
          DNA-binding motif, an RNA recognition motif (RRM), also
          known as RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), and a region rich in
          glutamine and arginine residues. SAFB1 is a nuclear
          protein with a distribution similar to that of SLTM,
          but unlike that of SAFB2, which is also found in the
          cytoplasm. To a large extent, SAFB1 and SLTM might
          share similar functions, such as the inhibition of an
          oestrogen reporter gene. The additional cytoplasmic
          localization of SAFB2 implies that it could play
          additional roles in the cytoplasmic compartment which
          are distinct from the nuclear functions shared with
          SAFB1 and SLTM. .
          Length = 74

 Score = 26.5 bits (59), Expect = 0.89
 Identities = 9/25 (36%), Positives = 17/25 (68%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRV 54
          ++V  +  +   ADL ++FS+YG+V
Sbjct: 2  LWVSGLSSTTKAADLKQLFSKYGKV 26


>gnl|CDD|240915 cd12471, RRM1_MSSP2, RNA recognition motif 1 in vertebrate
          single-stranded DNA-binding protein MSSP-2.  This
          subgroup corresponds to the RRM1 of MSSP-2, also termed
          RNA-binding motif, single-stranded-interacting protein
          2 (RBMS2), or suppressor of CDC2 with RNA-binding motif
          3 (SCR3), a double- and single-stranded DNA binding
          protein that belongs to the c-myc single-strand binding
          proteins (MSSP) family. It specifically recognizes the
          sequence T(C/A)TT, and stimulates DNA replication in
          the system using SV40 DNA. MSSP-2 is identical with
          Scr3, a human protein which complements the defect of
          cdc2 kinase in Schizosaccharomyces pombe. MSSP-2 has
          been implied in regulating DNA replication,
          transcription, apoptosis induction, and cell-cycle
          movement, via the interaction with C-MYC, the product
          of protooncogene c-myc. MSSP-2 contains two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          both of which are responsible for the specific DNA
          binding activity as well as induction of apoptosis. .
          Length = 75

 Score = 26.6 bits (58), Expect = 1.0
 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 1/41 (2%)

Query: 33 GQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          G  P + D+ DL K+   YG++ +   + DK T + KG  F
Sbjct: 8  GLHPGTTDQ-DLVKLCQPYGKIVSTKAILDKTTNKCKGYGF 47


>gnl|CDD|241043 cd12599, RRM1_SF2_plant_like, RNA recognition motif 1 in plant
          pre-mRNA-splicing factor SF2 and similar proteins.
          This subgroup corresponds to the RRM1 of SF2, also
          termed SR1 protein, a plant serine/arginine (SR)-rich
          phosphoprotein similar to the mammalian splicing factor
          SF2/ASF. It promotes splice site switching in mammalian
          nuclear extracts. SF2 contains two N-terminal RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          followed by a C-terminal domain rich in proline, serine
          and lysine residues (PSK domain), a composition
          reminiscent of histones. This PSK domain harbors a
          putative phosphorylation site for the mitotic kinase
          cyclin/p34cdc2. .
          Length = 72

 Score = 26.3 bits (58), Expect = 1.0
 Identities = 8/30 (26%), Positives = 20/30 (66%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINV 59
          ++VG +P  + E ++  +F +YG + +I++
Sbjct: 2  VYVGNLPGDIREREVEDLFYKYGPIVDIDL 31


>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in
          serine/arginine-rich splicing factor SRSF10, SRSF12 and
          similar proteins.  This subfamily corresponds to the
          RRM of SRSF10 and SRSF12. SRSF10, also termed 40 kDa
          SR-repressor protein (SRrp40), or FUS-interacting
          serine-arginine-rich protein 1 (FUSIP1), or splicing
          factor SRp38, or splicing factor, arginine/serine-rich
          13A (SFRS13A), or TLS-associated protein with Ser-Arg
          repeats (TASR). It is a serine-arginine (SR) protein
          that acts as a potent and general splicing repressor
          when dephosphorylated. It mediates global inhibition of
          splicing both in M phase of the cell cycle and in
          response to heat shock. SRSF10 emerges as a modulator
          of cholesterol homeostasis through the regulation of
          low-density lipoprotein receptor (LDLR) splicing
          efficiency. It also regulates cardiac-specific
          alternative splicing of triadin pre-mRNA and is
          required for proper Ca2+ handling during embryonic
          heart development. In contrast, the phosphorylated
          SRSF10 functions as a sequence-specific splicing
          activator in the presence of a nuclear cofactor. It
          activates distal alternative 5' splice site of
          adenovirus E1A pre-mRNA in vivo. Moreover, SRSF10
          strengthens pre-mRNA recognition by U1 and U2 snRNPs.
          SRSF10 localizes to the nuclear speckles and can
          shuttle between nucleus and cytoplasm. SRSF12, also
          termed 35 kDa SR repressor protein (SRrp35), or
          splicing factor, arginine/serine-rich 13B (SFRS13B), or
          splicing factor, arginine/serine-rich 19 (SFRS19), is a
          serine/arginine (SR) protein-like alternative splicing
          regulator that antagonizes authentic SR proteins in the
          modulation of alternative 5' splice site choice. For
          instance, it activates distal alternative 5' splice
          site of the adenovirus E1A pre-mRNA in vivo. Both,
          SRSF10 and SRSF12, contain a single N-terminal RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain), followed by
          a C-terminal RS domain rich in serine-arginine
          dipeptides. .
          Length = 84

 Score = 26.6 bits (59), Expect = 1.0
 Identities = 9/44 (20%), Positives = 23/44 (52%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          ++V  +  +    DL ++F +YG + ++ +  D  T + +G  +
Sbjct: 3  LYVRNVADATRPDDLRRLFGKYGPIVDVYIPLDFYTRRPRGFAY 46


>gnl|CDD|240717 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Arabidopsis
          thaliana phragmoplastin interacting protein 1 (PHIP1)
          and similar proteins.  This subfamily corresponds to
          the RRM1 of PHIP1. A. thaliana PHIP1 and its homologs
          represent a novel class of plant-specific RNA-binding
          proteins that may play a unique role in the polarized
          mRNA transport to the vicinity of the cell plate. The
          family members consist of multiple functional domains,
          including a lysine-rich domain (KRD domain) that
          contains three nuclear localization motifs (KKKR/NK),
          two RNA recognition motifs (RRMs), and three CCHC-type
          zinc fingers. PHIP1 is a peripheral membrane protein
          and is localized at the cell plate during cytokinesis
          in plants. In addition to phragmoplastin, PHIP1
          interacts with two Arabidopsis small GTP-binding
          proteins, Rop1 and Ran2. However, PHIP1 interacted only
          with the GTP-bound form of Rop1 but not the GDP-bound
          form. It also binds specifically to Ran2 mRNA. .
          Length = 72

 Score = 26.2 bits (58), Expect = 1.1
 Identities = 12/43 (27%), Positives = 22/43 (51%)

Query: 31 FVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          +VG IP    E ++   FS  G +  ++++    TG+ +G  F
Sbjct: 2  YVGGIPYYSTEDEIRSYFSYCGEIEELDLMTFPDTGRFRGIAF 44


>gnl|CDD|176053 cd08408, C2B_Synaptotagmin-14_16, C2 domain second repeat present
          in Synaptotagmins 14 and 16.  Synaptotagmin 14 and 16
          are membrane-trafficking proteins in specific tissues
          outside the brain.   Both of these contain C-terminal
          tandem C2 repeats, but only Synaptotagmin 14 has an
          N-terminal transmembrane domain and a putative
          fatty-acylation site. Previously all synaptotagmins
          were thought to be calcium sensors in the regulation of
          neurotransmitter release and hormone secretion, but it
          has been shown that not all of them bind calcium and
          this is indeed the case here.  Of the 17 identified
          synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).
          The function of the two C2 domains that bind calcium
          are: regulating the fusion step of synaptic vesicle
          exocytosis (C2A) and  binding to
          phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
          absence of calcium ions and to phosphatidylinositol
          bisphosphate (PIP2) in their presence (C2B).  C2B also
          regulates also the recycling step of synaptic vesicles.
          C2 domains fold into an 8-standed beta-sandwich that
          can adopt 2 structural arrangements: Type I and Type
          II, distinguished by a circular permutation involving
          their N- and C-terminal beta strands. Many C2 domains
          are Ca2+-dependent membrane-targeting modules that bind
          a wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions. This cd contains the second C2
          repeat, C2B, and has a type-I topology.
          Length = 138

 Score = 26.6 bits (59), Expect = 1.3
 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 5/44 (11%)

Query: 20 PEQPDPDFIKMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDK 63
            QPDP+F + FV Q+      +++T MFS    VYN   ++ K
Sbjct: 61 RGQPDPEFKETFVFQVA-LFQLSEVTLMFS----VYNKRKMKRK 99


>gnl|CDD|241085 cd12641, RRM_TRA2B, RNA recognition motif in Transformer-2
          protein homolog beta (TRA-2 beta) and similar proteins.
           This subgroup corresponds to the RRM of TRA2-beta or
          TRA-2-beta, also termed splicing factor,
          arginine/serine-rich 10 (SFRS10), or transformer-2
          protein homolog B, a mammalian homolog of Drosophila
          transformer-2 (Tra2). TRA2-beta is a
          serine/arginine-rich (SR) protein that controls the
          pre-mRNA alternative splicing of the
          calcitonin/calcitonin gene-related peptide (CGRP), the
          survival motor neuron 1 (SMN1) protein and the tau
          protein. It contains a well conserved RNA recognition
          motif (RRM), also termed RBD (RNA binding domain) or
          RNP (ribonucleoprotein domain), flanked by the N- and
          C-terminal arginine/serine (RS)-rich regions. TRA2-beta
          specifically binds to two types of RNA sequences, the
          CAA and (GAA)2 sequences, through the RRMs in different
          RNA binding modes.  .
          Length = 89

 Score = 26.5 bits (58), Expect = 1.3
 Identities = 11/33 (33%), Positives = 24/33 (72%)

Query: 41 EADLTKMFSEYGRVYNINVLRDKVTGQSKGKIF 73
          E DL ++FS+YG + +++++ D+ + +S+G  F
Sbjct: 23 ERDLREVFSKYGPIADVSIVYDQQSRRSRGFAF 55


>gnl|CDD|241068 cd12624, RRM_PRC, RNA recognition motif in peroxisome
          proliferator-activated receptor gamma
          coactivator-related protein 1 (PRC) and similar
          proteins.  This subgroup corresponds to the RRM of PRC,
          also termed PGC-1-related coactivator, one of the
          members of PGC-1 transcriptional coactivators family,
          including peroxisome proliferator-activated receptor
          gamma coactivators PGC-1alpha and PGC-1beta. Unlike
          PGC-1alpha and PGC-1beta, PRC is ubiquitous and more
          abundantly expressed in proliferating cells than in
          growth-arrested cells. PRC has been implicated in the
          regulation of several metabolic pathways, mitochondrial
          biogenesis, and cell growth. It functions as a
          growth-regulated transcriptional cofactor activating
          many nuclear genes specifying mitochondrial respiratory
          function. PRC directly interacts with nuclear
          transcriptional factors implicated in respiratory chain
          expression including nuclear respiratory factors 1 and
          2 (NRF-1 and NRF-2), CREB (cAMP-response
          element-binding protein), and estrogen-related receptor
          alpha (ERRalpha). It interacts indirectly with the
          NRF-2beta subunit through host cell factor (HCF), a
          cellular protein involved in herpes simplex virus (HSV)
          infection and cell cycle regulation. Furthermore, like
          PGC-1alpha and PGC-1beta, PRC can transactivate a
          number of NRF-dependent nuclear genes required for
          mitochondrial respiratory function, including those
          encoding cytochrome c, 5-aminolevulinate synthase,
          Tfam, and TFB1M, and TFB2M. Further research indicates
          that PRC may also act as a sensor of metabolic stress
          that orchestrates a redox-sensitive program of
          inflammatory gene expression. PRC is a multi-domain
          protein containing an N-terminal activation domain, an
          LXXLL coactivator signature, a central proline-rich
          region, a tetrapeptide motif (DHDY) responsible for HCF
          binding, a C-terminal arginine/serine-rich (SR) domain,
          and an RNA recognition motif (RRM), also termed RBD
          (RNA binding domain) or RNP (ribonucleoprotein domain).
          .
          Length = 91

 Score = 26.4 bits (58), Expect = 1.3
 Identities = 8/25 (32%), Positives = 16/25 (64%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRV 54
          +++G+IP  M  ++L   FS +G +
Sbjct: 5  VYIGKIPSRMTRSELKDRFSVFGEI 29


>gnl|CDD|241207 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in heterogeneous
          nuclear ribonucleoprotein A3 (hnRNP A3) and similar
          proteins.  This subgroup corresponds to the RRM1 of
          hnRNP A3 which is a novel RNA trafficking response
          element-binding protein that interacts with the hnRNP
          A2 response element (A2RE) independently of hnRNP A2
          and participates in the trafficking of A2RE-containing
          RNA. hnRNP A3 can shuttle between the nucleus and the
          cytoplasm. It contains two RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), followed by a long
          glycine-rich region at the C-terminus. .
          Length = 81

 Score = 26.2 bits (57), Expect = 1.4
 Identities = 12/42 (28%), Positives = 24/42 (57%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          K+F+G +     +  L + F ++G + +  V+RD  T +S+G
Sbjct: 4  KLFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDPQTKRSRG 45


>gnl|CDD|240761 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 in RNA-binding
          protein 19 (RBM19), yeast multiple RNA-binding
          domain-containing protein 1 (MRD1) and similar
          proteins.  This subfamily corresponds to the RRM1 of
          RBM19 and MRD1. RBM19, also termed RNA-binding domain-1
          (RBD-1), is a nucleolar protein conserved in
          eukaryotes. It is involved in ribosome biogenesis by
          processing rRNA and is essential for preimplantation
          development. It has a unique domain organization
          containing 6 conserved RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). MRD1 is encoded by a novel
          yeast gene MRD1 (multiple RNA-binding domain). It is
          well-conserved in yeast and its homologs exist in all
          eukaryotes. MRD1 is present in the nucleolus and the
          nucleoplasm. It interacts with the 35 S precursor rRNA
          (pre-rRNA) and U3 small nucleolar RNAs (snoRNAs). It is
          essential for the initial processing at the A0-A2
          cleavage sites in the 35 S pre-rRNA. MRD1 contains 5
          conserved RRMs, which may play an important structural
          role in organizing specific rRNA processing events. .
          Length = 77

 Score = 26.1 bits (58), Expect = 1.4
 Identities = 11/36 (30%), Positives = 23/36 (63%), Gaps = 1/36 (2%)

Query: 29 KMFVGQIPRSMDEADLTKMFSE-YGRVYNINVLRDK 63
          ++ V  +P S+ EA+L + FS+  G + ++ +LR +
Sbjct: 2  RLIVKNLPASLTEAELKEHFSKHGGEITDVKLLRTE 37


>gnl|CDD|181676 PRK09165, PRK09165, replicative DNA helicase; Provisional.
          Length = 497

 Score = 26.8 bits (60), Expect = 1.5
 Identities = 11/23 (47%), Positives = 14/23 (60%)

Query: 69  KGKIFEAAFLKIARAAIEPQKAP 91
           +GKI E  F K+  A+ E QK P
Sbjct: 293 RGKISEEDFEKLVDASQELQKLP 315


>gnl|CDD|240708 cd12262, RRM2_4_MRN1, RNA recognition motif 2 and 4 in
          RNA-binding protein MRN1 and similar proteins.  This
          subgroup corresponds to the RRM2 and RRM4 of MRN1, also
          termed multicopy suppressor of RSC-NHP6 synthetic
          lethality protein 1, or post-transcriptional regulator
          of 69 kDa, and is an RNA-binding protein found in
          yeast. Although its specific biological role remains
          unclear, MRN1 might be involved in translational
          regulation. Members in this family contain four copies
          of conserved RNA recognition motif (RRM), also known as
          RBD (RNA binding domain) or RNP (ribonucleoprotein
          domain). .
          Length = 82

 Score = 26.0 bits (57), Expect = 1.6
 Identities = 10/27 (37%), Positives = 18/27 (66%)

Query: 37 RSMDEADLTKMFSEYGRVYNINVLRDK 63
          R++ E +L K   +YG + +I +LR+K
Sbjct: 17 RNLPEKELRKECEKYGEIESIRILREK 43


>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal
          pre-messenger RNA splicing protein 24 (Prp24) and
          similar proteins.  This subfamily corresponds to the
          RRM3 of Prp24, also termed U4/U6
          snRNA-associated-splicing factor PRP24 (U4/U6 snRNP),
          an RNA-binding protein with four well conserved RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          It facilitates U6 RNA base-pairing with U4 RNA during
          spliceosome assembly. Prp24 specifically binds free U6
          RNA primarily with RRMs 1 and 2 and facilitates pairing
          of U6 RNA bases with U4 RNA bases. Additionally, it may
          also be involved in dissociation of the U4/U6 complex
          during spliceosome activation. .
          Length = 78

 Score = 25.7 bits (57), Expect = 1.7
 Identities = 10/31 (32%), Positives = 20/31 (64%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINV 59
          +++V  +   +DE DL  +FS++G V +I +
Sbjct: 2  EIYVRNLDFKLDEDDLRGIFSKFGEVESIRI 32


>gnl|CDD|241031 cd12587, RRM1_PSF, RNA recognition motif 1 in vertebrate
          polypyrimidine tract-binding protein
          (PTB)-associated-splicing factor (PSF).  This subgroup
          corresponds to the RRM1 of PSF, also termed proline-
          and glutamine-rich splicing factor, or 100 kDa
          DNA-pairing protein (POMp100), or 100 kDa subunit of
          DNA-binding p52/p100 complex, a multifunctional protein
          that mediates diverse activities in the cell. It is
          ubiquitously expressed and highly conserved in
          vertebrates. PSF binds not only RNA but also both
          single-stranded DNA (ssDNA) and double-stranded DNA
          (dsDNA) and facilitates the renaturation of
          complementary ssDNAs. Besides, it promotes the
          formation of D-loops in superhelical duplex DNA, and is
          involved in cell proliferation. PSF can also interact
          with multiple factors. It is an RNA-binding component
          of spliceosomes and binds to insulin-like growth factor
          response element (IGFRE). PSF functions as a
          transcriptional repressor interacting with Sin3A and
          mediating silencing through the recruitment of histone
          deacetylases (HDACs) to the DNA binding domain (DBD) of
          nuclear hormone receptors. Additionally, PSF is an
          essential pre-mRNA splicing factor and is dissociated
          from PTB and binds to U1-70K and serine-arginine (SR)
          proteins during apoptosis. PSF forms a heterodimer with
          the nuclear protein p54nrb, also known as non-POU
          domain-containing octamer-binding protein (NonO). The
          PSF/p54nrb complex displays a variety of functions,
          such as DNA recombination and RNA synthesis,
          processing, and transport. PSF contains two conserved
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          which are responsible for interactions with RNA and for
          the localization of the protein in speckles. It also
          contains an N-terminal region rich in proline, glycine,
          and glutamine residues, which may play a role in
          interactions recruiting other molecules. .
          Length = 71

 Score = 25.6 bits (56), Expect = 1.8
 Identities = 9/24 (37%), Positives = 17/24 (70%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYG 52
          ++FVG +P  + E +  K+F++YG
Sbjct: 3  RLFVGNLPADITEDEFKKLFAKYG 26


>gnl|CDD|241205 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in heterogeneous
          nuclear ribonucleoprotein A1 (hnRNP A1) and similar
          proteins.  This subgroup corresponds to the RRM1 of
          hnRNP A1, also termed helix-destabilizing protein, or
          single-strand RNA-binding protein, or hnRNP core
          protein A1, and is an abundant eukaryotic nuclear
          RNA-binding protein that may modulate splice site
          selection in pre-mRNA splicing. hnRNP A1 has been
          characterized as a splicing silencer, often acting in
          opposition to an activating hnRNP H. It silences exons
          when bound to exonic elements in the alternatively
          spliced transcripts of c-src, HIV, GRIN1, and
          beta-tropomyosin. hnRNP A1 can shuttle between the
          nucleus and the cytoplasm. Thus, it may be involved in
          transport of cellular RNAs, including the packaging of
          pre-mRNA into hnRNP particles and transport of poly A+
          mRNA from the nucleus to the cytoplasm. The cytoplasmic
          hnRNP A1 has high affinity with AU-rich elements,
          whereas the nuclear hnRNP A1 has high affinity with a
          polypyrimidine stretch bordered by AG at the 3' ends of
          introns. hnRNP A1 is also involved in the replication
          of an RNA virus, such as mouse hepatitis virus (MHV),
          through an interaction with the
          transcription-regulatory region of viral RNA. hnRNP A1,
          together with the scaffold protein septin 6, serves as
          host protein to form a complex with NS5b and viral RNA,
          and further plays important roles in the replication of
          Hepatitis C virus (HCV). hnRNP A1 contains two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          followed by a long glycine-rich region at the
          C-terminus. The RRMs of hnRNP A1 play an important role
          in silencing the exon and the glycine-rich domain is
          responsible for protein-protein interactions. .
          Length = 81

 Score = 25.8 bits (56), Expect = 1.9
 Identities = 12/42 (28%), Positives = 23/42 (54%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          K+F+G +     +  L   F ++G + +  V+RD  T +S+G
Sbjct: 4  KLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRG 45


>gnl|CDD|240980 cd12536, RRM1_RBM39, RNA recognition motif 1 in vertebrate
          RNA-binding protein 39 (RBM39).  This subgroup
          corresponds to the RRM1 of RBM39, also termed
          hepatocellular carcinoma protein 1, or RNA-binding
          region-containing protein 2, or splicing factor HCC1, a
          nuclear autoantigen that contains an N-terminal
          arginine/serine rich (RS) motif and three RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          An octapeptide sequence called the RS-ERK motif is
          repeated six times in the RS region of RBM39. Based on
          the specific domain composition, RBM39 has been
          classified into a family of non-snRNP (small nuclear
          ribonucleoprotein) splicing factors that are usually
          not complexed to snRNAs. .
          Length = 85

 Score = 25.8 bits (56), Expect = 2.2
 Identities = 12/41 (29%), Positives = 24/41 (58%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          +F  Q+   +   DL + FS  G+V ++ ++ D+ + +SKG
Sbjct: 4  VFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKG 44


>gnl|CDD|241051 cd12607, RRM2_RBM4, RNA recognition motif 2 in vertebrate
          RNA-binding protein 4 (RBM4).  This subgroup
          corresponds to the RRM2 of RBM4, a ubiquitously
          expressed splicing factor that has two isoforms, RBM4A
          (also known as Lark homolog) and RBM4B (also known as
          RBM30), which are very similar in structure and
          sequence. RBM4 may function as a translational
          regulator of stress-associated mRNAs and also plays a
          role in micro-RNA-mediated gene regulation. RBM4
          contains two N-terminal RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), a CCHC-type zinc finger,
          and three alanine-rich regions within their C-terminal
          regions. The C-terminal region may be crucial for
          nuclear localization and protein-protein interaction.
          The RRMs, in combination with the C-terminal region,
          are responsible for the splicing function of RBM4. .
          Length = 67

 Score = 25.4 bits (55), Expect = 2.6
 Identities = 12/34 (35%), Positives = 18/34 (52%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRD 62
          K+ VG I  S    +L   F EYG V   ++++D
Sbjct: 2  KLHVGNISSSCTNQELRAKFEEYGPVIECDIVKD 35


>gnl|CDD|240726 cd12280, RRM_FET, RNA recognition motif in the FET family of
          RNA-binding proteins.  This subfamily corresponds to
          the RRM of FET (previously TET) (FUS/TLS, EWS, TAF15)
          family of RNA-binding proteins. This ubiquitously
          expressed family of similarly structured proteins
          predominantly localizing to the nuclear, includes FUS
          (also known as TLS or Pigpen or hnRNP P2), EWS (also
          known as EWSR1), TAF15 (also known as hTAFII68 or TAF2N
          or RPB56), and Drosophila Cabeza (also known as SARFH).
          The corresponding coding genes of these proteins are
          involved in deleterious genomic rearrangements with
          transcription factor genes in a variety of human
          sarcomas and acute leukemias. All FET proteins interact
          with each other and are therefore likely to be part of
          the very same protein complexes, which suggests a
          general bridging role for FET proteins coupling RNA
          transcription, processing, transport, and DNA repair.
          The FET proteins contain multiple copies of a
          degenerate hexapeptide repeat motif at the N-terminus.
          The C-terminal region consists of a conserved nuclear
          import and retention signal (C-NLS), a putative
          zinc-finger domain, and a conserved RNA recognition
          motif (RRM), also known as RBD (RNA binding domain) or
          RNP (ribonucleoprotein domain), which is flanked by 3
          arginine-glycine-glycine (RGG) boxes. FUS and EWS might
          have similar sequence specificity; both bind
          preferentially to GGUG-containing RNAs. FUS has also
          been shown to bind strongly to human telomeric RNA and
          to small low-copy-number RNAs tethered to the promoter
          of cyclin D1. To date, nothing is known about the RNA
          binding specificity of TAF15. .
          Length = 81

 Score = 25.4 bits (56), Expect = 2.6
 Identities = 11/44 (25%), Positives = 19/44 (43%), Gaps = 5/44 (11%)

Query: 31 FVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIFE 74
          ++  +P  + E  L ++F   G      + RDK T     KI+ 
Sbjct: 2  YISGLPDDVTEDSLAELFGGIG-----IIKRDKRTWPPMIKIYT 40


>gnl|CDD|177281 PHA00446, PHA00446, hypothetical protein.
          Length = 89

 Score = 25.6 bits (56), Expect = 2.7
 Identities = 13/35 (37%), Positives = 16/35 (45%), Gaps = 6/35 (17%)

Query: 31 FVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVT 65
          FV    R  D AD      ++ R  +INV   KVT
Sbjct: 3  FVANTIRLSDTAD------QWARRVHINVRNGKVT 31


>gnl|CDD|240892 cd12446, RRM_RBM25, RNA recognition motif in eukaryotic
          RNA-binding protein 25 and similar proteins.  This
          subfamily corresponds to the RRM of RBM25, also termed
          Arg/Glu/Asp-rich protein of 120 kDa (RED120), or
          protein S164, or RNA-binding region-containing protein
          7, an evolutionary-conserved splicing coactivator
          SRm160 (SR-related nuclear matrix protein of 160 kDa,
          )-interacting protein. RBM25 belongs to a family of
          RNA-binding proteins containing a well conserved RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain), at the
          N-terminus, a RE/RD-rich (ER) central region, and a
          C-terminal proline-tryptophan-isoleucine (PWI) motif.
          It localizes to the nuclear speckles and associates
          with multiple splicing components, including splicing
          cofactors SRm160/300, U snRNAs, assembled splicing
          complexes, and spliced mRNAs. It may play an important
          role in pre-mRNA processing by coupling splicing with
          mRNA 3'-end formation. Additional research indicates
          that RBM25 is one of the RNA-binding regulators that
          direct the alternative splicing of apoptotic factors.
          It can activate proapoptotic Bcl-xS 5'ss by binding to
          the exonic splicing enhancer, CGGGCA, and stabilize the
          pre-mRNA-U1 snRNP through interaction with hLuc7A, a U1
          snRNP-associated factor. .
          Length = 84

 Score = 25.3 bits (56), Expect = 2.7
 Identities = 12/42 (28%), Positives = 23/42 (54%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
           +FVG IP  + +  + K+  + G+V +   ++D  TG+ K 
Sbjct: 2  TVFVGNIPEGVSDDFIRKLLEKCGKVLSWKRVKDPSTGKLKA 43


>gnl|CDD|241040 cd12596, RRM1_SRSF6, RNA recognition motif 1 in vertebrate
          serine/arginine-rich splicing factor 6 (SRSF6).  This
          subfamily corresponds to the RRM1 of SRSF6, also termed
          pre-mRNA-splicing factor SRp55, which is an essential
          splicing regulatory serine/arginine (SR) protein that
          preferentially interacts with a number of purine-rich
          splicing enhancers (ESEs) to activate splicing of the
          ESE-containing exon. It is the only protein from HeLa
          nuclear extract or purified SR proteins that
          specifically binds B element RNA after UV irradiation.
          SRSF6 may also recognize different types of RNA sites.
          For instance, it does not bind to the purine-rich
          sequence in the calcitonin-specific ESE, but binds to a
          region adjacent to the purine tract. Moreover, cellular
          levels of SRSF6 may control tissue-specific alternative
          splicing of the calcitonin/ calcitonin gene-related
          peptide (CGRP) pre-mRNA. SRSF6 contains two N-terminal
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          followed by a C-terminal SR domains rich in
          serine-arginine dipeptides. .
          Length = 70

 Score = 25.3 bits (55), Expect = 2.8
 Identities = 7/31 (22%), Positives = 20/31 (64%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINV 59
          ++++G++   + E D+ + F  YG++  I++
Sbjct: 1  RVYIGRLSYHVREKDIQRFFGGYGKLLEIDL 31


>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein
          Serine/Threonine Kinase, 70 kDa ribosomal protein S6
          kinase.  Serine/Threonine Kinases (STKs), 70 kDa
          ribosomal protein S6 kinase (p70S6K) subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The p70S6K subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. p70S6K (or S6K) contains
          only one catalytic kinase domain, unlike p90 ribosomal
          S6 kinases (RSKs). It acts as a downstream effector of
          the STK mTOR (mammalian Target of Rapamycin) and plays
          a role in the regulation of the translation machinery
          during protein synthesis. p70S6K also plays a pivotal
          role in regulating cell size and glucose homeostasis.
          Its targets include S6, the translation initiation
          factor eIF3, and the insulin receptor substrate IRS-1,
          among others. Mammals contain two isoforms of p70S6K,
          named S6K1 and S6K2 (or S6K-beta).
          Length = 323

 Score = 25.9 bits (57), Expect = 2.9
 Identities = 14/31 (45%), Positives = 17/31 (54%), Gaps = 4/31 (12%)

Query: 51 YGRVYNINVLRDKVTGQSKGKIFEAAFLKIA 81
          YG+V+ +     KVTG   GKIF    LK A
Sbjct: 9  YGKVFQVR----KVTGADTGKIFAMKVLKKA 35


>gnl|CDD|240867 cd12421, RRM1_PTBP1_hnRNPL_like, RNA recognition motif in
          polypyrimidine tract-binding protein 1 (PTB or hnRNP
          I), heterogeneous nuclear ribonucleoprotein L
          (hnRNP-L), and similar proteins.  This subfamily
          corresponds to the RRM1 of the majority of family
          members that include polypyrimidine tract-binding
          protein 1 (PTB or hnRNP I), polypyrimidine
          tract-binding protein 2 (PTBP2 or nPTB), regulator of
          differentiation 1 (Rod1), heterogeneous nuclear
          ribonucleoprotein L (hnRNP-L), heterogeneous nuclear
          ribonucleoprotein L-like (hnRNP-LL), polypyrimidine
          tract-binding protein homolog 3 (PTBPH3),
          polypyrimidine tract-binding protein homolog 1 and 2
          (PTBPH1 and PTBPH2), and similar proteins. PTB is an
          important negative regulator of alternative splicing in
          mammalian cells and also functions at several other
          aspects of mRNA metabolism, including mRNA
          localization, stabilization, polyadenylation, and
          translation. PTBP2 is highly homologous to PTB and is
          perhaps specific to the vertebrates. Unlike PTB, PTBP2
          is enriched in the brain and in some neural cell lines.
          It binds more stably to the downstream control sequence
          (DCS) RNA than PTB does but is a weaker repressor of
          splicing in vitro. PTBP2 also greatly enhances the
          binding of two other proteins, heterogeneous nuclear
          ribonucleoprotein (hnRNP) H and KH-type
          splicing-regulatory protein (KSRP), to the DCS RNA. The
          binding properties of PTBP2 and its reduced inhibitory
          activity on splicing imply roles in controlling the
          assembly of other splicing-regulatory proteins. Rod1 is
          a mammalian polypyrimidine tract binding protein (PTB)
          homolog of a regulator of differentiation in the
          fission yeast Schizosaccharomyces pombe, where the nrd1
          gene encodes an RNA binding protein negatively
          regulates the onset of differentiation. ROD1 is
          predominantly expressed in hematopoietic cells or
          organs. It might play a role controlling
          differentiation in mammals. hnRNP-L is a higher
          eukaryotic specific subunit of human KMT3a (also known
          as HYPB or hSet2) complex required for histone H3
          Lys-36 trimethylation activity. It plays both, nuclear
          and cytoplasmic, roles in mRNA export of intronless
          genes, IRES-mediated translation, mRNA stability, and
          splicing. hnRNP-LL protein plays a critical and unique
          role in the signal-induced regulation of CD45 and acts
          as a global regulator of alternative splicing in
          activated T cells. The family also includes
          polypyrimidine tract binding protein homolog 3 (PTBPH3)
          found in plant. Although its biological roles remain
          unclear, PTBPH3 shows significant sequence similarity
          to other family members, all of which contain four RNA
          recognition motifs (RRM), also known as RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain).
          Although their biological roles remain unclear, both
          PTBPH1 and PTBPH2 show significant sequence similarity
          to PTB. However, in contrast to PTB, they have three
          RRMs. In addition, this family also includes
          RNA-binding motif protein 20 (RBM20) that is an
          alternative splicing regulator associated with dilated
          cardiomyopathy (DCM) and contains only one RRM. .
          Length = 74

 Score = 25.2 bits (56), Expect = 3.0
 Identities = 11/29 (37%), Positives = 19/29 (65%)

Query: 35 IPRSMDEADLTKMFSEYGRVYNINVLRDK 63
          +P  + E+DL  + S +G+V N+ +LR K
Sbjct: 7  LPPDVTESDLIALVSPFGKVTNVLLLRGK 35


>gnl|CDD|240981 cd12537, RRM1_RBM23, RNA recognition motif 1 in vertebrate
          probable RNA-binding protein 23 (RBM23).  This subgroup
          corresponds to the RRM1 of RBM23, also termed
          RNA-binding region-containing protein 4, or splicing
          factor SF2, which may function as a pre-mRNA splicing
          factor. It shows high sequence homology to RNA-binding
          protein 39 (RBM39 or HCC1), a nuclear autoantigen that
          contains an N-terminal arginine/serine rich (RS) motif
          and three RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains). In contrast to RBM39, RBM23 contains only two
          RRMs. .
          Length = 85

 Score = 25.4 bits (55), Expect = 3.0
 Identities = 12/41 (29%), Positives = 23/41 (56%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          +F  Q+   +   DL   FS  G+V ++ ++ D+ + +SKG
Sbjct: 4  VFCMQLAARIRPRDLEDFFSAVGKVRDVRIISDRNSRRSKG 44


>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple
          RNA-binding domain-containing protein 1 (MRD1) and
          similar proteins.  This subgroup corresponds to the
          RRM1 of MRD1 which is encoded by a novel yeast gene
          MRD1 (multiple RNA-binding domain). It is
          well-conserved in yeast and its homologs exist in all
          eukaryotes. MRD1 is present in the nucleolus and the
          nucleoplasm. It interacts with the 35 S precursor rRNA
          (pre-rRNA) and U3 small nucleolar RNAs (snoRNAs). MRD1
          is essential for the initial processing at the A0-A2
          cleavage sites in the 35 S pre-rRNA. It contains 5
          conserved RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), which may play an important structural role
          in organizing specific rRNA processing events. .
          Length = 76

 Score = 24.9 bits (55), Expect = 3.1
 Identities = 9/33 (27%), Positives = 17/33 (51%)

Query: 31 FVGQIPRSMDEADLTKMFSEYGRVYNINVLRDK 63
           V  +P+ + E  L + F   G V ++ V+R +
Sbjct: 4  IVKNLPKYVTEDRLREHFESKGEVTDVKVMRTR 36


>gnl|CDD|240994 cd12550, RRM_II_PABPN1, RNA recognition motif in type II
          polyadenylate-binding protein 2 (PABP-2) and similar
          proteins.  This subgroup corresponds to the RRM of
          PABP-2, also termed poly(A)-binding protein 2, or
          nuclear poly(A)-binding protein 1 (PABPN1), or
          poly(A)-binding protein II (PABII), which is a
          ubiquitously expressed type II nuclear poly(A)-binding
          protein that directs the elongation of mRNA poly(A)
          tails during pre-mRNA processing. Although PABP-2 binds
          poly(A) with high affinity and specificity as type I
          poly(A)-binding proteins, it contains only one highly
          conserved RNA recognition motif (RRM), also termed RBD
          (RNA binding domain) or RNP (ribonucleoprotein domain),
          which is responsible for the poly(A) binding. In
          addition, PABP-2 possesses an acidic N-terminal domain
          that is essential for the stimulation of PAP, and an
          arginine-rich C-terminal domain. .
          Length = 76

 Score = 25.1 bits (55), Expect = 3.3
 Identities = 12/41 (29%), Positives = 19/41 (46%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          ++VG +       +L   F   G V  + +L DK +G  KG
Sbjct: 2  VYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKG 42


>gnl|CDD|241168 cd12724, RRM1_CPEB2_like, RNA recognition motif 1 in cytoplasmic
          polyadenylation element-binding protein CPEB-2, CPEB-3,
          CPEB-4 and similar protiens.  This subgroup corresponds
          to the RRM1 of the paralog proteins CPEB-2, CPEB-3 and
          CPEB-4, all well-conserved in both, vertebrates and
          invertebrates. Due to the high sequence similarity,
          members in this family may share similar expression
          patterns and functions. CPEB-2 is an RNA-binding
          protein that is abundantly expressed in testis and
          localized in cytoplasm in transfected HeLa cells. It
          preferentially binds to poly(U) RNA oligomers and may
          regulate the translation of stored mRNAs during
          spermiogenesis. Moreover, CPEB-2 impedes target RNA
          translation at elongation; it directly interacts with
          the elongation factor, eEF2, to reduce
          eEF2/ribosome-activated GTP hydrolysis in vitro and
          inhibit peptide elongation of CPEB2-bound RNA in vivo.
          CPEB-3 is a sequence-specific translational regulatory
          protein that regulates translation in a
          polyadenylation-independent manner. It functions as a
          translational repressor that governs the synthesis of
          the AMPA receptor GluR2 through binding GluR2 mRNA. It
          also represses translation of a reporter RNA in
          transfected neurons and stimulates translation in
          response to NMDA. CPEB-4 is an RNA-binding protein that
          mediates meiotic mRNA cytoplasmic polyadenylation and
          translation. It is essential for neuron survival and
          present on the endoplasmic reticulum (ER). It is
          accumulated in the nucleus upon ischemia or the
          depletion of ER calcium. CPEB-4 is overexpressed in a
          large variety of tumors and is associated with many
          mRNAs in cancer cells. All family members contain an
          N-terminal unstructured region, two RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), and a Zn-finger
          motif. In addition, they do have conserved nuclear
          export signals that are not present in CPEB-1. .
          Length = 92

 Score = 25.1 bits (55), Expect = 3.4
 Identities = 10/26 (38%), Positives = 17/26 (65%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRV 54
          K+FVG +P  +DE ++T  F  +G +
Sbjct: 2  KVFVGGLPPDIDEDEITASFRRFGPL 27


>gnl|CDD|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in
          heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0)
          and similar proteins.  This subfamily corresponds to
          the RRM1 of hnRNP A0 which is a low abundance hnRNP
          protein that has been implicated in mRNA stability in
          mammalian cells. It has been identified as the
          substrate for MAPKAP-K2 and may be involved in the
          lipopolysaccharide (LPS)-induced post-transcriptional
          regulation of tumor necrosis factor-alpha (TNF-alpha),
          cyclooxygenase 2 (COX-2) and macrophage inflammatory
          protein 2 (MIP-2). hnRNP A0 contains two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          followed by a long glycine-rich region at the
          C-terminus. .
          Length = 79

 Score = 25.1 bits (55), Expect = 3.6
 Identities = 13/42 (30%), Positives = 24/42 (57%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          K+FVG +     ++ L + F+ YG++    V+ D  T +S+G
Sbjct: 4  KLFVGGLNLKTSDSGLRRHFTRYGKLTECVVMVDPNTKRSRG 45


>gnl|CDD|240725 cd12279, RRM_TUT1, RNA recognition motif in speckle targeted
          PIP5K1A-regulated poly(A) polymerase (Star-PAP) and
          similar proteins.  This subfamily corresponds to the
          RRM of Star-PAP, also termed RNA-binding motif protein
          21 (RBM21), which is a ubiquitously expressed U6
          snRNA-specific terminal uridylyltransferase (U6-TUTase)
          essential for cell proliferation. Although it belongs
          to the well-characterized poly(A) polymerase protein
          superfamily, Star-PAP is highly divergent from both,
          the poly(A) polymerase (PAP) and the terminal uridylyl
          transferase (TUTase), identified within the editing
          complexes of trypanosomes. Star-PAP predominantly
          localizes at nuclear speckles and catalyzes
          RNA-modifying nucleotidyl transferase reactions. It
          functions in mRNA biosynthesis and may be regulated by
          phosphoinositides. It binds to glutathione
          S-transferase (GST)-PIPKIalpha. Star-PAP preferentially
          uses ATP as a nucleotide substrate and possesses PAP
          activity that is stimulated by PtdIns4,5P2. It contains
          an N-terminal C2H2-type zinc finger motif followed by
          an RNA recognition motif (RRM), also termed RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain), a
          split PAP domain linked by a proline-rich region, a PAP
          catalytic and core domain, a PAP-associated domain, an
          RS repeat, and a nuclear localization signal (NLS). .
          Length = 74

 Score = 25.0 bits (55), Expect = 3.6
 Identities = 12/34 (35%), Positives = 17/34 (50%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDK 63
          +FV    R   E  L   FS +G V N+ + +DK
Sbjct: 5  VFVSGFKRGTSEEQLMDYFSAFGPVMNVIMDKDK 38


>gnl|CDD|240805 cd12359, RRM2_VICKZ, RNA recognition motif 2 in the VICKZ family
          proteins.  This subfamily corresponds to the RRM2 of
          IGF-II mRNA-binding proteins (IGF2BPs or IMPs) in the
          VICKZ family that have been implicated in the
          post-transcriptional regulation of several different
          RNAs and in subcytoplasmic localization of mRNAs during
          embryogenesis. IGF2BPs are composed of two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          and four hnRNP K homology (KH) domains. .
          Length = 76

 Score = 24.6 bits (54), Expect = 4.0
 Identities = 12/47 (25%), Positives = 20/47 (42%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIFEA 75
          K+ +  IP  +   DL  + S YG V N   +  K    +    +E+
Sbjct: 2  KIQISNIPPHVRWEDLDSLLSTYGTVKNCEQVPTKSETATVNVTYES 48


>gnl|CDD|241066 cd12622, RRM3_PUB1, RNA recognition motif 3 in yeast nuclear and
          cytoplasmic polyadenylated RNA-binding protein PUB1 and
          similar proteins.  This subfamily corresponds to the
          RRM3 of yeast protein PUB1, also termed ARS
          consensus-binding protein ACBP-60, or poly
          uridylate-binding protein, or poly(U)-binding protein.
          PUB1 has been identified as both, a heterogeneous
          nuclear RNA-binding protein (hnRNP) and a cytoplasmic
          mRNA-binding protein (mRNP), which may be stably bound
          to a translationally inactive subpopulation of mRNAs
          within the cytoplasm. PUB1 is distributed in both, the
          nucleus and the cytoplasm, and binds to poly(A)+ RNA
          (mRNA or pre-mRNA). Although it is one of the major
          cellular proteins cross-linked by UV light to
          polyadenylated RNAs in vivo, PUB1 is nonessential for
          cell growth in yeast. PUB1 also binds to T-rich single
          stranded DNA (ssDNA); however, there is no strong
          evidence implicating PUB1 in the mechanism of DNA
          replication. PUB1 contains three RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a GAR motif (glycine
          and arginine rich stretch) that is located between RRM2
          and RRM3. .
          Length = 74

 Score = 24.8 bits (54), Expect = 4.2
 Identities = 10/33 (30%), Positives = 16/33 (48%)

Query: 31 FVGQIPRSMDEADLTKMFSEYGRVYNINVLRDK 63
          +VG IP    +ADL  +F  +G +       D+
Sbjct: 4  YVGNIPPYTTQADLIPLFQNFGYILEFRHQPDR 36


>gnl|CDD|233508 TIGR01649, hnRNP-L_PTB, hnRNP-L/PTB/hephaestus splicing factor
          family.  Included in this family of heterogeneous
          ribonucleoproteins are PTB (polypyrimidine tract
          binding protein ) and hnRNP-L. These proteins contain
          four RNA recognition motifs (rrm: pfam00067).
          Length = 481

 Score = 25.5 bits (56), Expect = 4.2
 Identities = 9/29 (31%), Positives = 16/29 (55%)

Query: 35 IPRSMDEADLTKMFSEYGRVYNINVLRDK 63
          +P+ + EADL +    +G V  + +L  K
Sbjct: 10 LPQDVVEADLVEALIPFGPVSYVMMLPGK 38



 Score = 25.5 bits (56), Expect = 4.4
 Identities = 9/18 (50%), Positives = 13/18 (72%)

Query: 35  IPRSMDEADLTKMFSEYG 52
           IP S+ E DL ++F+E G
Sbjct: 402 IPLSVSEEDLKELFAENG 419


>gnl|CDD|241114 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 in yeast
          nucleolar protein 12 (Nop12p) and similar proteins.
          This subgroup corresponds to the RRM2 of Nop12p, which
          is encoded by YOL041C from Saccharomyces cerevisiae. It
          is a novel nucleolar protein required for pre-25S rRNA
          processing and normal rates of cell growth at low
          temperatures. Nop12p shares high sequence similarity
          with nucleolar protein 13 (Nop13p). Both, Nop12p and
          Nop13p, are not essential for growth. However, unlike
          Nop13p that localizes primarily to the nucleolus but is
          also present in the nucleoplasm to a lesser extent,
          Nop12p is localized to the nucleolus. Nop12p contains
          two RNA recognition motifs (RRMs), also termed RBDs
          (RNA binding domains) or RNPs (ribonucleoprotein
          domains). .
          Length = 79

 Score = 24.8 bits (54), Expect = 4.7
 Identities = 12/41 (29%), Positives = 21/41 (51%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          +FVG +     E  L ++F + G +  + ++RD  T   KG
Sbjct: 2  VFVGNLGFEDVEEGLWRVFGKCGGIEYVRIVRDPKTNVGKG 42


>gnl|CDD|241008 cd12564, RRM1_RBM19, RNA recognition motif 1 in RNA-binding
          protein 19 (RBM19) and similar proteins.  This subgroup
          corresponds to the RRM1 of RBM19, also termed
          RNA-binding domain-1 (RBD-1), a nucleolar protein
          conserved in eukaryotes. It is involved in ribosome
          biogenesis by processing rRNA. In addition, it is
          essential for preimplantation development. RBM19 has a
          unique domain organization containing 6 conserved RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains). .
          Length = 76

 Score = 24.6 bits (54), Expect = 4.8
 Identities = 7/26 (26%), Positives = 15/26 (57%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRV 54
          ++ V  +P+ + E  L K+F  +G +
Sbjct: 2  RLIVKNLPKGIKEDKLRKLFEAFGTI 27


>gnl|CDD|240968 cd12524, RRM1_MEI2_like, RNA recognition motif 1 in plant
          Mei2-like proteins.  This subgroup corresponds to the
          RRM1 of Mei2-like proteins that represent an ancient
          eukaryotic RNA-binding proteins family. Their
          corresponding Mei2-like genes appear to have arisen
          early in eukaryote evolution, been lost from some
          lineages such as Saccharomyces cerevisiae and
          metazoans, and diversified in the plant lineage. The
          plant Mei2-like genes may function in cell fate
          specification during development, rather than as
          stimulators of meiosis. Members in this family contain
          three RNA recognition motifs (RRMs), also termed RBDs
          (RNA binding domains) or RNPs (ribonucleoprotein
          domains). The C-terminal RRM (RRM3) is unique to
          Mei2-like proteins and it is highly conserved between
          plants and fungi. Up to date, the intracellular
          localization, RNA target(s), cellular interactions and
          phosphorylation states of Mei2-like proteins in plants
          remain unclear. .
          Length = 77

 Score = 24.5 bits (54), Expect = 4.8
 Identities = 6/25 (24%), Positives = 16/25 (64%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRV 54
          +FV  I  ++++ +L  +F ++G +
Sbjct: 4  LFVRNINSNVEDEELRALFEQFGDI 28


>gnl|CDD|241133 cd12689, RRM1_hnRNPL_like, RNA recognition motif 1 in
          heterogeneous nuclear ribonucleoprotein L (hnRNP-L) and
          similar proteins.  This subfamily corresponds to the
          RRM1 of heterogeneous nuclear ribonucleoprotein L
          (hnRNP-L), heterogeneous nuclear ribonucleoprotein
          L-like (hnRNP-LL), and similar proteins. hnRNP-L is a
          higher eukaryotic specific subunit of human KMT3a (also
          known as HYPB or hSet2) complex required for histone H3
          Lys-36 trimethylation activity. It plays both, nuclear
          and cytoplasmic, roles in mRNA export of intronless
          genes, IRES-mediated translation, mRNA stability, and
          splicing. hnRNP-LL plays a critical and unique role in
          the signal-induced regulation of CD45 and acts as a
          global regulator of alternative splicing in activated T
          cells. It is closely related in domain structure and
          sequence to hnRNP-L, which contains three
          RNA-recognition motifs (RRMs), also known as RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain). .
          Length = 80

 Score = 24.6 bits (54), Expect = 5.1
 Identities = 8/26 (30%), Positives = 16/26 (61%)

Query: 35 IPRSMDEADLTKMFSEYGRVYNINVL 60
          +P  + EADL +  SE+G +  + ++
Sbjct: 10 LPDGVTEADLVEALSEFGPISYVTMM 35


>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell
          carcinoma antigen recognized by T-cells 3 (SART3) and
          similar proteins.  This subfamily corresponds to the
          RRM1 of SART3, also termed Tat-interacting protein of
          110 kDa (Tip110), an RNA-binding protein expressed in
          the nucleus of the majority of proliferating cells,
          including normal cells and malignant cells, but not in
          normal tissues except for the testes and fetal liver.
          It is involved in the regulation of mRNA splicing
          probably via its complex formation with RNA-binding
          protein with a serine-rich domain (RNPS1), a
          pre-mRNA-splicing factor. SART3 has also been
          identified as a nuclear Tat-interacting protein that
          regulates Tat transactivation activity through direct
          interaction and functions as an important cellular
          factor for HIV-1 gene expression and viral replication.
          In addition, SART3 is required for U6 snRNP targeting
          to Cajal bodies. It binds specifically and directly to
          the U6 snRNA, interacts transiently with the U6 and
          U4/U6 snRNPs, and promotes the reassembly of U4/U6
          snRNPs after splicing in vitro. SART3 contains an
          N-terminal half-a-tetratricopeptide repeat (HAT)-rich
          domain, a nuclearlocalization signal (NLS) domain, and
          two C-terminal RNA recognition motifs (RRMs), also
          termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). .
          Length = 72

 Score = 24.5 bits (54), Expect = 5.1
 Identities = 13/40 (32%), Positives = 26/40 (65%), Gaps = 1/40 (2%)

Query: 31 FVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          FV  +  S+ E +L K+FS+ G + ++ ++++   G+SKG
Sbjct: 3  FVSNLDYSVPEDELRKLFSKCGEITDVRLVKNYK-GKSKG 41


>gnl|CDD|187750 cd09233, ACE1-Sec16-like, Ancestral coatomer element 1 (ACE1) of
           COPII coat complex assembly protein Sec16.  COPII coat
           complex plays an important role in vesicular traffic of
           newly synthezised proteins from the endoplasmatic
           reticulum (ER) to the Golgi apparatus by mediating the
           formation of transport vesicles. COPII consists of an
           outer coat, made up of the scaffold proteins Sec31 and
           Sec13, and the cargo adaptor complex, Sec23 and Sec24,
           which are recruited by the small GTPase Sar1. Sec16 is
           involved in the early steps of the assembly process.
           Sec16 forms elongated heterotetramers with Sec13,
           Sec13-(Sec16)2-Sec13. It interacts with Sec13 by
           insertion of a single beta-blade to close the
           six-bladded beta propeller of Sec13. In the same way
           Sec13 interacts with Sec31 and Nup145C, a nuclear pore
           protein, all of these contain a structurally related
           ancestral coatomer element 1 (ACE1). Sec16 is believed
           to be a key component in maintaining the integrity of
           the ER exit site.
          Length = 314

 Score = 25.3 bits (56), Expect = 5.3
 Identities = 11/41 (26%), Positives = 18/41 (43%)

Query: 1   MGREKRRECTYEYVRSMSLPEQPDPDFIKMFVGQIPRSMDE 41
           +G+E   E    + RS S    P     ++F G  P ++ E
Sbjct: 101 LGKETWAEVVSRFARSESKLNDPLQTLYQLFSGNSPEAITE 141


>gnl|CDD|240703 cd12257, RRM1_RBM26_like, RNA recognition motif 1 in vertebrate
          RNA-binding protein 26 (RBM26) and similar proteins.
          This subfamily corresponds to the RRM1 of RBM26, and
          the RRM of RBM27. RBM26, also known as cutaneous T-cell
          lymphoma (CTCL) tumor antigen se70-2, represents a
          cutaneous lymphoma (CL)-associated antigen. It contains
          two RNA recognition motifs (RRMs), also known as RBDs
          (RNA binding domains) or RNPs (ribonucleoprotein
          domains). The RRMs may play some functional roles in
          RNA-binding or protein-protein interactions. RBM27
          contains only one RRM; its biological function remains
          unclear. .
          Length = 72

 Score = 24.4 bits (54), Expect = 5.7
 Identities = 10/32 (31%), Positives = 16/32 (50%), Gaps = 1/32 (3%)

Query: 29 KMFVGQIPR-SMDEADLTKMFSEYGRVYNINV 59
           + V  IP    +   L + FS++G + NI V
Sbjct: 3  TLEVRNIPPELNNITKLNEHFSKFGTIVNIQV 34


>gnl|CDD|240670 cd12224, RRM_RBM22, RNA recognition motif (RRM) found in
          Pre-mRNA-splicing factor RBM22 and similar proteins.
          This subgroup corresponds to the RRM of RBM22 (also
          known as RNA-binding motif protein 22, or Zinc finger
          CCCH domain-containing protein 16), a newly discovered
          RNA-binding motif protein which belongs to the SLT11
          gene family. SLT11 gene encoding protein (Slt11p) is a
          splicing factor in yeast, which is required for
          spliceosome assembly. Slt11p has two distinct
          biochemical properties: RNA-annealing and RNA-binding
          activities. RBM22 is the homolog of SLT11 in
          vertebrate. It has been reported to be involved in
          pre-splicesome assembly and to interact with the
          Ca2+-signaling protein ALG-2. It also plays an
          important role in embryogenesis. RBM22 contains a
          conserved RNA recognition motif (RRM), also known as
          RBD (RNA binding domain) or RNP (ribonucleoprotein
          domain), a zinc finger of the unusual type
          C-x8-C-x5-C-x3-H, and a C-terminus that is unusually
          rich in the amino acids Gly and Pro, including
          sequences of tetraprolines.
          Length = 74

 Score = 24.1 bits (53), Expect = 5.8
 Identities = 9/31 (29%), Positives = 18/31 (58%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVL 60
          ++VG +   + E DL   F ++G + +I V+
Sbjct: 4  LYVGGLGERVTEKDLRDHFYQFGEIRSITVV 34


>gnl|CDD|240999 cd12555, RRM2_RBM15, RNA recognition motif 2 in vertebrate RNA
          binding motif protein 15 (RBM15).  This subgroup
          corresponds to the RRM2 of RBM15, also termed
          one-twenty two protein 1 (OTT1), conserved in
          eukaryotes, a novel mRNA export factor and component of
          the NXF1 pathway. It binds to NXF1 and serves as
          receptor for the RNA export element RTE. It also
          possesses mRNA export activity and can facilitate the
          access of DEAD-box protein DBP5 to mRNA at the nuclear
          pore complex (NPC). RBM15 belongs to the Spen (split
          end) protein family, which contain three N-terminal RNA
          recognition motifs (RRMs), also known as RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain), and
          a C-terminal SPOC (Spen paralog and ortholog
          C-terminal) domain. This family also includes a
          RBM15-MKL1 (OTT-MAL) fusion protein that RBM15 is
          N-terminally fused to megakaryoblastic leukemia 1
          protein (MKL1) at the C-terminus in a translocation
          involving chromosome 1 and 22, resulting in acute
          megakaryoblastic leukemia. The fusion protein could
          interact with the mRNA export machinery. Although it
          maintains the specific transactivator function of MKL1,
          the fusion protein cannot activate RTE-mediated mRNA
          expression and has lost the post-transcriptional
          activator function of RBM15. However, it has
          transdominant suppressor function contributing to its
          oncogenic properties. .
          Length = 87

 Score = 24.5 bits (53), Expect = 5.8
 Identities = 12/50 (24%), Positives = 25/50 (50%), Gaps = 5/50 (10%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIFEAAFLK 79
          +F+G +  ++ E DL + F  +G +  +++ R       +G+     FLK
Sbjct: 10 LFLGNLDITVTETDLRRAFDRFGVITEVDIKR-----PGRGQTSTYGFLK 54


>gnl|CDD|235005 PRK02122, PRK02122, glucosamine-6-phosphate deaminase-like protein;
           Validated.
          Length = 652

 Score = 25.4 bits (56), Expect = 5.9
 Identities = 12/36 (33%), Positives = 20/36 (55%), Gaps = 5/36 (13%)

Query: 41  EADLTKMFSEYGRVYNINV-----LRDKVTGQSKGK 71
           E  L+ + ++YG  YN+N+     L+  +TG   GK
Sbjct: 318 ENGLSDLLAQYGSAYNVNIKVFNDLQHTITGWPGGK 353


>gnl|CDD|241069 cd12625, RRM1_IGF2BP1, RNA recognition motif 1 in vertebrate
          insulin-like growth factor 2 mRNA-binding protein 1
          (IGF2BP1).  This subgroup corresponds to the RRM1 of
          IGF2BP1 (IGF2 mRNA-binding protein 1 or IMP-1), also
          termed coding region determinant-binding protein
          (CRD-BP), or VICKZ family member 1, or zipcode-binding
          protein 1 (ZBP-1). IGF2BP1 is a multi-functional
          regulator of RNA metabolism that has been implicated in
          the control of aspects of localization, stability, and
          translation for many mRNAs. It is predominantly located
          in cytoplasm and was initially identified as a
          trans-acting factor that interacts with the zipcode in
          the 3'- untranslated region (UTR) of the beta-actin
          mRNA, which is important for its localization and
          translational regulation. It inhibits IGF-II mRNA
          translation through binding to the 5'-UTR of the
          transcript. IGF2BP1 also acts as human immunodeficiency
          virus type 1 (HIV-1) Gag-binding factor that interacts
          with HIV-1 Gag protein and blocks the formation of
          infectious HIV-1 particles. IGF2BP1 promotes mRNA
          stabilization; it functions as a coding region
          determinant (CRD)-binding protein that binds to the
          coding region of betaTrCP1 mRNA and prevents
          miR-183-mediated degradation of betaTrCP1 mRNA. It also
          promotes c-myc mRNA stability by associating with the
          CRD and stabilizes CD44 mRNA via interaction with the
          3'-UTR of the transcript. In addition, IGF2BP1
          specifically interacts with both Hepatitis C virus
          (HCV) 5'-UTR and 3'-UTR, further recruiting eIF3 and
          enhancing HCV internal ribosome entry site
          (IRES)-mediated translation initiation via the 3'-UTR.
          IGF2BP1 contains four hnRNP K-homology (KH) domains,
          two RNA recognition motifs (RRMs), also termed RBDs
          (RNA binding domains) or RNPs (ribonucleoprotein
          domains), and a RGG RNA-binding domain. It also
          contains two putative nuclear export signals (NESs) and
          a putative nuclear localization signal (NLS). .
          Length = 77

 Score = 24.2 bits (52), Expect = 6.1
 Identities = 8/23 (34%), Positives = 16/23 (69%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEY 51
          K+++G +  S+  ADL K+F ++
Sbjct: 3  KLYIGNLNESVTPADLEKVFEDH 25


>gnl|CDD|239132 cd02667, Peptidase_C19K, A subfamily of Peptidase C19. Peptidase
           C19 contains ubiquitinyl hydrolases. They are
           intracellular peptidases that remove ubiquitin molecules
           from polyubiquinated peptides by cleavage of isopeptide
           bonds. They hydrolyze bonds involving the carboxyl group
           of the C-terminal Gly residue of ubiquitin. The purpose
           of the de-ubiquitination is thought to be editing of the
           ubiquitin conjugates, which could rescue them from
           degradation, as well as recycling of the ubiquitin. The
           ubiquitin/proteasome system is responsible for most
           protein turnover in the mammalian cell, and with over 50
           members, family C19 is one of the largest families of
           peptidases in the human genome.
          Length = 279

 Score = 25.0 bits (55), Expect = 6.2
 Identities = 5/18 (27%), Positives = 7/18 (38%)

Query: 9   CTYEYVRSMSLPEQPDPD 26
             YE    +SLP   +  
Sbjct: 91  LVYEPFLDLSLPRSDEIK 108


>gnl|CDD|241167 cd12723, RRM1_CPEB1, RNA recognition motif 1 in cytoplasmic
          polyadenylation element-binding protein 1 (CPEB-1) and
          similar proteins.  This subgroup corresponds to the
          RRM2 of CPEB-1 (also termed CPE-BP1 or CEBP), an
          RNA-binding protein that interacts with the cytoplasmic
          polyadenylation element (CPE), a short U-rich motif in
          the 3' untranslated regions (UTRs) of certain mRNAs. It
          functions as a translational regulator that plays a
          major role in the control of maternal CPE-containing
          mRNA in oocytes, as well as of subsynaptic
          CPE-containing mRNA in neurons. Once phosphorylated and
          recruiting the polyadenylation complex, CPEB-1 may
          function as a translational activator stimulating
          polyadenylation and translation. Otherwise, it may
          function as a translational inhibitor when
          dephosphorylated and bound to a protein such as maskin
          or neuroguidin, which blocks translation initiation
          through interfering with the assembly of eIF-4E and
          eIF-4G. Although CPEB-1 is mainly located in cytoplasm,
          it can shuttle between nucleus and cytoplasm. CPEB-1
          contains an N-terminal unstructured region, two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          and a Zn-finger motif. Both of the RRMs and the Zn
          finger are required for CPEB-1 to bind CPE. The
          N-terminal regulatory region may be responsible for
          CPEB-1 interacting with other proteins. .
          Length = 100

 Score = 24.7 bits (54), Expect = 6.3
 Identities = 10/26 (38%), Positives = 15/26 (57%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRV 54
          K+F+G +P  + EA L   F  +G V
Sbjct: 4  KVFLGGVPWDITEAGLINTFKPFGSV 29


>gnl|CDD|240696 cd12250, RRM2_hnRNPR_like, RNA recognition motif 2 in
          heterogeneous nuclear ribonucleoprotein R (hnRNP R) and
          similar proteins.  This subfamily corresponds to the
          RRM2 in hnRNP R, hnRNP Q, APOBEC-1 complementation
          factor (ACF), and dead end protein homolog 1 (DND1).
          hnRNP R is a ubiquitously expressed nuclear RNA-binding
          protein that specifically bind mRNAs with a preference
          for poly(U) stretches. It has been implicated in mRNA
          processing and mRNA transport, and also acts as a
          regulator to modify binding to ribosomes and RNA
          translation. hnRNP Q is also a ubiquitously expressed
          nuclear RNA-binding protein. It has been identified as
          a component of the spliceosome complex, as well as a
          component of the apobec-1 editosome, and has been
          implicated in the regulation of specific mRNA
          transport. ACF is an RNA-binding subunit of a core
          complex that interacts with apoB mRNA to facilitate C
          to U RNA editing. It may also act as an apoB mRNA
          recognition factor and chaperone and play a key role in
          cell growth and differentiation. DND1 is essential for
          maintaining viable germ cells in vertebrates. It
          interacts with the 3'-untranslated region (3'-UTR) of
          multiple messenger RNAs (mRNAs) and prevents micro-RNA
          (miRNA) mediated repression of mRNA. This family also
          includes two functionally unknown RNA-binding proteins,
          RBM46 and RBM47. All members in this family, except for
          DND1, contain three conserved RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains); DND1 harbors only two
          RRMs. .
          Length = 82

 Score = 24.2 bits (53), Expect = 6.7
 Identities = 7/22 (31%), Positives = 16/22 (72%)

Query: 29 KMFVGQIPRSMDEADLTKMFSE 50
          ++FVG IP++  + ++ + FS+
Sbjct: 3  RLFVGGIPKTKTKEEILEEFSK 24


>gnl|CDD|241000 cd12556, RRM2_RBM15B, RNA recognition motif 2 in putative RNA
          binding motif protein 15B (RBM15B) from vertebrate.
          This subgroup corresponds to the RRM2 of RBM15B, also
          termed one twenty-two 3 (OTT3), a paralog of RNA
          binding motif protein 15 (RBM15), also known as
          One-twenty two protein 1 (OTT1). Like RBM15, RBM15B has
          post-transcriptional regulatory activity. It is a
          nuclear protein sharing with RBM15 the association with
          the splicing factor compartment and the nuclear
          envelope as well as the binding to mRNA export factors
          NXF1 and Aly/REF. RBM15B belongs to the Spen (split
          end) protein family, which shares a domain architecture
          comprising of three N-terminal RNA recognition motifs
          (RRMs), also known as RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), and a C-terminal SPOC (Spen
          paralog and ortholog C-terminal) domain. .
          Length = 85

 Score = 24.5 bits (53), Expect = 6.8
 Identities = 13/50 (26%), Positives = 27/50 (54%), Gaps = 5/50 (10%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIFEAAFLK 79
          +F+G +  ++ E +L + F +YG +  + + R     + +G  +  AFLK
Sbjct: 11 LFIGNLDHNVSEVELRRAFDKYGIIEEVVIKR---PARGQGGAY--AFLK 55


>gnl|CDD|206655 cd01862, Rab7, Rab GTPase family 7 (Rab7).  Rab7 subfamily. Rab7 is
           a small Rab GTPase that regulates vesicular traffic from
           early to late endosomal stages of the endocytic pathway.
           The yeast Ypt7 and mammalian Rab7 are both involved in
           transport to the vacuole/lysosome, whereas Ypt7 is also
           required for homotypic vacuole fusion. Mammalian Rab7 is
           an essential participant in the autophagic pathway for
           sequestration and targeting of cytoplasmic components to
           the lytic compartment. Mammalian Rab7 is also proposed
           to function as a tumor suppressor. GTPase activating
           proteins (GAPs) interact with GTP-bound Rab and
           accelerate the hydrolysis of GTP to GDP. Guanine
           nucleotide exchange factors (GEFs) interact with
           GDP-bound Rabs to promote the formation of the GTP-bound
           state. Rabs are further regulated by guanine nucleotide
           dissociation inhibitors (GDIs), which facilitate Rab
           recycling by masking C-terminal lipid binding and
           promoting cytosolic localization. Most Rab GTPases
           contain a lipid modification site at the C-terminus,
           with sequence motifs CC, CXC, or CCX. Lipid binding is
           essential for membrane attachment, a key feature of most
           Rab proteins. Due to the presence of truncated sequences
           in this CD, the lipid modification site is not available
           for annotation.
          Length = 172

 Score = 24.9 bits (55), Expect = 7.1
 Identities = 8/17 (47%), Positives = 11/17 (64%)

Query: 74  EAAFLKIARAAIEPQKA 90
           + AF  IAR A+E +K 
Sbjct: 156 DQAFETIARLALEQEKE 172


>gnl|CDD|240680 cd12234, RRM1_AtRSp31_like, RNA recognition motif in Arabidopsis
          thaliana arginine/serine-rich-splicing factor RSp31 and
          similar proteins from plants.  This subfamily
          corresponds to the RRM1in a family that represents a
          novel group of arginine/serine (RS) or serine/arginine
          (SR) splicing factors existing in plants, such as A.
          thaliana RSp31, RSp35, RSp41 and similar proteins. Like
          vertebrate RS splicing factors, these proteins function
          as plant splicing factors and play crucial roles in
          constitutive and alternative splicing in plants. They
          all contain two RNA recognition motifs (RRMs), also
          termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), at their N-terminus, and
          an RS domain at their C-terminus.
          Length = 72

 Score = 24.0 bits (52), Expect = 8.3
 Identities = 7/25 (28%), Positives = 15/25 (60%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRV 54
          +F G       ++++ ++F +YGRV
Sbjct: 3  VFCGNFEYDARQSEIERLFGKYGRV 27


>gnl|CDD|114930 pfam06238, Borrelia_lipo_2, Borrelia burgdorferi BBR25
          lipoprotein.  This family consists of a number of
          lipoproteins from the Lyme disease spirochete Borrelia
          burgdorferi.
          Length = 111

 Score = 24.2 bits (52), Expect = 8.3
 Identities = 14/45 (31%), Positives = 26/45 (57%), Gaps = 3/45 (6%)

Query: 27 FIKMFVGQIPRSMDEADLTKMFSEYGRV--YNINVLRDKVTGQSK 69
          F K ++  + +SM+ A+ TK+F E   +  YNI ++    T ++K
Sbjct: 41 FYKTYISTL-KSMETAESTKIFEEIKDILKYNIEIIEAISTDKNK 84


>gnl|CDD|240797 cd12351, RRM4_SHARP, RNA recognition motif 4 in
          SMART/HDAC1-associated repressor protein (SHARP) and
          similar proteins.  This subfamily corresponds to the
          RRM of SHARP, also termed Msx2-interacting protein
          (MINT), or SPEN homolog, is an estrogen-inducible
          transcriptional repressor that interacts directly with
          the nuclear receptor corepressor SMRT, histone
          deacetylases (HDACs) and components of the NuRD
          complex. SHARP recruits HDAC activity and binds to the
          steroid receptor RNA coactivator SRA through four
          conserved N-terminal RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), further suppressing
          SRA-potentiated steroid receptor transcription
          activity. Thus, SHARP has the capacity to modulate both
          liganded and nonliganded nuclear receptors. SHARP also
          has been identified as a component of transcriptional
          repression complexes in Notch/RBP-Jkappa signaling
          pathways. In addition to the N-terminal RRMs, SHARP
          possesses a C-terminal SPOC domain (Spen paralog and
          ortholog C-terminal domain), which is highly conserved
          among Spen proteins. .
          Length = 77

 Score = 23.8 bits (52), Expect = 8.5
 Identities = 10/29 (34%), Positives = 17/29 (58%)

Query: 35 IPRSMDEADLTKMFSEYGRVYNINVLRDK 63
          +  S+ E  LT+ FS YG V ++ + R +
Sbjct: 15 LDESVTEQYLTRHFSRYGPVVHVVIDRQR 43


>gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast
          nucleolar protein 13 (Nop13p) and similar proteins.
          This subfamily corresponds to the RRM2 of Nop13p
          encoded by YNL175c from Saccharomyces cerevisiae. It
          shares high sequence similarity with nucleolar protein
          12 (Nop12p). Both Nop12p and Nop13p are not essential
          for growth. However, unlike Nop12p that is localized to
          the nucleolus, Nop13p localizes primarily to the
          nucleolus but is also present in the nucleoplasm to a
          lesser extent. Nop13p contains two RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains). .
          Length = 73

 Score = 23.9 bits (52), Expect = 8.6
 Identities = 11/41 (26%), Positives = 21/41 (51%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKG 70
          +FVG +     E +L   F   GR+  + ++  + +G+ KG
Sbjct: 1  LFVGNLSFETTEDELRAHFGRVGRIRRVRMMTFEDSGKCKG 41


>gnl|CDD|240735 cd12289, RRM_LARP6, RNA recognition motif in La-related protein 6
          (LARP6) and similar proteins.  This subfamily
          corresponds to the RRM of LARP6, also termed Acheron
          (Achn), a novel member of the lupus antigen (La)
          family. It is expressed predominantly in neurons and
          muscle in vertebrates. LARP6 functions as a key
          regulatory protein that may play a role in mediating a
          variety of developmental and homeostatic processes in
          animals, including myogenesis, neurogenesis and
          possibly metastasis. LARP6 binds to
          Ca2+/calmodulin-dependent serine protein kinase (CASK),
          and forms a complex with inhibitor of differentiation
          transcription factors. It is structurally related to
          the La autoantigen and contains a La motif (LAM),
          nuclear localization and export (NLS and NES) signals,
          and an RNA recognition motif (RRM), also termed RBD
          (RNA binding domain) or RNP (ribonucleoprotein domain).
          .
          Length = 93

 Score = 24.2 bits (53), Expect = 8.6
 Identities = 6/27 (22%), Positives = 14/27 (51%), Gaps = 2/27 (7%)

Query: 35 IPRSMDEADLTKMFSEYGRVYNINVLR 61
             +++   + ++FS  G +  I +LR
Sbjct: 11 EESTIE--SVLELFSTCGVIALIRILR 35


>gnl|CDD|241041 cd12597, RRM1_SRSF1, RNA recognition motif 1 in
          serine/arginine-rich splicing factor 1 (SRSF1) and
          similar proteins.  This subgroup corresponds to the
          RRM1 of SRSF1, also termed alternative-splicing factor
          1 (ASF-1), or pre-mRNA-splicing factor SF2, P33
          subunit. SRSF1 is a splicing regulatory serine/arginine
          (SR) protein involved in constitutive and alternative
          splicing, nonsense-mediated mRNA decay (NMD), mRNA
          export and translation. It also functions as a
          splicing-factor oncoprotein that regulates apoptosis
          and proliferation to promote mammary epithelial cell
          transformation. SRSF1 is a shuttling SR protein and
          contains two N-terminal RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), separated by a long
          glycine-rich spacer, and a C-terminal RS domains rich
          in serine-arginine dipeptides. .
          Length = 73

 Score = 24.0 bits (52), Expect = 9.1
 Identities = 8/31 (25%), Positives = 20/31 (64%)

Query: 29 KMFVGQIPRSMDEADLTKMFSEYGRVYNINV 59
          +++VG +P  +   D+  +F +YG + +I++
Sbjct: 1  RIYVGNLPPDIRTKDIEDLFYKYGAIRDIDL 31


>gnl|CDD|240939 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in vertebrate
          heterogeneous nuclear ribonucleoprotein Q (hnRNP Q).
          This subgroup corresponds to the RRM3 of hnRNP Q, also
          termed glycine- and tyrosine-rich RNA-binding protein
          (GRY-RBP), or NS1-associated protein 1 (NASP1), or
          synaptotagmin-binding, cytoplasmic RNA-interacting
          protein (SYNCRIP). It is a ubiquitously expressed
          nuclear RNA-binding protein identified as a component
          of the spliceosome complex, as well as a component of
          the apobec-1 editosome. As an alternatively spliced
          version of NSAP, it acts as an interaction partner of a
          multifunctional protein required for viral replication,
          and is implicated in the regulation of specific mRNA
          transport. hnRNP Q has also been identified as SYNCRIP
          that is a dual functional protein participating in both
          viral RNA replication and translation. As a
          synaptotagmin-binding protein, hnRNP Q plays a putative
          role in organelle-based mRNA transport along the
          cytoskeleton. Moreover, hnRNP Q has been found in
          protein complexes involved in translationally coupled
          mRNA turnover and mRNA splicing. It functions as a
          wild-type survival motor neuron (SMN)-binding protein
          that may participate in pre-mRNA splicing and modulate
          mRNA transport along microtubuli. hnRNP Q contains an
          acidic auxiliary N-terminal region, followed by two
          well defined and one degenerated RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a C-terminal RGG
          motif; hnRNP Q binds RNA through its RRM domains. .
          Length = 72

 Score = 23.8 bits (51), Expect = 10.0
 Identities = 9/33 (27%), Positives = 19/33 (57%)

Query: 30 MFVGQIPRSMDEADLTKMFSEYGRVYNINVLRD 62
          +FV  +  ++ E  L K F ++G++  +  L+D
Sbjct: 4  LFVRNLANTVTEEILEKAFGQFGKLERVKKLKD 36


>gnl|CDD|227637 COG5329, COG5329, Phosphoinositide polyphosphatase (Sac family)
           [Signal transduction mechanisms].
          Length = 570

 Score = 24.7 bits (54), Expect = 10.0
 Identities = 8/19 (42%), Positives = 13/19 (68%)

Query: 45  TKMFSEYGRVYNINVLRDK 63
            K+  +YG VY +N+L+ K
Sbjct: 300 DKLREKYGDVYVVNLLKTK 318


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.320    0.136    0.388 

Gapped
Lambda     K      H
   0.267   0.0783    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 4,745,399
Number of extensions: 384952
Number of successful extensions: 672
Number of sequences better than 10.0: 1
Number of HSP's gapped: 671
Number of HSP's successfully gapped: 281
Length of query: 91
Length of database: 10,937,602
Length adjustment: 58
Effective length of query: 33
Effective length of database: 8,365,070
Effective search space: 276047310
Effective search space used: 276047310
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (24.1 bits)