Diaphorina citri psyllid: psy11998

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-----
MGFKIREILKFYYWVAHLSNVHLFFSPAGERRPGEWCKLAYWELSHRVGRLYPVVTPYIHVFWAQPCGDGLCLETLATGNNSAPSGNGPHHVPDAVRRTRTKIGLVVESRRLNPSFGAVCPYTKASGCGYVPGRDRQGLTLSLEADGVWAYNRSEAPVFVNSPGLDDPGPPTLLVYRIPPGHCLNIFDPALPPRLRESFPAPPTGPVDPNSIRISFAKGWGPKYSRQEITACPAWLEVLLVPAAC
cccEEEEEEEccEEEEcccccccccccccccccccEEEEEEEEEccccccEEEECccEEEEEEcccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccEEEEECccCEEEEccccccEEEccccccccccccccEEEcccccEEccccccccccccccccccccccccccEEEEEcCCccccccccccccccccEEEEEEccccc
**FKIREILKFYYWVAHLSNVHLFFSPAGERRPGEWCKLAYWELSHRVGRLYPVVTPYIHVFWAQPCGDGLCLETLAT********************TRTKIGLVVESRRLNPSFGAVCPYTKASGCGYVPGRDRQGLTLSLEADGVWAYNRSEAPVFVNSPGLDDPGPPTLLVYRIPPGHCLNIFDPAL**********PPTGPVDPNSIRISFAKGWGPKYSRQEITACPAWLEVLLVPAAC
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGFKIREILKFYYWVAHLSNVHLFFSPAGERRPGEWCKLAYWELSHRVGRLYPVVTPYIHVFWAQPCGDGLCLETLATGNNSAPSGNGPHHVPDAVRRTRTKIGLVVESRRLNPSFGAVCPYTKASGCGYVPGRDRQGLTLSLEADGVWAYNRSEAPVFVNSPGLDDPGPPTLLVYRIPPGHCLNIFDPALPPRLRESFPAPPTGPVDPNSIRISFAKGWGPKYSRQEITACPAWLEVLLVPAAC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044212 [MF]transcription regulatory region DNA bindingprobableGO:0097159, GO:0000975, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0014070 [BP]response to organic cyclic compoundprobableGO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0043066 [BP]negative regulation of apoptotic processprobableGO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0007178 [BP]transmembrane receptor protein serine/threonine kinase signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007167, GO:0007154, GO:0050789, GO:0044699
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0051239 [BP]regulation of multicellular organismal processprobableGO:0008150, GO:0065007, GO:0050789
GO:0003700 [MF]sequence-specific DNA binding transcription factor activityprobableGO:0003674, GO:0001071
GO:0005072 [MF]transforming growth factor beta receptor, cytoplasmic mediator activityprobableGO:0005057, GO:0003674, GO:0004871, GO:0060089
GO:0048518 [BP]positive regulation of biological processprobableGO:0008150, GO:0065007, GO:0050789
GO:0006355 [BP]regulation of transcription, DNA-dependentprobableGO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0034713 [MF]type I transforming growth factor beta receptor bindingprobableGO:0005126, GO:0005160, GO:0003674, GO:0005488, GO:0005515, GO:0005102
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0010991 [BP]negative regulation of SMAD protein complex assemblyprobableGO:0048585, GO:0048583, GO:0051129, GO:0051128, GO:0023057, GO:0010648, GO:0023051, GO:0010646, GO:0050789, GO:0044699, GO:0009968, GO:0090101, GO:0009966, GO:0065007, GO:0048519, GO:0010990, GO:0090092, GO:0009987, GO:0031333, GO:0050794, GO:0044763, GO:0043254, GO:0044087, GO:0008150, GO:0048523
GO:0030514 [BP]negative regulation of BMP signaling pathwayprobableGO:0090092, GO:0009968, GO:0090101, GO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523, GO:0030510
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0070698 [MF]type I activin receptor bindingprobableGO:0033612, GO:0003674, GO:0005488, GO:0005515, GO:0005102, GO:0070696, GO:0070697
GO:0051336 [BP]regulation of hydrolase activityprobableGO:0019222, GO:0050790, GO:0008150, GO:0065007, GO:0065009, GO:0050789
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0009790 [BP]embryo developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1DD1, chain A
Confidence level:very confident
Coverage over the Query: 17-79,91-105,138-243
View the alignment between query and template
View the model in PyMOL