Diaphorina citri psyllid: psy11978


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-
MGREKRRECTYEYVRSMSLPEQPDPDFIKMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIFEAAFLKIARAAIEPQKAP
cccccccccccccccccccccccccccccEEECcccccccHHHHHHHHHcccccEEEEEEEcccccccccEEEEEEcHHHHHHHHcccccc
**************************FIKMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIFEAAFLKIARAAIEPQK**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGREKRRECTYEYVRSMSLPEQPDPDFIKMFVGQIPRSMDEADLTKMFSEYGRVYNINVLRDKVTGQSKGKIFEAAFLKIARAAIEPQKAP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
CUGBP Elav-like family member 2 RNA-binding protein implicated in the regulation of several post-transcriptional events. Involved in pre-mRNA alternative splicing, mRNA translation and stability. Mediates exon inclusion and/or exclusion in pre-mRNA that are subject to tissue-specific and developmentally regulated alternative splicing. Specifically activates exon 5 inclusion of TNNT2 in embryonic, but not adult, skeletal muscle. Activates TNNT2 exon 5 inclusion by antagonizing the repressive effect of PTB. Acts as both an activator and repressor of a pair of coregulated exons: promotes inclusion of the smooth muscle (SM) exon but exclusion of the non-muscle (NM) exon in actinin pre-mRNAs. Promotes inclusion of exonS 21 and exclusion of exon 5 of the NMDA receptor R1 pre-mRNA. Involved in the apoB RNA editing activity. Increases COX2 mRNA stability and inhibits COX2 mRNA translation in epithelial cells after radiation injury (By similarity). Modulates the cellular apoptosis program by regulating COX2-mediated prostaglandin E2 (PGE2) expression (By similarity). Binds to (CUG)n triplet repeats in the 3'-UTR of transcripts such as DMPK. Binds to the muscle-specific splicing enhancer (MSE) intronic sites flanking the TNNT2 alternative exon 5. Binds preferentially to UG-rich sequences, in particular UG repeat and UGUU motifs. Binds to apoB mRNA, specifically to AU-rich sequences located immediatly upstream of the edited cytidine. Binds AU-rich sequences in the 3'-UTR of COX2 mRNA (By similarity). Binds to an intronic RNA element responsible for the silencing of exon 21 splicing (By similarity). Binds to (CUG)n repeats.confidentO95319
CUGBP Elav-like family member 2 RNA-binding protein implicated in the regulation of several post-transcriptional events. Involved in pre-mRNA alternative splicing, mRNA translation and stability. Mediates exon inclusion and/or exclusion in pre-mRNA that are subject to tissue-specific and developmentally regulated alternative splicing (By similarity). Specifically activates exon 5 inclusion of TNNT2 in embryonic, but not adult, skeletal muscle (By similarity). Activates TNNT2 exon 5 inclusion by antagonizing the repressive effect of PTB (By similarity). Acts as both an activator and repressor of a pair of coregulated exons: promotes inclusion of the smooth muscle (SM) exon but exclusion of the non-muscle (NM) exon in actinin pre-mRNAs (By similarity). Promotes inclusion of exonS 21 and exclusion of exon 5 of the NMDA receptor R1 pre-mRNA (By similarity). Involved in the apoB RNA editing activity (By similarity). Increases COX2 mRNA stability and inhibits COX2 mRNA translation in epithelial cells after radiation injury. Modulates the cellular apoptosis program by regulating COX2-mediated prostaglandin E2 (PGE2) expression. Binds to (CUG)n triplet repeats in the 3'-UTR of transcripts such as DMPK (By similarity). Binds to the muscle-specific splicing enhancer (MSE) intronic sites flanking the TNNT2 alternative exon 5 (By similarity). Binds preferentially to UG-rich sequences, in particular UG repeat and UGUU motifs (By similarity). Binds to apoB mRNA, specifically to AU-rich sequences located immediatly upstream of the edited cytidine (By similarity). Binds AU-rich sequences in the 3'-UTR of COX2 mRNA. Binds to an intronic RNA element responsible for the silencing of exon 21 splicing. Binds to (CUG)n repeats.confidentQ9Z0H4
CUGBP Elav-like family member 2 RNA-binding protein implicated in the regulation of several post-transcriptional events. Involved in pre-mRNA alternative splicing, mRNA translation and stability. Mediates exon inclusion and/or exclusion in pre-mRNA that are subject to tissue-specific and developmentally regulated alternative splicing. Specifically activates exon 5 inclusion of TNNT2 in embryonic, but not adult, skeletal muscle. Activates TNNT2 exon 5 inclusion by antagonizing the repressive effect of PTB. Acts as both an activator and repressor of a pair of coregulated exons: promotes inclusion of the smooth muscle (SM) exon but exclusion of the non-muscle (NM) exon in actinin pre-mRNAs. Promotes inclusion of exonS 21 and exclusion of exon 5 of the NMDA receptor R1 pre-mRNA. Involved in the apoB RNA editing activity. Increases COX2 mRNA stability and inhibits COX2 mRNA translation in epithelial cells after radiation injury. Modulates the cellular apoptosis program by regulating COX2-mediated prostaglandin E2 (PGE2) expression. Binds to (CUG)n triplet repeats in the 3'-UTR of transcripts such as DMPK. Binds to the muscle-specific splicing enhancer (MSE) intronic sites flanking the TNNT2 alternative exon 5. Binds preferentially to UG-rich sequences, in particular UG repeat and UGUU motifs. Binds to apoB mRNA, specifically to AU-rich sequences located immediatly upstream of the edited cytidine. Binds AU-rich sequences in the 3'-UTR of COX2 mRNA. Binds to an intronic RNA element responsible for the silencing of exon 21 splicing. Binds to (CUG)n repeats.confidentQ5R8Y8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000166 [MF]nucleotide bindingprobableGO:0097159, GO:0036094, GO:0003674, GO:0005488, GO:1901363, GO:1901265
GO:0007286 [BP]spermatid developmentprobableGO:0048610, GO:0022412, GO:0048468, GO:0019953, GO:0032501, GO:0007276, GO:0000003, GO:0048869, GO:0048515, GO:0030855, GO:0002064, GO:0032502, GO:0030154, GO:0048609, GO:0032504, GO:0060429, GO:0009888, GO:0044767, GO:0022414, GO:0007283, GO:0044763, GO:0048232, GO:0007281, GO:0044699, GO:0044702, GO:0003006, GO:0048856, GO:0008150, GO:0009987
GO:0006376 [BP]mRNA splice site selectionprobableGO:0022607, GO:0000245, GO:0043933, GO:0090304, GO:0034641, GO:0006807, GO:0044237, GO:0034622, GO:0071840, GO:0006139, GO:0071826, GO:0044260, GO:0016043, GO:0065003, GO:0071704, GO:0010467, GO:0022618, GO:1901360, GO:0022613, GO:0008380, GO:0044238, GO:0009987, GO:0006725, GO:0000375, GO:0000377, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0016071, GO:0000398, GO:0043170, GO:0044085, GO:0006396, GO:0006397
GO:0009941 [CC]chloroplast envelopeprobableGO:0009526, GO:0005737, GO:0009536, GO:0005575, GO:0043231, GO:0044464, GO:0043229, GO:0031967, GO:0031975, GO:0044446, GO:0044444, GO:0005623, GO:0044435, GO:0044434, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0043186 [CC]P granuleprobableGO:0005737, GO:0035770, GO:0043232, GO:0060293, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226, GO:0045495
GO:2000112 [BP]regulation of cellular macromolecule biosynthetic processprobableGO:0009889, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0050794, GO:0010556, GO:0065007, GO:0008150, GO:0050789
GO:0003730 [MF]mRNA 3'-UTR bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003729, GO:1901363, GO:0003723
GO:0045087 [BP]innate immune responseprobableGO:0002376, GO:0050896, GO:0006952, GO:0006950, GO:0008150, GO:0006955
GO:0030532 [CC]small nuclear ribonucleoprotein complexprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0040018 [BP]positive regulation of multicellular organism growthprobableGO:0040014, GO:0051240, GO:0050789, GO:0065007, GO:0051239, GO:0048518, GO:0008150, GO:0040008, GO:0045927
GO:0005681 [CC]spliceosomal complexprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0009570 [CC]chloroplast stromaprobableGO:0005737, GO:0005575, GO:0009536, GO:0043231, GO:0009532, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044435, GO:0044434, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0042835 [MF]BRE bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0009535 [CC]chloroplast thylakoid membraneprobableGO:0055035, GO:0034357, GO:0031976, GO:0043229, GO:0043227, GO:0043226, GO:0009579, GO:0009534, GO:0009536, GO:0016020, GO:0044436, GO:0044435, GO:0044434, GO:0005737, GO:0044446, GO:0031984, GO:0042651, GO:0009507, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044422
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0005938 [CC]cell cortexprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0010604 [BP]positive regulation of macromolecule metabolic processprobableGO:0009893, GO:0019222, GO:0060255, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0017091 [MF]AU-rich element bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0031981 [CC]nuclear lumenprobableGO:0005575, GO:0043231, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0010608 [BP]posttranscriptional regulation of gene expressionprobableGO:0019222, GO:0060255, GO:0050789, GO:0008150, GO:0065007, GO:0010468
GO:0031369 [MF]translation initiation factor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0000381 [BP]regulation of alternative mRNA splicing, via spliceosomeprobableGO:0051252, GO:0080090, GO:0019222, GO:0060255, GO:0050684, GO:0043484, GO:0031323, GO:0050794, GO:0050789, GO:0019219, GO:0065007, GO:0051171, GO:0048024, GO:0008150, GO:0010468
GO:0008266 [MF]poly(U) RNA bindingprobableGO:0097159, GO:0003727, GO:0003674, GO:0003723, GO:0003676, GO:0008187, GO:1901363, GO:0005488
GO:0031325 [BP]positive regulation of cellular metabolic processprobableGO:0009893, GO:0019222, GO:0031323, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3NMR, chain A
Confidence level:very confident
Coverage over the Query: 26-89
View the alignment between query and template
View the model in PyMOL