Query         psy11988
Match_columns 156
No_of_seqs    119 out of 870
Neff          6.3 
Searched_HMMs 46136
Date          Fri Aug 16 15:43:49 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy11988.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/11988hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF00093 VWC:  von Willebrand f  99.5 6.5E-14 1.4E-18   90.8   4.6   55   36-92      1-57  (57)
  2 smart00214 VWC von Willebrand   99.4   5E-13 1.1E-17   87.1   5.7   55   36-92      1-59  (59)
  3 PF00093 VWC:  von Willebrand f  97.9 8.4E-06 1.8E-10   52.5   2.0   32    1-33     26-57  (57)
  4 smart00215 VWC_out von Willebr  97.8 1.1E-05 2.4E-10   54.1   2.5   40   36-78      1-41  (67)
  5 PF12714 TILa:  TILa domain      97.5 0.00019 4.2E-09   46.3   4.1   38   35-74      1-41  (56)
  6 smart00214 VWC von Willebrand   97.2 0.00029 6.3E-09   45.5   3.0   33    1-33     26-59  (59)
  7 PF05375 Pacifastin_I:  Pacifas  91.9    0.24 5.2E-06   29.7   3.1   28   44-74      3-31  (39)
  8 cd00061 FN1 Fibronectin type 1  89.5     0.8 1.7E-05   27.9   3.9   35   36-70      3-42  (43)
  9 PF05825 PSP94:  Beta-microsemi  88.7    0.53 1.1E-05   33.5   3.2   34   35-70     17-51  (94)
 10 KOG1544|consensus               86.7    0.63 1.4E-05   40.5   3.0   47   25-74     87-147 (470)
 11 PF15430 SVWC:  Single domain v  85.6     2.1 4.6E-05   27.2   4.5   38   36-74      1-38  (65)
 12 smart00215 VWC_out von Willebr  85.3    0.45 9.6E-06   31.8   1.1   33   95-127     1-43  (67)
 13 PF14828 Amnionless:  Amnionles  84.4    0.45 9.7E-06   42.5   1.1   28    5-35    205-234 (437)
 14 smart00058 FN1 Fibronectin typ  82.2     3.3 7.3E-05   25.5   4.0   32   40-71      7-43  (45)
 15 PF14828 Amnionless:  Amnionles  81.2    0.56 1.2E-05   41.9   0.4   36   57-93    192-233 (437)
 16 PF15430 SVWC:  Single domain v  75.5     2.9 6.2E-05   26.6   2.4   30   95-124     1-30  (65)
 17 PF00039 fn1:  Fibronectin type  73.6     3.4 7.4E-05   24.6   2.2   30   39-68      6-39  (39)
 18 PF12714 TILa:  TILa domain      59.1      14  0.0003   23.4   3.1   25   94-119     1-27  (56)
 19 PF09443 CFC:  Cripto_Frl-1_Cry  39.1      11 0.00024   22.3   0.2   24   47-72      7-30  (36)
 20 PF10791 F1F0-ATPsyn_F:  Mitoch  37.5      19 0.00041   25.7   1.2   23  127-149    73-95  (95)
 21 PF09064 Tme5_EGF_like:  Thromb  26.3      48   0.001   19.3   1.4   13    5-19      2-14  (34)

No 1  
>PF00093 VWC:  von Willebrand factor type C domain;  InterPro: IPR001007 The vWF domain is found in various plasma proteins: complement factors B, C2, CR3 and CR4; the integrins (I-domains); collagen types VI, VII, XII and XIV; and other extracellular proteins [, , ]. Although the majority of VWA-containing proteins are extracellular, the most ancient ones present in all eukaryotes are all intracellular proteins involved in functions such as transcription, DNA repair, ribosomal and membrane transport and the proteasome. A common feature appears to be involvement in multiprotein complexes. Proteins that incorporate vWF domains participate in numerous biological events (e.g. cell adhesion, migration, homing, pattern formation, and signal transduction), involving interaction with a large array of ligands []. A number of human diseases arise from mutations in VWA domains. Secondary structure prediction from 75 aligned vWF sequences has revealed a largely alternating sequence of alpha-helices and beta-strands []. The domain is named after the von Willebrand factor (VWF) type C repeat which is found in multidomain protein/multifunctional proteins involved in maintaining homeostasis [, ]. For the von Willebrand factor the duplicated VWFC domain is thought to participate in oligomerization, but not in the initial dimerization step []. The presence of this region in a number of other complex-forming proteins points to the possible involvment of the VWFC domain in complex formation.; GO: 0005515 protein binding; PDB: 1U5M_A.
Probab=99.46  E-value=6.5e-14  Score=90.77  Aligned_cols=55  Identities=36%  Similarity=0.996  Sum_probs=34.5

Q ss_pred             cccCCEEecCCCeEeCCCCCceEEEecCCceEEEeeecC-CCCCCCC-CCCCCCCCCCC
Q psy11988         36 CVHHGVFRESGSEWTDPDNPCRIFTCKAGVVTETEMQCY-APCKHPT-PPGPGQCCPTC   92 (156)
Q Consensus        36 C~~~g~~y~~Ge~w~~~~d~C~~C~C~~G~v~C~~~~Cp-~~C~~~~-~~~pG~CCp~C   92 (156)
                      |.++|++|.+|++|++  ++|++|+|.+|.|.|.++.|| ++|+.+. +..+|+|||+|
T Consensus         1 C~~~g~~y~~g~~w~~--~~C~~C~C~~G~v~C~~~~Cp~~~C~~~~~~~~~g~CCp~C   57 (57)
T PF00093_consen    1 CSFNGRVYQNGESWHP--DPCTTCTCQDGEVQCSRIQCPPLDCPNPELVKPPGECCPVC   57 (57)
T ss_dssp             EESSS-EE-SS-EE-S---SSEEEEEETTEEEEEE---S-SS-S-------SS-S--S-
T ss_pred             CeeCCEEeCCCCEECC--CCCcEeEecCCEEEEcCCCCcCCCCCCCceecCCCCcCCCC
Confidence            6899999999999999  679999999999999999999 8999983 38899999987


No 2  
>smart00214 VWC von Willebrand factor (vWF) type C domain.
Probab=99.41  E-value=5e-13  Score=87.12  Aligned_cols=55  Identities=40%  Similarity=1.044  Sum_probs=50.5

Q ss_pred             cccCCEEecCCCeEeCCCCCceEEEecCCc-eEEEeeecC-C-CCCCCC-CCCCCCCCCCC
Q psy11988         36 CVHHGVFRESGSEWTDPDNPCRIFTCKAGV-VTETEMQCY-A-PCKHPT-PPGPGQCCPTC   92 (156)
Q Consensus        36 C~~~g~~y~~Ge~w~~~~d~C~~C~C~~G~-v~C~~~~Cp-~-~C~~~~-~~~pG~CCp~C   92 (156)
                      |.|+|+.|.+|++|++  |+|++|+|.+|. |.|.++.|| . .|+++. +..+|+|||+|
T Consensus         1 C~~~g~~y~~G~~W~~--~~C~~C~C~~g~~v~C~~~~Cp~~~~C~~~~~~~~~g~CCp~C   59 (59)
T smart00214        1 CVHNGEVYNDGETWKP--DPCQICTCLDGETVLCDPVECPPPPDCPNPERVKPPGECCPRC   59 (59)
T ss_pred             CccCCEEeCCCCEECC--CCCeECCcCCCCEEEeeeecCCCCCCCCCCcccCCCCCcCCCC
Confidence            7899999999999998  789999999999 999999999 4 799886 47899999987


No 3  
>PF00093 VWC:  von Willebrand factor type C domain;  InterPro: IPR001007 The vWF domain is found in various plasma proteins: complement factors B, C2, CR3 and CR4; the integrins (I-domains); collagen types VI, VII, XII and XIV; and other extracellular proteins [, , ]. Although the majority of VWA-containing proteins are extracellular, the most ancient ones present in all eukaryotes are all intracellular proteins involved in functions such as transcription, DNA repair, ribosomal and membrane transport and the proteasome. A common feature appears to be involvement in multiprotein complexes. Proteins that incorporate vWF domains participate in numerous biological events (e.g. cell adhesion, migration, homing, pattern formation, and signal transduction), involving interaction with a large array of ligands []. A number of human diseases arise from mutations in VWA domains. Secondary structure prediction from 75 aligned vWF sequences has revealed a largely alternating sequence of alpha-helices and beta-strands []. The domain is named after the von Willebrand factor (VWF) type C repeat which is found in multidomain protein/multifunctional proteins involved in maintaining homeostasis [, ]. For the von Willebrand factor the duplicated VWFC domain is thought to participate in oligomerization, but not in the initial dimerization step []. The presence of this region in a number of other complex-forming proteins points to the possible involvment of the VWFC domain in complex formation.; GO: 0005515 protein binding; PDB: 1U5M_A.
Probab=97.86  E-value=8.4e-06  Score=52.52  Aligned_cols=32  Identities=34%  Similarity=0.845  Sum_probs=14.8

Q ss_pred             CCeEEeeccCCCCCCCCCcccccccCCCcCCCC
Q psy11988          1 NGFVECNRKSCPNQEGCHKLLEAKEKDGCCRKC   33 (156)
Q Consensus         1 ~G~v~C~~~~Cp~~~~C~~~v~~~~~g~CCP~C   33 (156)
                      +|.|+|.++.||+++ |+++.+.+.+|+|||+|
T Consensus        26 ~G~v~C~~~~Cp~~~-C~~~~~~~~~g~CCp~C   57 (57)
T PF00093_consen   26 DGEVQCSRIQCPPLD-CPNPELVKPPGECCPVC   57 (57)
T ss_dssp             TTEEEEEE---S-SS--S-------SS-S--S-
T ss_pred             CCEEEEcCCCCcCCC-CCCCceecCCCCcCCCC
Confidence            699999999999986 99992228999999987


No 4  
>smart00215 VWC_out von Willebrand factor (vWF) type C domain.
Probab=97.85  E-value=1.1e-05  Score=54.15  Aligned_cols=40  Identities=33%  Similarity=0.830  Sum_probs=35.6

Q ss_pred             cccCCEEecCCCeEeCCCCCceEEEecCCceEEEeeecC-CCCC
Q psy11988         36 CVHHGVFRESGSEWTDPDNPCRIFTCKAGVVTETEMQCY-APCK   78 (156)
Q Consensus        36 C~~~g~~y~~Ge~w~~~~d~C~~C~C~~G~v~C~~~~Cp-~~C~   78 (156)
                      |.++|+.|.+|++|.   |.|.+|+|.+|.+.|+++.|+ .+|.
T Consensus         1 C~~~G~~y~~g~~w~---d~Cn~CtC~~G~v~Ct~~~C~~~~c~   41 (67)
T smart00215        1 CYNNGSYYPPGAKWD---DDCNRCTCLNGRVSCTKVWCGPKPCL   41 (67)
T ss_pred             CeECCEEcCCCCccc---cCCCCCEecCCCEEecCCcCCCchhh
Confidence            689999999999997   469999999999999999998 4553


No 5  
>PF12714 TILa:  TILa domain
Probab=97.47  E-value=0.00019  Score=46.28  Aligned_cols=38  Identities=29%  Similarity=0.680  Sum_probs=33.5

Q ss_pred             ccc-cCCEEecCCCeEeCCCCCce-EEEe-cCCceEEEeeecC
Q psy11988         35 GCV-HHGVFRESGSEWTDPDNPCR-IFTC-KAGVVTETEMQCY   74 (156)
Q Consensus        35 ~C~-~~g~~y~~Ge~w~~~~d~C~-~C~C-~~G~v~C~~~~Cp   74 (156)
                      +|+ ++|+.|..||+|..  +.|+ .|+| .+|.|.|....|+
T Consensus         1 GC~d~~G~yy~~Ge~~~~--~~C~~~C~C~~~g~v~C~~~~C~   41 (56)
T PF12714_consen    1 GCTDYNGRYYPPGESWWT--DDCTQRCTCQPNGQVQCQPSSCP   41 (56)
T ss_pred             CCcCcCCEEECCCCEEeC--CCCCEeEEEcCCCeEEEeCCCCC
Confidence            588 99999999999998  4466 7999 6899999999988


No 6  
>smart00214 VWC von Willebrand factor (vWF) type C domain.
Probab=97.25  E-value=0.00029  Score=45.52  Aligned_cols=33  Identities=30%  Similarity=0.795  Sum_probs=27.0

Q ss_pred             CCe-EEeeccCCCCCCCCCcccccccCCCcCCCC
Q psy11988          1 NGF-VECNRKSCPNQEGCHKLLEAKEKDGCCRKC   33 (156)
Q Consensus         1 ~G~-v~C~~~~Cp~~~~C~~~v~~~~~g~CCP~C   33 (156)
                      +|. |+|.++.||++.+|++++..+.+|+|||+|
T Consensus        26 ~g~~v~C~~~~Cp~~~~C~~~~~~~~~g~CCp~C   59 (59)
T smart00214       26 DGETVLCDPVECPPPPDCPNPERVKPPGECCPRC   59 (59)
T ss_pred             CCCEEEeeeecCCCCCCCCCCcccCCCCCcCCCC
Confidence            577 999999999863499876446899999987


No 7  
>PF05375 Pacifastin_I:  Pacifastin inhibitor (LCMII);  InterPro: IPR008037 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively. In many cases they are synthesised as part of a larger precursor protein, either as a prepropeptide or as an N-terminal domain associated with an inactive peptidase or zymogen. This domain prevents access of the substrate to the active site. Removal of the N-terminal inhibitor domain either by interaction with a second peptidase or by autocatalytic cleavage activates the zymogen. Other inhibitors interact direct with proteinases using a simple noncovalent lock and key mechanism; while yet others use a conformational change-based trapping mechanism that depends on their structural and thermodynamic properties.  This family of serine protease inhibitors belong to MEROPS inhibitor family I19, clan IW. They inhibit chymotrpsin, a peptidase belong to the S1 family (IPR001254 from INTERPRO) []. They were first isolated from Locusta migratoria migratoria(migratory locust). These were HI, LMCI-1 (PMP-D2) and LMCI-2 (PMP-C) [, , ]; five additional members SGPI-1 to 5 were identified in Schistocerca gregaria (desert locust) [, ], and a heterodimeric serine protease inhibitor (pacifastin) was isolated from the hemolymph of Pacifastacus leniusculus (Signal crayfish) [].  Pacifastin is a 155kDa composed of two covalently linked subunits, which are separately encoded. The heavy chain of pacifastin (105 kDa) is related to transferrins, containing three transferrin lobes, two of which seem to be active for iron binding []. A number of the members of the transferrin family are also serine peptidases belong to MEROPS peptidase family S60 (IPR001156 from INTERPRO). The light chain of pacifastin (44 kDa) is the proteinase inhibitory subunit, and has nine cysteine-rich inhibitory domains that are homologous to each other. The locust inhibitors share a conserved array of six cysteine residues with the pacifastin light chain. The structure of members of this family reveal that they are comprised of a triple-stranded antiparallel beta-sheet connected by three disulphide bridges []. The biological function(s) of the locust inhibitors is (are) not fully understood. LMCI-1 and LMCI-2 were shown to inhibit the endogenous proteolytic activating cascade of prophenoloxidase []. Expression analysis shows that the genes encoding the SGPI precursors are differentially expressed in a time-, stage- and hormone-dependent manner.; GO: 0030414 peptidase inhibitor activity; PDB: 2VU8_I 1WO9_A 1GL1_K 1PMC_A 2XTT_A 2F91_B 1KJ0_A 1GL0_I 1KGM_A 3TVJ_I.
Probab=91.92  E-value=0.24  Score=29.69  Aligned_cols=28  Identities=29%  Similarity=0.552  Sum_probs=23.2

Q ss_pred             cCCCeEeCCCCCceEEEec-CCceEEEeeecC
Q psy11988         44 ESGSEWTDPDNPCRIFTCK-AGVVTETEMQCY   74 (156)
Q Consensus        44 ~~Ge~w~~~~d~C~~C~C~-~G~v~C~~~~Cp   74 (156)
                      .+|++|..   .|..|+|. +|...|.++.|+
T Consensus         3 ~pG~~~k~---dCN~C~C~~~G~~~CT~~~C~   31 (39)
T PF05375_consen    3 TPGSTFKK---DCNTCTCSSDGKWACTRKACP   31 (39)
T ss_dssp             -TTTEEEE---TTEEEEEBTTSSEEEE-SSSS
T ss_pred             CCCCeeeC---CCCCCCCCCCCcCccCcccCc
Confidence            36888886   39999999 999999999997


No 8  
>cd00061 FN1 Fibronectin type 1 domain, approximately 40 residue long with two conserved disulfide bridges. FN1 is one of three types of internal repeats which combine to form larger domains within fibronectin. Fibronectin, a plasma protein that binds cell surfaces and various compounds including collagen, fibrin, heparin, DNA, and actin, usually exists as a dimer in plasma and as an insoluble multimer in extracellular matrices.  Dimers of nearly identical subunits are linked by a disulfide bond close to their C-terminus. FN1 domains also found in coagulation factor XII, HGF activator, and tissue-type plasminogen activator. In tissue plasminogen activator, FN1 domains may form functional fibrin-binding units with EGF-like domains C-terminal to FN1.
Probab=89.48  E-value=0.8  Score=27.95  Aligned_cols=35  Identities=29%  Similarity=0.591  Sum_probs=26.8

Q ss_pred             cccC--CEEecCCCeEeCCC-CCceEEEecC--CceEEEe
Q psy11988         36 CVHH--GVFRESGSEWTDPD-NPCRIFTCKA--GVVTETE   70 (156)
Q Consensus        36 C~~~--g~~y~~Ge~w~~~~-d~C~~C~C~~--G~v~C~~   70 (156)
                      |.-+  ++.|..||+|.... ..-..|+|..  |.+.|.+
T Consensus         3 C~d~~t~~~Y~ige~W~r~~~~~~~~C~C~G~~G~~~C~~   42 (43)
T cd00061           3 CFDPQTGVFYRVGETWERPSEGHVLQCTCLGNRGEARCDP   42 (43)
T ss_pred             CCcCCcccEEeCCCEEEeecCCeEEEEEEeCCCCceEEee
Confidence            5544  89999999996542 2456899998  9998875


No 9  
>PF05825 PSP94:  Beta-microseminoprotein (PSP-94);  InterPro: IPR008735 This family consists of the mammalian specific protein beta-microseminoprotein. Prostatic secretory protein of 94 amino acids (PSP94), also called beta-microseminoprotein, is a small, nonglycosylated protein, rich in cysteine residues. It was first isolated as a major protein from Homo sapiens seminal plasma []. The exact function of this protein is unknown.; PDB: 2IZ4_A 1XHH_A 3IX0_C 2IZ3_A.
Probab=88.73  E-value=0.53  Score=33.52  Aligned_cols=34  Identities=18%  Similarity=0.453  Sum_probs=29.0

Q ss_pred             ccc-cCCEEecCCCeEeCCCCCceEEEecCCceEEEe
Q psy11988         35 GCV-HHGVFRESGSEWTDPDNPCRIFTCKAGVVTETE   70 (156)
Q Consensus        35 ~C~-~~g~~y~~Ge~w~~~~d~C~~C~C~~G~v~C~~   70 (156)
                      +|. .+|+.|.-|++|..  +.|..|+|....+.|-.
T Consensus        17 ~C~D~dG~~h~l~S~W~T--~~C~~C~C~~~Gi~CC~   51 (94)
T PF05825_consen   17 ECKDWDGKKHPLNSTWKT--DDCEECSCSEDGISCCS   51 (94)
T ss_dssp             CEEETTTEEEETTEEEEE--TTSEEEEEESSEEEEEE
T ss_pred             ccEeCCCcEEeCCCeECC--CCCcEEEecCCceEecc
Confidence            455 78999999999998  67999999987787753


No 10 
>KOG1544|consensus
Probab=86.70  E-value=0.63  Score=40.54  Aligned_cols=47  Identities=26%  Similarity=0.685  Sum_probs=39.4

Q ss_pred             cCCCcCCC----CC----------ccccCCEEecCCCeEeCCCCCceEEEecCCceEEEeeecC
Q psy11988         25 EKDGCCRK----CQ----------GCVHHGVFRESGSEWTDPDNPCRIFTCKAGVVTETEMQCY   74 (156)
Q Consensus        25 ~~g~CCP~----C~----------~C~~~g~~y~~Ge~w~~~~d~C~~C~C~~G~v~C~~~~Cp   74 (156)
                      ....|||.    |.          +|..+|+.|.+|++..   +.|..|+|+++.-.|....|-
T Consensus        87 ~~sDCCPDf~~fCRg~pp~~Qp~~gc~~gg~~y~~G~t~~---~NCn~CTC~n~qWKCdq~~CL  147 (470)
T KOG1544|consen   87 TVSDCCPDFWDFCRGVPPPFQPIQGCMHGGRIYPVGGTYW---DNCNRCTCQNRQWKCDQEPCL  147 (470)
T ss_pred             CCcccCcCHHHHhcCCCCCCCChhhcccCceecccCCeee---ccccceeecCCceecCCceee
Confidence            34668886    63          5999999999999865   469999999999999988875


No 11 
>PF15430 SVWC:  Single domain von Willebrand factor type C
Probab=85.59  E-value=2.1  Score=27.22  Aligned_cols=38  Identities=29%  Similarity=0.496  Sum_probs=29.4

Q ss_pred             cccCCEEecCCCeEeCCCCCceEEEecCCceEEEeeecC
Q psy11988         36 CVHHGVFRESGSEWTDPDNPCRIFTCKAGVVTETEMQCY   74 (156)
Q Consensus        36 C~~~g~~y~~Ge~w~~~~d~C~~C~C~~G~v~C~~~~Cp   74 (156)
                      |.|+|..+.+|+.|... ++|.+=+|..+.-.-....|+
T Consensus         1 C~y~~~~~~~g~~~~~~-~pC~~~~C~~~~~~v~v~~C~   38 (65)
T PF15430_consen    1 CYYNGRTIPSGESYNPE-EPCERWTCDASDGYVTVEGCP   38 (65)
T ss_pred             CEECCEEcCCCcEecCC-CCCceEEEECCCCEEEEEeCC
Confidence            78999999999999864 789999999444333456666


No 12 
>smart00215 VWC_out von Willebrand factor (vWF) type C domain.
Probab=85.34  E-value=0.45  Score=31.79  Aligned_cols=33  Identities=12%  Similarity=-0.022  Sum_probs=22.4

Q ss_pred             CCCCCEEecCCceecCC----------CCCCceeecCchhhHH
Q psy11988         95 KRPYGLLYVAFGLLNAT----------FGPPHVASGLLNVAFA  127 (156)
Q Consensus        95 C~~~g~~y~~G~~~~~~----------~~c~~~~c~~~~~~~~  127 (156)
                      |.++|++|++|+.|..+          ..|..+.|++.++.|-
T Consensus         1 C~~~G~~y~~g~~w~d~Cn~CtC~~G~v~Ct~~~C~~~~c~l~   43 (67)
T smart00215        1 CYNNGSYYPPGAKWDDDCNRCTCLNGRVSCTKVWCGPKPCLLH   43 (67)
T ss_pred             CeECCEEcCCCCccccCCCCCEecCCCEEecCCcCCCchhhcc
Confidence            57889999999999753          2233344666666554


No 13 
>PF14828 Amnionless:  Amnionless
Probab=84.38  E-value=0.45  Score=42.45  Aligned_cols=28  Identities=29%  Similarity=0.895  Sum_probs=23.8

Q ss_pred             Eeecc--CCCCCCCCCcccccccCCCcCCCCCc
Q psy11988          5 ECNRK--SCPNQEGCHKLLEAKEKDGCCRKCQG   35 (156)
Q Consensus         5 ~C~~~--~Cp~~~~C~~~v~~~~~g~CCP~C~~   35 (156)
                      .|...  +|+..+ |..|+  +..|+|||.|-.
T Consensus       205 ICs~v~~~C~~~~-C~~pl--~P~GhCC~iCGa  234 (437)
T PF14828_consen  205 ICSNVLQRCPKPH-CRSPL--RPEGHCCPICGA  234 (437)
T ss_pred             hhHHhhCcCCCCc-cCCCC--CCCCCchhhcce
Confidence            46666  999986 99999  899999999954


No 14 
>smart00058 FN1 Fibronectin type 1 domain. One of three types of internal repeat within the plasma protein, fibronectin. Found also in coagulation factor XII, HGF activator and tissue-type plasminogen activator. In t-PA and fibronectin, this domain type  contributes to fibrin-binding.
Probab=82.16  E-value=3.3  Score=25.49  Aligned_cols=32  Identities=19%  Similarity=0.281  Sum_probs=24.7

Q ss_pred             CEEecCCCeEeCCCC--CceEEEecCCc---eEEEee
Q psy11988         40 GVFRESGSEWTDPDN--PCRIFTCKAGV---VTETEM   71 (156)
Q Consensus        40 g~~y~~Ge~w~~~~d--~C~~C~C~~G~---v~C~~~   71 (156)
                      ++.|..||+|....+  .-..|+|..+.   +.|.+.
T Consensus         7 ~~~Y~ige~W~r~~~~g~~~~C~C~G~g~G~~~C~~~   43 (45)
T smart00058        7 GTTYRIGDTWERPYEGGHVLQCTCLGNGRGEWKCDPV   43 (45)
T ss_pred             ccEEecCCEEEeecCCCcEEEeEEcCCCceEEEEEec
Confidence            789999999966433  46789999655   888864


No 15 
>PF14828 Amnionless:  Amnionless
Probab=81.20  E-value=0.56  Score=41.86  Aligned_cols=36  Identities=25%  Similarity=0.693  Sum_probs=29.5

Q ss_pred             eEEEecCCc---eEEEee--ecC-CCCCCCCCCCCCCCCCCCC
Q psy11988         57 RIFTCKAGV---VTETEM--QCY-APCKHPTPPGPGQCCPTCP   93 (156)
Q Consensus        57 ~~C~C~~G~---v~C~~~--~Cp-~~C~~~~~~~pG~CCp~C~   93 (156)
                      .-|.|.+..   ..|..+  +|+ ..|.+|. .+.|+||++|-
T Consensus       192 ~gC~C~n~~~l~~ICs~v~~~C~~~~C~~pl-~P~GhCC~iCG  233 (437)
T PF14828_consen  192 SGCPCGNDEVLEWICSNVLQRCPKPHCRSPL-RPEGHCCPICG  233 (437)
T ss_pred             ccCccCcccchhhhhHHhhCcCCCCccCCCC-CCCCCchhhcc
Confidence            478887644   567777  899 7999998 89999999994


No 16 
>PF15430 SVWC:  Single domain von Willebrand factor type C
Probab=75.54  E-value=2.9  Score=26.57  Aligned_cols=30  Identities=7%  Similarity=-0.288  Sum_probs=25.9

Q ss_pred             CCCCCEEecCCceecCCCCCCceeecCchh
Q psy11988         95 KRPYGLLYVAFGLLNATFGPPHVASGLLNV  124 (156)
Q Consensus        95 C~~~g~~y~~G~~~~~~~~c~~~~c~~~~~  124 (156)
                      |.++|+.+.+|+.|.....|.+++|...+.
T Consensus         1 C~y~~~~~~~g~~~~~~~pC~~~~C~~~~~   30 (65)
T PF15430_consen    1 CYYNGRTIPSGESYNPEEPCERWTCDASDG   30 (65)
T ss_pred             CEECCEEcCCCcEecCCCCCceEEEECCCC
Confidence            678899999999999999999999984443


No 17 
>PF00039 fn1:  Fibronectin type I domain;  InterPro: IPR000083 Fibronectin type I repeats are one of the three repeats found in the fibronectin protein. Fibronectin is a plasma protein that binds cell surfaces and various compounds including collagen, fibrin, heparin, DNA, and actin. Type I domain (FN1) is approximately 40 residues in length. Four conserved cysteines are involved in disulphide bonds. The 3D structure of the FN1 domain has been determined [, , ]. It consists of two antiparallel beta-sheets, first a double-stranded one, that is linked by a disulphide bond to a triple-stranded beta-sheet. The second conserved disulphide bridge links the C-terminal adjacent strands of the domain.  In human tissue plasminogen activator chain A the FN1 domain together with the following epidermal growth factor (EGF)-like domain are involved in fibrin-binding []. It has been suggested that these two modules form a single structural and functional unit []. The two domains keep their specific tertiary structure, but interact intimately to bury a hydrophobic core; the inter-module linker makes up the third strand of the EGF-module's major beta-sheet.; GO: 0005576 extracellular region; PDB: 2RKY_A 1FBR_A 2RL0_D 3M7P_A 3MQL_A 3ZRZ_A 2RKZ_F 2CKU_A 2CG6_A 3CAL_C ....
Probab=73.61  E-value=3.4  Score=24.59  Aligned_cols=30  Identities=27%  Similarity=0.463  Sum_probs=20.8

Q ss_pred             CCEEecCCCeEeCCC-CCceEEEecC---CceEE
Q psy11988         39 HGVFRESGSEWTDPD-NPCRIFTCKA---GVVTE   68 (156)
Q Consensus        39 ~g~~y~~Ge~w~~~~-d~C~~C~C~~---G~v~C   68 (156)
                      .++.|..||+|.... ..=..|+|..   |.+.|
T Consensus         6 t~~~Y~vge~W~R~~~g~~~~CtC~G~g~G~~~C   39 (39)
T PF00039_consen    6 TGQFYQVGETWERPYQGHMMQCTCLGNGRGEWKC   39 (39)
T ss_dssp             TTEEEETTEEEEEEETSSEEEEEEEETTTTEEEE
T ss_pred             CccEEeCCCEEEeecCCeEEEeEECCCCccceEC
Confidence            489999999996431 2345799964   65655


No 18 
>PF12714 TILa:  TILa domain
Probab=59.06  E-value=14  Score=23.42  Aligned_cols=25  Identities=12%  Similarity=-0.099  Sum_probs=19.0

Q ss_pred             CCC-CCCEEecCCceecCCCCCCc-eee
Q psy11988         94 GKR-PYGLLYVAFGLLNATFGPPH-VAS  119 (156)
Q Consensus        94 ~C~-~~g~~y~~G~~~~~~~~c~~-~~c  119 (156)
                      +|. ++|+.|+.|++|-.+. |.+ .+|
T Consensus         1 GC~d~~G~yy~~Ge~~~~~~-C~~~C~C   27 (56)
T PF12714_consen    1 GCTDYNGRYYPPGESWWTDD-CTQRCTC   27 (56)
T ss_pred             CCcCcCCEEECCCCEEeCCC-CCEeEEE
Confidence            577 8899999999998865 332 555


No 19 
>PF09443 CFC:  Cripto_Frl-1_Cryptic (CFC);  InterPro: IPR019011 This entry represents the CFC domain found in the membrane protein Cripto (or teratocarcinoma-derived growth factor), a protein over expressed in many tumours [, ] and structurally similar to the C-terminal extracellular portions of Jagged 1 and Jagged 2 []. CFC is approx 40-residues long, compacted by three internal disulphide bridges, and binds Alk4 via a hydrophobic patch. CFC is structurally homologous to the VWFC-like domain [].  The protein Cripto is the founding member of the extra-cellular EGF-CFC growth factors, which are composed of two adjacent cysteine-rich domains: the EGF-like (IPR006210 from INTERPRO) and the CFC domains. Members of the EGF-CFC family play key roles in embryonic development and are also implicated in tumourigenesis []. The Cripto protein could play a role in the determination of the epiblastic cells that subsequently give rise to the mesoderm. Although both the EGF and CFC domains are involved in the tumourigenic activity of Crispto proteins, the CFC domain appears to play a crucial role, as it is through the CFC domain that Crispto interferes with the onco-suppressive activity of Activins, either by blocking the Activin receptor ALK4 or by antagonising proteins of the TGF-beta family [].  The Cryptic protein is involved in the correct establishment of the left-right axis. May play a role in mesoderm and/or neural patterning during gastrulation.; PDB: 2J5H_A.
Probab=39.07  E-value=11  Score=22.25  Aligned_cols=24  Identities=25%  Similarity=0.552  Sum_probs=7.1

Q ss_pred             CeEeCCCCCceEEEecCCceEEEeee
Q psy11988         47 SEWTDPDNPCRIFTCKAGVVTETEMQ   72 (156)
Q Consensus        47 e~w~~~~d~C~~C~C~~G~v~C~~~~   72 (156)
                      ..|..  ..|..|+|..|+..|.+.+
T Consensus         7 g~W~~--~~C~lCrC~~G~LhC~p~~   30 (36)
T PF09443_consen    7 GEWVP--KGCSLCRCWYGTLHCFPQQ   30 (36)
T ss_dssp             TT-SS-----------SSS--S--SS
T ss_pred             CCeee--cCceeeEeecCcEEEcCcc
Confidence            35777  6799999999999998643


No 20 
>PF10791 F1F0-ATPsyn_F:  Mitochondrial F1-F0 ATP synthase subunit F of fungi;  InterPro: IPR019727 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   F-ATPases (also known as F1F0-ATPase, or H(+)-transporting two-sector ATPase) (3.6.3.14 from EC) are composed of two linked complexes: the F1 ATPase complex is the catalytic core and is composed of 5 subunits (alpha, beta, gamma, delta, epsilon), while the F0 ATPase complex is the membrane-embedded proton channel that is composed of at least 3 subunits (A-C), nine in mitochondria (A-G, F6, F8). Both the F1 and F0 complexes are rotary motors that are coupled back-to-back. In the F1 complex, the central gamma subunit forms the rotor inside the cylinder made of the alpha(3)beta(3) subunits, while in the F0 complex, the ring-shaped C subunits forms the rotor. The two rotors rotate in opposite directions, but the F0 rotor is usually stronger, using the force from the proton gradient to push the F1 rotor in reverse in order to drive ATP synthesis []. These ATPases can also work in reverse to hydrolyse ATP to create a proton gradient. This entry represents subunit F found in the F0 complex of F-ATPases from fungal mitochondria. The membrane bound F1-FO-type H+ ATP synthase of mitochondria catalyses the terminal step in oxidative respiration converting the generation of the electrochemical gradient into ATP for cellular biosynthesis. The general structure and the core subunits of the enzyme are highly conserved in both prokaryotic and eukaryotic organisms. 
Probab=37.46  E-value=19  Score=25.72  Aligned_cols=23  Identities=22%  Similarity=0.655  Sum_probs=18.7

Q ss_pred             HHHHHHHhHhhhhhhhheeeeee
Q psy11988        127 ALLHVAFGFLVLSFGFQAFLTLK  149 (156)
Q Consensus       127 ~~~~~~~~~~~~~~~~~~~~~~~  149 (156)
                      -++|+++|++++.++.+-+..||
T Consensus        73 PllHli~~l~~iGYs~eYyfHLr   95 (95)
T PF10791_consen   73 PLLHLIGGLFLIGYSIEYYFHLR   95 (95)
T ss_pred             cHHHHHHHHHHHHHHHHhHhhcC
Confidence            48999999999999887665553


No 21 
>PF09064 Tme5_EGF_like:  Thrombomodulin like fifth domain, EGF-like;  InterPro: IPR015149 This domain adopts a fold similar to other EGF domains, with a flat major and a twisted minor beta sheet. Disulphide pairing, however, is not of the usual 1-3, 2-4, 5-6 type; rather 1-2, 3-4, 5-6 pairing is found. Its extended major sheet (strands beta-2 and beta-3 and the connecting loop) projects into thrombin's active site groove. This domain is required for interaction of thrombomodulin with thrombin, and subsequent activation of protein-C []. ; GO: 0004888 transmembrane signaling receptor activity, 0016021 integral to membrane
Probab=26.26  E-value=48  Score=19.28  Aligned_cols=13  Identities=38%  Similarity=1.112  Sum_probs=9.2

Q ss_pred             EeeccCCCCCCCCCc
Q psy11988          5 ECNRKSCPNQEGCHK   19 (156)
Q Consensus         5 ~C~~~~Cp~~~~C~~   19 (156)
                      +|+.++||.  .|..
T Consensus         2 fCn~t~CpA--~CDp   14 (34)
T PF09064_consen    2 FCNQTECPA--DCDP   14 (34)
T ss_pred             ccccccCCC--ccCC
Confidence            578888887  4754


Done!