Diaphorina citri psyllid: psy11993

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630

MLDFFTIFSKGGIVLWYFQSASQIFTPSLNALIKSVILQERGGNQVFEHNGLVLKHKLDNEFDLVFVVGFQKILQLSYVDKLLDDVHLEFRDKYKNELGSDMHLYDYDFESTYNVLLKEAEEWSKVQACIPKQMRTFEESSKSKKTIASMIIDKNKKEEKSVPSKKKGKAVETKVEPVTPPSPVQNGDAGIEEDIIMINRQKLAMKMGSPKNKTKPKTPKANAKEGKKPRIWELSGDQRDLSTLEYTKDKPSDSNALNITPDTHLVGKMVGGIKDLEVESSSEEESSDDEEDVRAETSHVSAKKANGKANKGMFSLFRGLVGSKNLTKSDMKPILEKMKDHLIAKNVAADIAVKLCDSVALKLEGKVLGTFESVANTVKSTLTDALVQILSPKRRVDILRDALEAKKQGRPFVMAFCGVNGVGKSTNLAKICFWLIENNLNVLIAACDTFRAGAVEQLRTHVRHLCSLHPAAKHGGREMVQLFEKGYGKDPAEIAFRAISHARDMHIDVVLIDTAGRMQDNEPLMRALAKLVKVNQPDLLLFVGEALVGNEAVDQLVKFNNAMADHSLSDNPHLIDGIVLTKFDTIDDKVGAAISMTYITGQPIVFVGTGQTYTDLKSLNAKAVVNALMK

cccEEEEEEcccEEEEEEccccccccHHHHHHHHHHHHHcccccccCECccEEEEEEEEccccEEEEEEEEcccHHHcHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHccccccccHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcHHHHHHHccccccccHHHHHHHHccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccEEEEEEECccccHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHHccccccccccccccEEEEEccccccHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHHHHHHHccccccccccccEEEEEccccccccccEEEHHHHHccccEEEEEccccccccccccHHHHHHHHHc

MLDFFTIFSKGGIVLWYFQSASQIFTPSLNALIKSVILQERGGNQVFEHNGLVLKHKLDNEFDLVFVVGFQKILQLSYVDKLLDDVHLEFRDKYKNELGSDMHLYDYDFESTYNVLLKEAEEWSKVQ******************************************************************************************************************************************************************************************FSLFRGLVGSKNLTKSDMKPILEKMKDHLIAKNVAADIAVKLCDSVALKLEGKVLGTFESVANTVKSTLTDALVQILSPKRRVDILRDALEAKKQGRPFVMAFCGVNGVGKSTNLAKICFWLIENNLNVLIAACDTFRAGAVEQLRTHVRHLCSLHPAAKHGGREMVQLFEKGYGKDPAEIAFRAISHARDMHIDVVLIDTAGRMQDNEPLMRALAKLVKVNQPDLLLFVGEALVGNEAVDQLVKFNNAMADHSLSDNPHLIDGIVLTKFDTIDDKVGAAISMTYITGQPIVFVGTGQTYTDLKSLNAKAVVNALMK

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Signal recognition particle receptor subunit alpha	Component of the SRP (signal recognition particle) receptor. Ensures, in conjunction with the signal recognition particle, the correct targeting of the nascent secretory proteins to the endoplasmic reticulum membrane system.	very confident	Q3MHE8
Signal recognition particle receptor subunit alpha homolog	Component of the SRP (signal recognition particle) receptor. Ensures, in conjunction with the signal recognition particle, the correct targeting of the nascent secretory proteins to the endoplasmic reticulum membrane system (By similarity). May have a role in axonogenesis.	very confident	Q9U5L1
Signal recognition particle receptor subunit alpha	Component of the SRP (signal recognition particle) receptor. Ensures, in conjunction with the signal recognition particle, the correct targeting of the nascent secretory proteins to the endoplasmic reticulum membrane system.	very confident	P08240

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005811 [CC]	lipid particle	confident	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005789 [CC]	endoplasmic reticulum membrane	confident	GO:0005737, GO:0005575, GO:0005783, GO:0044432, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0042175, GO:0044444, GO:0012505, GO:0044424, GO:0044425, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0003924 [MF]	GTPase activity	probable	GO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0007409 [BP]	axonogenesis	probable	GO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0048812, GO:0008150
GO:0006412 [BP]	translation	probable	GO:0071704, GO:0044267, GO:0008152, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0008150, GO:0034645, GO:1901576
GO:0016021 [CC]	integral to membrane	probable	GO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0005047 [MF]	signal recognition particle binding	probable	GO:0043021, GO:0003674, GO:0005488
GO:0005785 [CC]	signal recognition particle receptor complex	probable	GO:0005783, GO:0044464, GO:0005789, GO:0042175, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0044432, GO:0005791, GO:0012505, GO:0043234, GO:0032991, GO:0043231, GO:0030867, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425, GO:0044422
GO:0005525 [MF]	GTP binding	probable	GO:0043168, GO:0003674, GO:0005488, GO:0019001, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032561, GO:0032553, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0006184 [BP]	GTP catabolic process	probable	GO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0009203, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0071704, GO:0042278, GO:1901069, GO:1901068, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0046039, GO:0044238, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0006987 [BP]	activation of signaling protein activity involved in unfolded protein response	probable	GO:0032069, GO:0048522, GO:0019220, GO:0080090, GO:0019222, GO:0033674, GO:0051246, GO:0031325, GO:0031323, GO:0023052, GO:0007165, GO:0070887, GO:0042221, GO:0050789, GO:0043085, GO:0009893, GO:0006984, GO:0051716, GO:0006986, GO:0051347, GO:0010604, GO:0051345, GO:0010562, GO:0043549, GO:0034976, GO:0051247, GO:0019219, GO:0071310, GO:0032270, GO:0044699, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0042325, GO:0050790, GO:0045937, GO:0060255, GO:0045859, GO:0032075, GO:0051174, GO:0006950, GO:0032268, GO:0044763, GO:0051171, GO:0007154, GO:0050794, GO:0010033, GO:0051336, GO:0044700, GO:0042327, GO:0045860, GO:0030968, GO:0050896, GO:0031401, GO:0051338, GO:0035967, GO:0035966, GO:0033554, GO:0008150, GO:0009987, GO:0001932, GO:0001934, GO:0034620
GO:0006614 [BP]	SRP-dependent cotranslational protein targeting to membrane	probable	GO:0008104, GO:0006613, GO:0006612, GO:0044699, GO:0070972, GO:0070727, GO:0006886, GO:0071702, GO:0016482, GO:0006810, GO:0072599, GO:0072594, GO:0034613, GO:0006605, GO:0045184, GO:0015031, GO:0044765, GO:0008150, GO:0051649, GO:0051234, GO:0051179, GO:0051641, GO:0033036, GO:0046907, GO:0045047, GO:0033365, GO:0044763, GO:0009987
GO:0050708 [BP]	regulation of protein secretion	probable	GO:0070201, GO:0051223, GO:0051046, GO:0060341, GO:0051049, GO:0050794, GO:0065007, GO:0008150, GO:0032879, GO:0050789, GO:0032880
GO:0040010 [BP]	positive regulation of growth rate	probable	GO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0002119 [BP]	nematode larval development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0003729 [MF]	mRNA binding	probable	GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0018996 [BP]	molting cycle, collagen and cuticulin-based cuticle	probable	GO:0008150, GO:0032501, GO:0042303, GO:0044699, GO:0044707
GO:0048477 [BP]	oogenesis	probable	GO:0044702, GO:0048609, GO:0032504, GO:0019953, GO:0007292, GO:0022414, GO:0032501, GO:0008150, GO:0044699, GO:0007276, GO:0000003
GO:0009792 [BP]	embryo development ending in birth or egg hatching	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0040007 [BP]	growth	probable	GO:0008150

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2FH5, chain A
Confidence level:very confident
Coverage over the Query: 1-125
View the alignment between query and template
View the model in PyMOL

Template: 3KL4, chain A
Confidence level:very confident
Coverage over the Query: 310-467,481-563,574-630
View the alignment between query and template
View the model in PyMOL

Template: 2IXE, chain A
Confidence level:confident
Coverage over the Query: 397-582
View the alignment between query and template
View the model in PyMOL