RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy12002
         (164 letters)



>gnl|CDD|132854 cd07215, Pat17_PNPLA8_PNPLA9_like2, Patatin-like phospholipase of
           bacteria.  Patatin is a storage protein of the potato
           tuber that shows Phospholipase A2 activity (PLA2; EC
           3.1.1.4). Patatin catalyzes the nonspecific hydrolysis
           of phospholipids, glycolipids, sulfolipids, and mono-
           and diacylglycerols, thereby showing lipid acyl
           hydrolase activity. The active site includes an oxyanion
           hole with a conserved GGxR motif; it is found in almost
           all the members of this family. The catalytic dyad is
           formed by a serine and an aspartate. Patatin belongs to
           the alpha-beta hydrolase family which is identified by a
           characteristic nucleophile elbow with a consensus
           sequence of Sm-X-Nu-Sm (Sm = small residue, X = any
           residue and Nu = nucleophile). Members of this family
           have been found also in vertebrates. This family
           includes subfamily of PNPLA8 (iPLA2-gamma) and PNPLA9
           (iPLA2-beta) like phospholipases from human as well as
           the Pat17 isozyme from Solanum cardiophyllum.
          Length = 329

 Score = 30.8 bits (70), Expect = 0.23
 Identities = 19/70 (27%), Positives = 28/70 (40%), Gaps = 18/70 (25%)

Query: 25  GALQVLPPLIDVIPESRLNLVIYHLKQAWDL------YLTMDT------------SPESL 66
           G L    PLID++ +     V Y LKQ +D       YL +              SPE+L
Sbjct: 245 GLLGWAKPLIDIMMDGASQTVDYQLKQIFDAEGDQQQYLRIQPELEDADPEMDDASPENL 304

Query: 67  QILQLIANES 76
           + L+ +    
Sbjct: 305 EKLREVGQAL 314


>gnl|CDD|220356 pfam09709, Cas_Csd1, CRISPR-associated protein (Cas_Csd1).  CRISPR
           loci appear to be mobile elements with a wide host
           range. This entry represents proteins that tend to be
           found near CRISPR repeats. The species range, so far, is
           exclusively bacterial and mesophilic, although CRISPR
           loci are particularly common among the archaea and
           thermophilic bacteria. Clusters of short DNA repeats
           with nonhomologous spacers, which are found at regular
           intervals in the genomes of phylogenetically distinct
           prokaryotic species, comprise a family with recognisable
           features. This family is known as CRISPR (short for
           Clustered, Regularly Interspaced Short Palindromic
           Repeats). A number of protein families appear only in
           association with these repeats and are designated Cas
           (CRISPR-Associated) proteins.
          Length = 572

 Score = 27.2 bits (61), Expect = 4.9
 Identities = 14/50 (28%), Positives = 20/50 (40%), Gaps = 2/50 (4%)

Query: 48  HLKQAWDLYLTMDTSPESLQILQLIANESYRRA-KFWFAFKAFDMLERLE 96
            LK+    Y    +      +L L  N   R + +FW      + LERLE
Sbjct: 303 LLKKPITGYRADLSDDTRFYVLGLAPNAG-RLSVRFWRELTVGEFLERLE 351


>gnl|CDD|131677 TIGR02629, L_rham_iso_rhiz, L-rhamnose catabolism isomerase,
           Pseudomonas stutzeri subtype.  Members of this family
           are isomerases in the pathway of L-rhamnose catabolism
           as found in Pseudomonas stutzeri and in a number of the
           Rhizobiales. This family differs from the L-rhamnose
           isomerases of Escherichia coli (see TIGR01748). This
           enzyme catalyzes the isomerization step in rhamnose
           catabolism. Genetic evidence in Rhizobium leguminosarum
           bv. trifolii suggests phosphorylation occurs first, then
           isomerization of the the phosphorylated sugar, but
           characterization of the recombinant enzyme from
           Pseudomonas  stutzeri does show L-rhamnose isomerase
           activity. The name given is deliberately vague because
           the relative order of phosphorylation and isomerization
           is unclear [Energy metabolism, Sugars].
          Length = 412

 Score = 26.5 bits (58), Expect = 7.9
 Identities = 10/37 (27%), Positives = 15/37 (40%)

Query: 109 CAGLMQMIMAGKENRLNVPWAKCALGQYKEAEEMFLL 145
           CA + Q+  A     L++PW K    + K       L
Sbjct: 76  CAVIQQLTRATPNVSLHIPWDKADPKELKARGSALGL 112


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.323    0.138    0.428 

Gapped
Lambda     K      H
   0.267   0.0700    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 8,450,701
Number of extensions: 767473
Number of successful extensions: 583
Number of sequences better than 10.0: 1
Number of HSP's gapped: 582
Number of HSP's successfully gapped: 16
Length of query: 164
Length of database: 10,937,602
Length adjustment: 90
Effective length of query: 74
Effective length of database: 6,945,742
Effective search space: 513984908
Effective search space used: 513984908
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 55 (25.0 bits)