Query         psy12003
Match_columns 61
No_of_seqs    126 out of 1034
Neff          7.5 
Searched_HMMs 46136
Date          Fri Aug 16 16:13:11 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12003.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12003hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0489|consensus               99.7 1.9E-17 4.1E-22  106.2   1.4   35    4-38    190-224 (261)
  2 KOG0487|consensus               99.6 7.9E-17 1.7E-21  105.5   1.2   32    4-35    266-297 (308)
  3 KOG0848|consensus               99.6 1.8E-16   4E-21  102.4   1.4   32    4-35    230-261 (317)
  4 KOG0850|consensus               99.6   5E-16 1.1E-20   98.4   2.6   36    2-37    151-186 (245)
  5 KOG0488|consensus               99.6 4.7E-16   1E-20  102.0   2.2   31    4-34    203-233 (309)
  6 KOG0844|consensus               99.6 8.3E-17 1.8E-21  105.8  -1.7   34    4-37    212-245 (408)
  7 KOG0842|consensus               99.6 1.1E-15 2.3E-20  100.2   2.6   40    2-41    182-221 (307)
  8 KOG0485|consensus               99.5 2.7E-15 5.7E-20   95.0   0.3   32    2-33    133-164 (268)
  9 KOG0484|consensus               99.5 2.4E-15 5.2E-20   86.1  -0.3   32    4-35     48-79  (125)
 10 KOG0843|consensus               99.5 9.7E-15 2.1E-19   90.0   0.8   33    2-34    131-163 (197)
 11 KOG0492|consensus               99.5 1.3E-14 2.8E-19   91.3   1.3   33    2-34    173-205 (246)
 12 KOG0491|consensus               99.4   2E-14 4.4E-19   87.8   1.1   35    2-36    129-163 (194)
 13 KOG0483|consensus               99.4 2.7E-14 5.8E-19   89.1  -0.9   32    2-33     79-110 (198)
 14 KOG2251|consensus               99.4 1.8E-13 3.9E-18   86.3   2.7   32    4-35     68-99  (228)
 15 KOG0494|consensus               99.3 1.9E-13 4.1E-18   88.5   0.6   32    6-37    174-205 (332)
 16 KOG0847|consensus               99.3 7.9E-13 1.7E-17   84.1   0.4   32    2-33    196-227 (288)
 17 KOG4577|consensus               99.2 7.4E-12 1.6E-16   82.2   1.2   34    4-37    198-231 (383)
 18 PF00046 Homeobox:  Homeobox do  99.2 1.2E-12 2.7E-17   66.5  -2.3   29    2-30     29-57  (57)
 19 KOG0493|consensus               99.1 1.8E-11 3.8E-16   79.5  -0.3   30    4-33    277-306 (342)
 20 KOG0486|consensus               99.1 7.4E-11 1.6E-15   77.8   2.3   33    4-36    143-175 (351)
 21 KOG3802|consensus               99.0 1.6E-10 3.4E-15   77.9   1.9   32    2-33    323-354 (398)
 22 cd00086 homeodomain Homeodomai  99.0   2E-11 4.3E-16   61.8  -2.0   30    2-31     29-58  (59)
 23 COG5576 Homeodomain-containing  99.0 1.4E-10   3E-15   70.2   0.7   32    3-34     81-112 (156)
 24 KOG0490|consensus               98.9 5.4E-10 1.2E-14   69.1   2.8   30    4-33     91-120 (235)
 25 smart00389 HOX Homeodomain. DN  98.9 5.3E-11 1.1E-15   59.9  -2.6   28    2-29     29-56  (56)
 26 TIGR01565 homeo_ZF_HD homeobox  98.8 7.3E-10 1.6E-14   57.5   0.1   24    2-25     34-57  (58)
 27 KOG0849|consensus               98.5 6.7E-08 1.5E-12   64.6   1.5   30    4-33    207-236 (354)
 28 KOG0775|consensus               98.2 6.7E-07 1.5E-11   58.5   2.2   31    3-33    206-236 (304)
 29 KOG1168|consensus               98.2 7.8E-07 1.7E-11   58.9   1.6   34    2-35    338-371 (385)
 30 PF05920 Homeobox_KN:  Homeobox  97.8 8.9E-07 1.9E-11   42.7  -2.9   26    2-27     15-40  (40)
 31 KOG0490|consensus               97.4 5.1E-05 1.1E-09   46.8   0.8   30    4-33    184-213 (235)
 32 KOG0774|consensus               96.5  0.0024 5.3E-08   42.1   2.5   30    3-32    221-250 (334)
 33 KOG1146|consensus               95.9  0.0059 1.3E-07   47.0   2.2   34    2-35    932-965 (1406)
 34 PF10668 Phage_terminase:  Phag  94.5  0.0048   1E-07   32.1  -1.2   28    1-30     23-50  (60)
 35 KOG3623|consensus               94.1   0.012 2.6E-07   43.5  -0.3   33    2-34    585-617 (1007)
 36 PF11569 Homez:  Homeodomain le  93.9  0.0049 1.1E-07   31.7  -2.0   24    2-25     27-50  (56)
 37 KOG0773|consensus               92.1   0.051 1.1E-06   35.9   0.3   28    5-32    274-301 (342)
 38 cd04761 HTH_MerR-SF Helix-Turn  89.9   0.035 7.5E-07   26.4  -1.6   24    1-24      1-24  (49)
 39 PF13411 MerR_1:  MerR HTH fami  87.5   0.058 1.3E-06   27.5  -1.8   21    1-21      1-21  (69)
 40 COG5484 Uncharacterized conser  86.3     0.1 2.2E-06   34.3  -1.5   27    1-29     20-46  (279)
 41 PF06056 Terminase_5:  Putative  85.9    0.11 2.3E-06   26.6  -1.3   28    2-31     15-42  (58)
 42 cd04762 HTH_MerR-trunc Helix-T  85.6   0.094   2E-06   24.4  -1.5   26    1-26      1-26  (49)
 43 KOG2252|consensus               83.1    0.18   4E-06   36.0  -1.5   25    4-28    451-475 (558)
 44 TIGR03879 near_KaiC_dom probab  82.0    0.19 4.1E-06   27.0  -1.4   23    1-23     33-55  (73)
 45 PF08281 Sigma70_r4_2:  Sigma-7  81.9    0.13 2.7E-06   25.1  -2.0   22    2-23     28-49  (54)
 46 cd04763 HTH_MlrA-like Helix-Tu  80.9    0.19 4.1E-06   25.7  -1.6   22    1-22      1-22  (68)
 47 cd04764 HTH_MlrA-like_sg1 Heli  80.4    0.24 5.1E-06   25.2  -1.3   22    1-22      1-22  (67)
 48 cd06171 Sigma70_r4 Sigma70, re  79.0    0.14 3.1E-06   23.8  -2.3   22    2-23     28-49  (55)
 49 PF13518 HTH_28:  Helix-turn-he  78.7    0.25 5.3E-06   23.6  -1.5   20    3-22     15-34  (52)
 50 TIGR01764 excise DNA binding d  77.8    0.29 6.4E-06   22.7  -1.4   25    1-25      2-26  (49)
 51 PRK10072 putative transcriptio  77.5    0.41 8.8E-06   26.9  -1.0   25    3-27     49-73  (96)
 52 PRK06759 RNA polymerase factor  76.5    0.39 8.4E-06   27.6  -1.4   26    1-26    123-148 (154)
 53 PRK09646 RNA polymerase sigma   76.1    0.59 1.3E-05   28.2  -0.7   29    2-30    160-188 (194)
 54 cd04780 HTH_MerR-like_sg5 Heli  76.0    0.39 8.6E-06   26.6  -1.4   21    1-21      1-21  (95)
 55 PF08280 HTH_Mga:  M protein tr  75.8    0.43 9.4E-06   24.1  -1.1   17    2-18     21-37  (59)
 56 TIGR02985 Sig70_bacteroi1 RNA   75.5     0.5 1.1E-05   26.9  -1.1   26    2-27    131-156 (161)
 57 PF13443 HTH_26:  Cro/C1-type H  75.3    0.23   5E-06   24.8  -2.3   27    2-28     12-38  (63)
 58 PF04218 CENP-B_N:  CENP-B N-te  74.8    0.26 5.7E-06   24.6  -2.1   23    3-25     25-47  (53)
 59 PRK12526 RNA polymerase sigma   74.6    0.59 1.3E-05   28.6  -1.0   30    2-31    171-200 (206)
 60 TIGR02939 RpoE_Sigma70 RNA pol  74.4    0.55 1.2E-05   27.8  -1.1   29    2-30    156-184 (190)
 61 TIGR02947 SigH_actino RNA poly  74.2    0.67 1.4E-05   27.8  -0.8   32    1-32    148-179 (193)
 62 TIGR02937 sigma70-ECF RNA poly  74.0    0.59 1.3E-05   25.9  -1.0   26    2-27    128-153 (158)
 63 PRK12519 RNA polymerase sigma   73.9    0.68 1.5E-05   27.7  -0.8   29    2-30    159-187 (194)
 64 PRK09644 RNA polymerase sigma   73.8    0.58 1.3E-05   27.4  -1.1   30    2-31    126-155 (165)
 65 PRK12514 RNA polymerase sigma   73.5    0.76 1.6E-05   27.2  -0.7   29    2-30    147-175 (179)
 66 PRK09642 RNA polymerase sigma   73.2    0.66 1.4E-05   26.9  -1.0   29    2-30    124-152 (160)
 67 smart00422 HTH_MERR helix_turn  73.1    0.49 1.1E-05   23.9  -1.4   21    1-21      1-21  (70)
 68 PF04545 Sigma70_r4:  Sigma-70,  71.9    0.34 7.4E-06   23.3  -2.1   19    2-20     22-40  (50)
 69 PRK09652 RNA polymerase sigma   71.1    0.74 1.6E-05   26.8  -1.1   28    2-29    146-173 (182)
 70 PRK12530 RNA polymerase sigma   71.0    0.79 1.7E-05   27.6  -1.0   30    1-30    151-180 (189)
 71 PRK12547 RNA polymerase sigma   70.7    0.84 1.8E-05   26.8  -0.9   29    1-29    129-157 (164)
 72 PRK09639 RNA polymerase sigma   70.3    0.82 1.8E-05   26.5  -1.0   31    1-31    128-158 (166)
 73 cd04774 HTH_YfmP Helix-Turn-He  69.7    0.69 1.5E-05   25.6  -1.4   22    1-22      1-22  (96)
 74 TIGR02999 Sig-70_X6 RNA polyme  69.6    0.89 1.9E-05   26.9  -1.0   28    2-29    152-179 (183)
 75 PRK12518 RNA polymerase sigma   69.3     1.2 2.5E-05   26.2  -0.5   31    2-32    138-168 (175)
 76 TIGR02983 SigE-fam_strep RNA p  68.7       1 2.2E-05   26.1  -0.9   30    1-30    127-156 (162)
 77 PF08765 Mor:  Mor transcriptio  68.6    0.63 1.4E-05   26.2  -1.7   18    1-18     73-90  (108)
 78 PRK12515 RNA polymerase sigma   68.6     1.2 2.6E-05   26.7  -0.6   33    1-33    148-180 (189)
 79 PF13384 HTH_23:  Homeodomain-l  68.6    0.38 8.3E-06   23.0  -2.3   20    3-22     20-39  (50)
 80 PF13404 HTH_AsnC-type:  AsnC-t  68.3    0.57 1.2E-05   22.3  -1.6   16    3-18     20-35  (42)
 81 PHA03273 envelope glycoprotein  68.2     2.5 5.5E-05   30.0   0.9   20    8-28    114-133 (486)
 82 PRK11924 RNA polymerase sigma   68.1     1.3 2.8E-05   25.7  -0.5   29    2-30    143-171 (179)
 83 PRK00118 putative DNA-binding   67.9       1 2.2E-05   25.6  -0.9   31    1-31     34-64  (104)
 84 TIGR02989 Sig-70_gvs1 RNA poly  67.1    0.92   2E-05   26.1  -1.3   21    2-22    129-149 (159)
 85 cd04788 HTH_NolA-AlbR Helix-Tu  66.8    0.86 1.9E-05   25.1  -1.4   22    1-22      1-22  (96)
 86 PRK09047 RNA polymerase factor  66.7     1.1 2.3E-05   25.8  -1.0   28    2-29    124-151 (161)
 87 TIGR02948 SigW_bacill RNA poly  66.7     1.2 2.5E-05   26.3  -0.9   29    2-30    154-182 (187)
 88 cd01104 HTH_MlrA-CarA Helix-Tu  66.6    0.82 1.8E-05   23.0  -1.4   21    2-22      2-22  (68)
 89 cd01392 HTH_LacI Helix-turn-he  66.5    0.74 1.6E-05   22.0  -1.5   21    5-25      2-22  (52)
 90 PF08279 HTH_11:  HTH domain;    66.2    0.95 2.1E-05   22.0  -1.1   16    3-18     18-33  (55)
 91 PRK12538 RNA polymerase sigma   65.5     1.1 2.4E-05   28.2  -1.2   32    1-32    188-219 (233)
 92 PRK12535 RNA polymerase sigma   65.5     1.8 3.8E-05   26.4  -0.3   32    2-33    151-182 (196)
 93 PRK09637 RNA polymerase sigma   65.3     1.2 2.7E-05   26.7  -1.0   30    1-30    123-152 (181)
 94 PRK05602 RNA polymerase sigma   65.2     1.3 2.7E-05   26.4  -0.9   30    2-31    146-175 (186)
 95 PRK09648 RNA polymerase sigma   65.0     1.2 2.7E-05   26.5  -1.0   22    2-23    157-178 (189)
 96 PRK12536 RNA polymerase sigma   65.0     1.2 2.6E-05   26.5  -1.0   29    2-30    147-175 (181)
 97 PRK12520 RNA polymerase sigma   64.6       2 4.4E-05   25.7  -0.1   32    2-33    149-180 (191)
 98 PRK12543 RNA polymerase sigma   64.5     1.3 2.7E-05   26.4  -1.0   30    2-31    135-164 (179)
 99 TIGR02959 SigZ RNA polymerase   64.2     1.3 2.8E-05   26.2  -1.0   31    2-32    118-148 (170)
100 cd04767 HTH_HspR-like_MBC Heli  63.8     1.1 2.3E-05   26.2  -1.4   24    1-24      2-25  (120)
101 TIGR02950 SigM_subfam RNA poly  63.6     1.3 2.8E-05   25.3  -1.1   21    2-22    123-143 (154)
102 cd04773 HTH_TioE_rpt2 Second H  63.4       1 2.3E-05   25.3  -1.5   22    1-22      1-22  (108)
103 TIGR03070 couple_hipB transcri  63.2     1.4   3E-05   21.0  -0.9   23    3-25     18-40  (58)
104 PF12728 HTH_17:  Helix-turn-he  63.0    0.98 2.1E-05   21.7  -1.4   25    1-25      2-26  (51)
105 cd00592 HTH_MerR-like Helix-Tu  62.8     1.1 2.5E-05   24.3  -1.3   22    1-22      1-22  (100)
106 PF01381 HTH_3:  Helix-turn-hel  62.8    0.67 1.5E-05   22.3  -2.1   24    2-25     11-34  (55)
107 PRK09645 RNA polymerase sigma   62.8     1.6 3.4E-05   25.6  -0.8   29    1-29    135-163 (173)
108 TIGR02607 antidote_HigA addict  62.4     1.3 2.9E-05   22.8  -1.1   24    2-25     20-43  (78)
109 PF00376 MerR:  MerR family reg  62.4    0.58 1.3E-05   21.8  -2.2   18    3-20      2-19  (38)
110 cd01106 HTH_TipAL-Mta Helix-Tu  62.4     1.1 2.4E-05   24.7  -1.4   24    1-24      1-24  (103)
111 PRK12532 RNA polymerase sigma   62.4     1.5 3.3E-05   26.3  -1.0   31    1-31    153-183 (195)
112 PRK12516 RNA polymerase sigma   62.2     1.5 3.4E-05   26.4  -1.0   32    1-32    133-164 (187)
113 TIGR02952 Sig70_famx2 RNA poly  61.7     1.4   3E-05   25.5  -1.2   21    1-21    139-159 (170)
114 TIGR02954 Sig70_famx3 RNA poly  61.2     1.8 3.9E-05   25.3  -0.8   21    2-22    137-157 (169)
115 cd00093 HTH_XRE Helix-turn-hel  60.8     1.3 2.9E-05   20.0  -1.2   23    3-25     15-37  (58)
116 PRK12512 RNA polymerase sigma   60.7     1.8 3.9E-05   25.7  -0.9   30    2-31    149-178 (184)
117 KOG3755|consensus               60.7     2.4 5.2E-05   31.3  -0.3   21   13-33    739-759 (769)
118 PRK11923 algU RNA polymerase s  60.4     1.6 3.5E-05   26.1  -1.1   30    2-31    156-185 (193)
119 PRK06986 fliA flagellar biosyn  60.3     1.7 3.7E-05   27.1  -1.0   29    2-30    202-230 (236)
120 PRK12537 RNA polymerase sigma   60.3       2 4.4E-05   25.5  -0.7   24    2-25    151-174 (182)
121 PRK12542 RNA polymerase sigma   60.0     1.8 3.9E-05   25.8  -1.0   29    2-30    140-168 (185)
122 PRK13182 racA polar chromosome  59.5     1.5 3.2E-05   27.1  -1.4   23    1-23      1-23  (175)
123 PRK12529 RNA polymerase sigma   59.4     1.7 3.7E-05   25.9  -1.1   27    2-28    145-171 (178)
124 cd04766 HTH_HspR Helix-Turn-He  58.8     1.4   3E-05   23.9  -1.4   22    1-22      2-23  (91)
125 PRK08301 sporulation sigma fac  58.8     1.9 4.1E-05   26.8  -1.0   29    2-30    200-228 (234)
126 PRK12533 RNA polymerase sigma   58.5     3.6 7.9E-05   25.6   0.2   31    2-32    152-182 (216)
127 PRK09640 RNA polymerase sigma   58.4     1.9 4.1E-05   25.8  -1.0   29    2-30    152-180 (188)
128 smart00530 HTH_XRE Helix-turn-  58.1     1.7 3.6E-05   19.5  -1.1   23    3-25     13-35  (56)
129 PRK12513 RNA polymerase sigma   57.9       2 4.4E-05   25.7  -1.0   30    2-31    157-186 (194)
130 smart00421 HTH_LUXR helix_turn  57.4     1.2 2.7E-05   20.9  -1.7   21    2-22     20-40  (58)
131 cd08313 Death_TNFR1 Death doma  57.1     2.3 5.1E-05   23.0  -0.7   15    4-18     15-29  (80)
132 TIGR02044 CueR Cu(I)-responsiv  57.1     1.7 3.6E-05   25.0  -1.4   22    1-22      1-22  (127)
133 cd01105 HTH_GlnR-like Helix-Tu  56.8     1.6 3.5E-05   23.6  -1.4   20    1-20      2-21  (88)
134 PRK12541 RNA polymerase sigma   56.7     1.6 3.5E-05   25.3  -1.5   28    2-29    130-157 (161)
135 TIGR02859 spore_sigH RNA polym  56.5       2 4.4E-05   25.6  -1.1   21    2-22    167-187 (198)
136 PF06505 XylR_N:  Activator of   56.5     3.4 7.4E-05   23.4  -0.1   22    5-26      1-22  (103)
137 PRK03975 tfx putative transcri  56.5       2 4.2E-05   25.7  -1.2   32    2-33     23-54  (141)
138 PRK12523 RNA polymerase sigma   56.4       2 4.3E-05   25.3  -1.2   28    2-29    137-164 (172)
139 PRK06930 positive control sigm  56.3       2 4.3E-05   26.1  -1.2   30    2-31    132-161 (170)
140 PF05331 DUF742:  Protein of un  56.3     4.2   9E-05   23.5   0.2   18    3-20     58-75  (114)
141 cd01279 HTH_HspR-like Helix-Tu  56.0     1.6 3.4E-05   24.1  -1.5   22    1-22      2-23  (98)
142 PRK12522 RNA polymerase sigma   55.7     2.6 5.6E-05   24.8  -0.8   28    2-29    137-164 (173)
143 cd04789 HTH_Cfa Helix-Turn-Hel  55.6     1.8 3.9E-05   24.0  -1.4   22    1-22      2-23  (102)
144 PRK08295 RNA polymerase factor  55.2     2.3   5E-05   25.6  -1.0   29    2-30    172-200 (208)
145 cd01282 HTH_MerR-like_sg3 Heli  55.1     1.9 4.1E-05   24.3  -1.3   22    1-22      1-22  (112)
146 PRK12539 RNA polymerase sigma   55.0     2.4 5.3E-05   25.2  -0.9   29    2-30    149-177 (184)
147 cd01109 HTH_YyaN Helix-Turn-He  55.0       2 4.3E-05   24.1  -1.3   21    1-21      1-21  (113)
148 PRK09647 RNA polymerase sigma   54.9     3.1 6.6E-05   25.6  -0.5   30    2-31    156-185 (203)
149 cd04786 HTH_MerR-like_sg7 Heli  54.8       2 4.3E-05   25.1  -1.3   20    1-20      1-20  (131)
150 TIGR02943 Sig70_famx1 RNA poly  54.6     2.5 5.4E-05   25.5  -1.0   31    1-31    148-178 (188)
151 PRK12524 RNA polymerase sigma   54.4     2.4 5.1E-05   25.6  -1.1   30    2-31    154-183 (196)
152 TIGR03001 Sig-70_gmx1 RNA poly  54.4     2.9 6.2E-05   26.6  -0.7   31    2-32    179-209 (244)
153 PRK12545 RNA polymerase sigma   54.4     3.9 8.5E-05   24.8  -0.1   30    2-31    157-186 (201)
154 cd04779 HTH_MerR-like_sg4 Heli  54.3     1.9 4.2E-05   25.3  -1.4   24    1-24      1-24  (134)
155 PRK12546 RNA polymerase sigma   54.0     2.6 5.6E-05   25.5  -1.0   30    2-31    131-160 (188)
156 PRK10227 DNA-binding transcrip  53.9     2.1 4.5E-05   25.1  -1.3   20    1-20      1-20  (135)
157 PRK12511 RNA polymerase sigma   53.7     2.8   6E-05   25.3  -0.9   31    1-31    128-158 (182)
158 PRK09649 RNA polymerase sigma   53.5     2.3   5E-05   25.5  -1.2   21    2-22    148-168 (185)
159 PF07638 Sigma70_ECF:  ECF sigm  53.4     2.5 5.3E-05   25.6  -1.1   24    2-25    153-176 (185)
160 PF04967 HTH_10:  HTH DNA bindi  53.3     2.7 5.9E-05   21.1  -0.8   17    2-18     25-41  (53)
161 TIGR02054 MerD mercuric resist  52.7     2.2 4.8E-05   24.7  -1.3   22    1-22      4-25  (120)
162 PF07022 Phage_CI_repr:  Bacter  52.5     2.5 5.5E-05   21.6  -1.0   22    4-25     16-38  (66)
163 PRK07037 extracytoplasmic-func  52.4     2.7 5.8E-05   24.3  -1.0   21    2-22    127-147 (163)
164 PRK12531 RNA polymerase sigma   52.3       3 6.4E-05   25.1  -0.9   26    2-27    159-184 (194)
165 TIGR03826 YvyF flagellar opero  51.8     2.3 4.9E-05   25.4  -1.4   25    2-26     48-72  (137)
166 cd06170 LuxR_C_like C-terminal  51.8     2.3 4.9E-05   20.1  -1.2   21    2-22     17-37  (57)
167 cd04775 HTH_Cfa-like Helix-Tur  51.8     2.2 4.9E-05   23.6  -1.4   21    2-22      3-23  (102)
168 PRK13919 putative RNA polymera  51.8     3.1 6.6E-05   24.7  -0.9   21    2-22    153-173 (186)
169 PRK06811 RNA polymerase factor  51.8     2.6 5.7E-05   25.2  -1.2   29    2-30    149-177 (189)
170 smart00354 HTH_LACI helix_turn  51.8     2.4 5.1E-05   21.9  -1.2   24    2-25      2-25  (70)
171 PRK09638 RNA polymerase sigma   51.6     3.2   7E-05   24.3  -0.8   21    2-22    144-164 (176)
172 PF13551 HTH_29:  Winged helix-  51.5     1.6 3.4E-05   23.7  -2.0   21    2-22     14-34  (112)
173 TIGR02047 CadR-PbrR Cd(II)/Pb(  51.4     2.4 5.1E-05   24.5  -1.4   22    1-22      1-22  (127)
174 cd08306 Death_FADD Fas-associa  51.4     3.5 7.6E-05   22.3  -0.6   18    4-21     17-34  (86)
175 cd01110 HTH_SoxR Helix-Turn-He  51.1     2.4 5.2E-05   24.9  -1.4   22    1-22      2-23  (139)
176 PF02796 HTH_7:  Helix-turn-hel  50.3     2.9 6.3E-05   19.8  -0.9   18    2-19     23-40  (45)
177 PF04552 Sigma54_DBD:  Sigma-54  49.9     5.4 0.00012   24.2   0.0   18    1-18     50-67  (160)
178 COG2197 CitB Response regulato  49.8       3 6.4E-05   25.9  -1.2   17    4-20    167-183 (211)
179 PF08220 HTH_DeoR:  DeoR-like h  49.5       3 6.6E-05   20.8  -1.0   17    2-18     16-32  (57)
180 cd02413 40S_S3_KH K homology R  49.4     7.1 0.00015   21.0   0.4   18    5-22     58-75  (81)
181 COG1595 RpoE DNA-directed RNA   48.9       3 6.6E-05   24.8  -1.2   31    3-33    146-176 (182)
182 PF13936 HTH_38:  Helix-turn-he  48.6     2.9 6.3E-05   19.8  -1.1   19    2-20     22-40  (44)
183 PRK11922 RNA polymerase sigma   48.6     3.4 7.4E-05   25.7  -1.0   31    2-32    167-197 (231)
184 PHA01976 helix-turn-helix prot  48.4     3.1 6.7E-05   20.8  -1.1   23    3-25     18-40  (67)
185 PRK12540 RNA polymerase sigma   48.3     3.6 7.8E-05   24.7  -1.0   29    2-30    129-157 (182)
186 PRK11511 DNA-binding transcrip  48.1     2.2 4.8E-05   24.4  -1.8   23    2-24     27-49  (127)
187 PRK08583 RNA polymerase sigma   48.0     3.6 7.8E-05   26.0  -1.0   28    2-29    223-250 (257)
188 PRK04217 hypothetical protein;  47.9     3.2 6.9E-05   23.8  -1.2   30    2-31     60-89  (110)
189 TIGR01950 SoxR redox-sensitive  47.7     2.9 6.3E-05   24.7  -1.4   22    1-22      2-23  (142)
190 PRK09641 RNA polymerase sigma   47.7     3.6 7.7E-05   24.2  -1.0   29    2-30    154-182 (187)
191 cd01107 HTH_BmrR Helix-Turn-He  47.6     3.1 6.7E-05   23.2  -1.2   22    1-22      1-22  (108)
192 TIGR02980 SigBFG RNA polymeras  47.5     3.4 7.3E-05   25.5  -1.2   22    1-22    195-216 (227)
193 PF13542 HTH_Tnp_ISL3:  Helix-t  47.4     2.5 5.3E-05   20.2  -1.5   19    3-21     30-48  (52)
194 PRK12525 RNA polymerase sigma   47.4     3.1 6.7E-05   24.4  -1.3   22    2-23    136-157 (168)
195 TIGR02835 spore_sigmaE RNA pol  47.3     3.7 7.9E-05   25.7  -1.1   21    2-22    200-220 (234)
196 PRK09636 RNA polymerase sigma   47.1     3.4 7.5E-05   26.6  -1.2   30    1-30    132-161 (293)
197 PF06322 Phage_NinH:  Phage Nin  46.8     3.8 8.3E-05   21.5  -0.8   18    2-19     18-35  (64)
198 PF01418 HTH_6:  Helix-turn-hel  46.5     3.9 8.4E-05   21.5  -0.9   18    1-18     35-52  (77)
199 cd04765 HTH_MlrA-like_sg2 Heli  46.5       3 6.5E-05   23.1  -1.4   21    2-22      2-22  (99)
200 PF01710 HTH_Tnp_IS630:  Transp  46.4     2.7 5.9E-05   23.9  -1.6   21    2-22     20-40  (119)
201 cd04787 HTH_HMRTR_unk Helix-Tu  46.2     3.2   7E-05   24.0  -1.3   20    1-20      1-20  (133)
202 cd01108 HTH_CueR Helix-Turn-He  46.1     3.3 7.2E-05   23.8  -1.3   22    1-22      1-22  (127)
203 PRK09413 IS2 repressor TnpA; R  46.0     3.3 7.1E-05   23.6  -1.3   20    2-21     31-50  (121)
204 PF07498 Rho_N:  Rho terminatio  45.9     9.5 0.00021   18.0   0.5   13    2-14      9-21  (43)
205 PRK11179 DNA-binding transcrip  45.8     3.7   8E-05   24.2  -1.2   16    3-18     26-41  (153)
206 PRK07670 RNA polymerase sigma   45.4       4 8.8E-05   25.7  -1.1   28    2-29    219-246 (251)
207 PRK06704 RNA polymerase factor  45.3       4 8.6E-05   25.9  -1.1   30    2-31    134-163 (228)
208 PF00356 LacI:  Bacterial regul  45.2     2.7 5.9E-05   20.4  -1.5   22    3-24      2-23  (46)
209 COG0789 SoxR Predicted transcr  45.1     3.8 8.2E-05   22.9  -1.1   20    1-20      1-20  (124)
210 PRK12544 RNA polymerase sigma   44.9     4.2 9.2E-05   25.0  -1.0   30    2-31    166-195 (206)
211 PF01527 HTH_Tnp_1:  Transposas  44.9     1.9 4.2E-05   22.0  -2.2   19    2-20     25-43  (76)
212 cd04784 HTH_CadR-PbrR Helix-Tu  44.7     3.5 7.5E-05   23.6  -1.4   21    1-21      1-21  (127)
213 cd04768 HTH_BmrR-like Helix-Tu  44.6     3.5 7.7E-05   22.6  -1.3   22    2-23      2-23  (96)
214 PF07813 LTXXQ:  LTXXQ motif fa  44.4       4 8.6E-05   21.7  -1.1   18    3-20      6-23  (100)
215 PF08452 DNAP_B_exo_N:  DNA pol  43.6     7.6 0.00016   16.2  -0.0    8   19-26      7-14  (22)
216 cd04769 HTH_MerR2 Helix-Turn-H  43.4     3.7 8.1E-05   23.2  -1.3   22    1-22      1-22  (116)
217 cd08315 Death_TRAILR_DR4_DR5 D  43.1     5.3 0.00011   22.2  -0.7   16    3-18     22-37  (96)
218 TIGR02960 SigX5 RNA polymerase  43.1     4.6 9.9E-05   26.1  -1.1   28    2-29    160-187 (324)
219 cd04781 HTH_MerR-like_sg6 Heli  43.0     3.8 8.3E-05   23.3  -1.4   22    1-22      1-22  (120)
220 PF13223 DUF4031:  Protein of u  42.7     6.9 0.00015   21.5  -0.3   18    2-23     25-42  (83)
221 PF04936 DUF658:  Protein of un  42.6     2.5 5.4E-05   26.3  -2.3   31    3-33     17-47  (186)
222 TIGR02043 ZntR Zn(II)-responsi  42.5     3.9 8.5E-05   23.7  -1.4   22    1-22      2-23  (131)
223 PF06971 Put_DNA-bind_N:  Putat  42.4     2.2 4.8E-05   21.2  -2.1   15    4-18     32-46  (50)
224 PRK09651 RNA polymerase sigma   42.3     4.9 0.00011   23.7  -1.0   21    2-22    137-157 (172)
225 PF09012 FeoC:  FeoC like trans  42.3     3.8 8.3E-05   21.0  -1.3   17    2-18     16-32  (69)
226 cd04770 HTH_HMRTR Helix-Turn-H  42.2       4 8.7E-05   23.1  -1.3   21    1-21      1-21  (123)
227 PRK12527 RNA polymerase sigma   42.0       5 0.00011   23.1  -1.0   21    2-22    123-143 (159)
228 PF11388 DotA:  Phagosome traff  42.0      39 0.00085   19.2   2.7   18   16-33     31-48  (105)
229 cd04777 HTH_MerR-like_sg1 Heli  41.9       4 8.7E-05   22.6  -1.3   20    1-20      1-20  (107)
230 PRK12534 RNA polymerase sigma   41.4     6.7 0.00015   23.2  -0.5   21    2-22    155-175 (187)
231 TIGR02957 SigX4 RNA polymerase  41.3     4.7  0.0001   25.9  -1.3   29    2-30    126-154 (281)
232 PRK07408 RNA polymerase sigma   40.9       5 0.00011   25.5  -1.2   29    1-29    220-248 (256)
233 COG4189 Predicted transcriptio  40.6     9.5 0.00021   25.3   0.1   18    1-18     38-55  (308)
234 PRK12528 RNA polymerase sigma   40.4     4.5 9.8E-05   23.4  -1.3   21    2-22    131-151 (161)
235 PRK07122 RNA polymerase sigma   40.3     5.3 0.00011   25.7  -1.2   28    1-28    232-259 (264)
236 cd04785 HTH_CadR-PbrR-like Hel  40.3     4.4 9.6E-05   23.2  -1.4   22    1-22      1-22  (126)
237 cd08316 Death_FAS_TNFRSF6 Deat  39.9     6.8 0.00015   21.9  -0.6   16    3-18     23-38  (97)
238 TIGR02394 rpoS_proteo RNA poly  39.8     5.6 0.00012   25.6  -1.1   30    2-31    244-273 (285)
239 TIGR02479 FliA_WhiG RNA polyme  39.8     5.7 0.00012   24.5  -1.0   22    2-23    193-214 (224)
240 PRK09514 zntR zinc-responsive   39.8     4.5 9.8E-05   23.7  -1.4   22    1-22      2-23  (140)
241 cd00569 HTH_Hin_like Helix-tur  39.6     4.5 9.6E-05   16.4  -1.2   18    3-20     24-41  (42)
242 PRK05657 RNA polymerase sigma   39.5     5.6 0.00012   26.4  -1.1   31    2-32    284-314 (325)
243 cd04782 HTH_BltR Helix-Turn-He  39.5     4.6 9.9E-05   22.1  -1.4   21    2-22      2-22  (97)
244 PRK15411 rcsA colanic acid cap  39.2     6.6 0.00014   24.2  -0.8   18    3-20    155-172 (207)
245 PRK09706 transcriptional repre  39.0     5.7 0.00012   22.8  -1.1   25    3-27     21-45  (135)
246 PRK13890 conjugal transfer pro  38.6     5.4 0.00012   22.9  -1.2   24    2-25     20-43  (120)
247 PRK09415 RNA polymerase factor  38.4     5.7 0.00012   23.6  -1.2   21    2-22    145-165 (179)
248 cd08318 Death_NMPP84 Death dom  38.3     6.3 0.00014   21.3  -0.9   16    4-19     22-37  (86)
249 cd08779 Death_PIDD Death Domai  38.1     7.9 0.00017   21.0  -0.5   22    4-25     17-39  (86)
250 PRK09726 antitoxin HipB; Provi  38.0     5.6 0.00012   21.3  -1.1   23    3-25     28-50  (88)
251 PF00196 GerE:  Bacterial regul  37.8     1.6 3.5E-05   21.5  -3.1   24    2-25     20-43  (58)
252 PF14493 HTH_40:  Helix-turn-he  37.4      11 0.00024   20.3  -0.0   18    1-18     14-31  (91)
253 cd08784 Death_DRs Death Domain  37.2     7.1 0.00015   20.8  -0.8   22    4-25     15-37  (79)
254 cd04783 HTH_MerR1 Helix-Turn-H  37.2     5.2 0.00011   22.8  -1.4   20    1-20      1-20  (126)
255 KOG4580|consensus               37.2      13 0.00029   21.5   0.3   12   17-28     10-21  (112)
256 PRK11169 leucine-responsive tr  37.1     6.7 0.00014   23.4  -1.0   16    3-18     31-46  (164)
257 TIGR02941 Sigma_B RNA polymera  36.9     6.3 0.00014   24.8  -1.2   26    2-27    223-248 (255)
258 COG2452 Predicted site-specifi  36.9       6 0.00013   25.0  -1.2   27    1-27      2-28  (193)
259 TIGR02984 Sig-70_plancto1 RNA   36.4       6 0.00013   23.2  -1.3   20    1-20    157-176 (189)
260 PF09607 BrkDBD:  Brinker DNA-b  36.0     3.5 7.6E-05   21.3  -2.0   17    6-22     31-47  (58)
261 COG1309 AcrR Transcriptional r  36.0      10 0.00023   20.9  -0.2   23    3-25     35-57  (201)
262 COG5264 VTC1 Vacuolar transpor  35.8      15 0.00031   21.8   0.3   12   17-28     25-36  (126)
263 PRK12517 RNA polymerase sigma   35.6     7.5 0.00016   23.4  -1.0   29    2-30    146-174 (188)
264 PRK13749 transcriptional regul  35.4       6 0.00013   23.0  -1.3   20    1-20      4-23  (121)
265 COG3747 Phage terminase, small  35.4     9.5 0.00021   23.4  -0.5   15    1-15    119-133 (160)
266 PRK09643 RNA polymerase sigma   35.2     7.6 0.00016   23.4  -1.0   18    2-19    152-169 (192)
267 COG3655 Predicted transcriptio  35.1     6.8 0.00015   21.1  -1.0   19    1-19     16-34  (73)
268 PRK06288 RNA polymerase sigma   34.6     7.8 0.00017   24.7  -1.0   30    2-31    230-259 (268)
269 TIGR02051 MerR Hg(II)-responsi  34.3     5.6 0.00012   22.8  -1.6   18    3-20      2-19  (124)
270 COG1522 Lrp Transcriptional re  34.2      10 0.00022   21.7  -0.5   17    2-18     24-40  (154)
271 KOG4752|consensus               33.9      27 0.00059   14.8   0.9    7   25-31      2-8   (26)
272 cd08804 Death_ank2 Death domai  33.9     8.4 0.00018   20.8  -0.8   15    4-18     19-33  (84)
273 cd08317 Death_ank Death domain  33.9     8.3 0.00018   20.6  -0.9   16    4-19     19-34  (84)
274 PRK08241 RNA polymerase factor  33.8       7 0.00015   25.5  -1.4   22    1-22    170-191 (339)
275 cd01111 HTH_MerD Helix-Turn-He  33.6     6.6 0.00014   22.1  -1.3   21    2-22      2-22  (107)
276 PRK10100 DNA-binding transcrip  33.5     5.4 0.00012   24.9  -1.8   26    3-28    173-198 (216)
277 COG2944 Predicted transcriptio  32.8     5.7 0.00012   22.7  -1.7   22    5-26     62-83  (104)
278 smart00342 HTH_ARAC helix_turn  32.7       9 0.00019   19.0  -0.8   20    2-21      3-22  (84)
279 PF00424 REV:  REV protein (ant  32.6      24 0.00051   19.8   0.8   13   22-34     37-49  (91)
280 cd04776 HTH_GnyR Helix-Turn-He  32.1     7.2 0.00016   22.2  -1.4   20    1-20      1-20  (118)
281 TIGR02393 RpoD_Cterm RNA polym  31.8       8 0.00017   24.2  -1.3   30    2-31    198-227 (238)
282 TIGR02846 spore_sigmaK RNA pol  31.7     8.9 0.00019   23.8  -1.1   20    2-21    196-215 (227)
283 cd08319 Death_RAIDD Death doma  31.6     9.4  0.0002   20.7  -0.9   20    4-23     17-36  (83)
284 TIGR03541 reg_near_HchA LuxR f  31.6     5.4 0.00012   25.0  -2.1   27    3-29    189-215 (232)
285 cd08777 Death_RIP1 Death Domai  31.2     9.6 0.00021   20.7  -0.9   16    4-19     17-32  (86)
286 PF13560 HTH_31:  Helix-turn-he  31.1     4.6  0.0001   20.1  -2.1   24    3-26     17-40  (64)
287 PRK15002 redox-sensitivie tran  31.0     7.8 0.00017   23.3  -1.4   22    1-22     12-33  (154)
288 cd04772 HTH_TioE_rpt1 First He  30.9     6.9 0.00015   21.6  -1.5   20    2-21      2-21  (99)
289 PRK13752 putative transcriptio  30.8     7.6 0.00017   23.0  -1.4   20    1-20      8-27  (144)
290 PF06032 DUF917:  Protein of un  30.7      23  0.0005   24.0   0.7   12   13-24    267-278 (353)
291 PRK10046 dpiA two-component re  30.7     9.5  0.0002   23.3  -1.1   16    3-18    180-195 (225)
292 COG5566 Uncharacterized conser  30.7      11 0.00025   22.5  -0.7   19    1-19    103-121 (137)
293 TIGR02885 spore_sigF RNA polym  30.6     8.7 0.00019   23.7  -1.3   20    1-20    200-219 (231)
294 PRK05803 sporulation sigma fac  30.5     9.3  0.0002   23.8  -1.1   20    2-21    197-216 (233)
295 PRK10651 transcriptional regul  30.4     6.9 0.00015   22.7  -1.7   25    3-27    173-197 (216)
296 PF04391 DUF533:  Protein of un  30.4      11 0.00024   23.5  -0.8   16    3-18    166-181 (188)
297 PF09339 HTH_IclR:  IclR helix-  30.3     4.8  0.0001   19.4  -2.0   17    2-18     20-36  (52)
298 TIGR03020 EpsA transcriptional  30.3       6 0.00013   25.5  -2.1   26    3-28    208-233 (247)
299 PF11516 DUF3220:  Protein of u  30.3     7.4 0.00016   21.6  -1.4   12   14-25     30-41  (106)
300 PF05344 DUF746:  Domain of Unk  29.8     7.7 0.00017   20.5  -1.4   20    3-22     16-35  (65)
301 PRK05911 RNA polymerase sigma   29.7      10 0.00022   24.2  -1.1   21    2-22    223-243 (257)
302 cd01763 Sumo Small ubiquitin-r  29.4      27 0.00058   18.6   0.7   24    5-28     40-63  (87)
303 PHA02535 P terminase ATPase su  29.3     9.9 0.00021   27.7  -1.3   27    3-31     21-47  (581)
304 cd01793 Fubi Fubi ubiquitin-li  29.3      25 0.00054   18.0   0.5   23    5-27     27-49  (74)
305 PRK15369 two component system   29.2     7.6 0.00016   22.2  -1.6   24    3-26    167-190 (211)
306 cd01670 Death Death Domain: a   29.0     9.4  0.0002   19.5  -1.1   21    4-24     14-34  (79)
307 PHA03236 DNA packaging protein  28.9      30 0.00066   20.5   0.9   23    2-24     23-46  (127)
308 PRK10840 transcriptional regul  28.9      10 0.00022   22.8  -1.2   16    4-19    169-184 (216)
309 PRK15482 transcriptional regul  28.7      17 0.00037   23.2  -0.2   18    1-18     35-52  (285)
310 PF12844 HTH_19:  Helix-turn-he  28.7     5.1 0.00011   19.8  -2.2   24    2-25     14-37  (64)
311 PF14354 Lar_restr_allev:  Rest  28.6      12 0.00026   18.5  -0.7    8   17-26     54-61  (61)
312 PRK10403 transcriptional regul  28.4     7.6 0.00016   22.4  -1.7   24    4-27    172-195 (215)
313 PF09292 Neil1-DNA_bind:  Endon  28.3      22 0.00049   16.8   0.2    6   18-23     27-32  (39)
314 PF01978 TrmB:  Sugar-specific   28.3     6.2 0.00014   19.9  -1.9   17    2-18     24-40  (68)
315 TIGR02395 rpoN_sigma RNA polym  28.0      25 0.00055   24.5   0.5   18    1-18    319-336 (429)
316 PRK10430 DNA-binding transcrip  27.7      14 0.00031   22.6  -0.7   20    3-22    181-200 (239)
317 cd01798 parkin_N amino-termina  27.6      22 0.00047   17.9   0.1   22    5-26     27-48  (70)
318 PRK15043 transcriptional regul  27.4      10 0.00022   24.6  -1.4   21    1-21      4-24  (243)
319 PRK11475 DNA-binding transcrip  27.3     9.4  0.0002   23.7  -1.5   17    3-19    152-168 (207)
320 PF13412 HTH_24:  Winged helix-  27.2     7.3 0.00016   18.2  -1.6   16    3-18     20-35  (48)
321 cd04778 HTH_MerR-like_sg2 Heli  26.9      11 0.00023   24.0  -1.4   20    1-20      2-21  (219)
322 PRK11557 putative DNA-binding   26.7      20 0.00043   22.7  -0.2   18    1-18     31-48  (278)
323 PF00440 TetR_N:  Bacterial reg  26.7     5.8 0.00013   18.7  -2.1   23    2-24     18-40  (47)
324 TIGR00122 birA_repr_reg BirA b  26.7      11 0.00024   19.0  -1.1   16    3-18     16-31  (69)
325 PF04760 IF2_N:  Translation in  26.6     7.3 0.00016   19.0  -1.7   15    3-17      6-20  (54)
326 PRK11337 DNA-binding transcrip  26.5      21 0.00045   22.9  -0.1   18    1-18     47-64  (292)
327 PRK11302 DNA-binding transcrip  26.3      19 0.00042   22.7  -0.2   18    1-18     35-52  (284)
328 PRK05572 sporulation sigma fac  26.0      13 0.00027   23.5  -1.2   20    1-20    219-238 (252)
329 PF04293 SpoVR:  SpoVR like pro  25.8      31 0.00066   24.3   0.6   21    2-22     14-34  (426)
330 cd01796 DDI1_N DNA damage indu  25.7      29 0.00063   17.7   0.4   23    5-27     28-50  (71)
331 TIGR03613 RutR pyrimidine util  25.6      13 0.00029   22.0  -1.0   23    3-25     31-53  (202)
332 cd01803 Ubiquitin Ubiquitin. U  25.6      26 0.00057   17.5   0.2   21    5-25     29-49  (76)
333 PRK13870 transcriptional regul  25.5     8.4 0.00018   24.3  -2.0   24    4-27    192-215 (234)
334 PF14549 P22_Cro:  DNA-binding   25.4     7.8 0.00017   19.9  -1.8   27    3-31     12-38  (60)
335 TIGR02612 mob_myst_A mobile my  25.4      13 0.00029   22.3  -1.0   24    2-25     40-63  (150)
336 smart00550 Zalpha Z-DNA-bindin  25.4      15 0.00033   18.8  -0.7   16    3-18     25-40  (68)
337 PRK09975 DNA-binding transcrip  25.3      15 0.00033   21.9  -0.8   24    3-26     34-57  (213)
338 PF05119 Terminase_4:  Phage te  25.1      23 0.00049   19.0  -0.1   14    2-15     72-85  (100)
339 PRK06424 transcription factor;  24.8      14  0.0003   22.1  -1.1   25    3-27    100-124 (144)
340 PRK05932 RNA polymerase factor  24.8      31 0.00066   24.3   0.5   18    1-18    344-361 (455)
341 cd01769 UBL Ubiquitin-like dom  24.5      30 0.00065   16.7   0.3   20    5-24     26-45  (69)
342 PRK09635 sigI RNA polymerase s  24.1      13 0.00029   24.2  -1.3   26    2-27    136-161 (290)
343 PF13730 HTH_36:  Helix-turn-he  24.0      12 0.00026   17.9  -1.2   18    3-20     28-45  (55)
344 PF08784 RPA_C:  Replication pr  23.9      11 0.00023   20.6  -1.6   17    2-18     67-83  (102)
345 cd08805 Death_ank1 Death domai  23.6      18 0.00039   19.7  -0.7   15    4-18     19-33  (84)
346 PF04539 Sigma70_r3:  Sigma-70   23.6     8.9 0.00019   19.7  -1.9   17    3-19     23-39  (78)
347 PF08671 SinI:  Anti-repressor   23.3     9.7 0.00021   17.0  -1.5   19    2-20      7-25  (30)
348 PTZ00044 ubiquitin; Provisiona  23.3      28  0.0006   17.7   0.0   23    5-27     29-51  (76)
349 PF11976 Rad60-SLD:  Ubiquitin-  23.2      27 0.00058   17.5  -0.0   24    4-27     28-52  (72)
350 PRK09191 two-component respons  23.0      17 0.00037   22.2  -0.9   21    2-22    106-126 (261)
351 COG1737 RpiR Transcriptional r  23.0      20 0.00044   23.2  -0.6   17    2-18     38-54  (281)
352 smart00344 HTH_ASNC helix_turn  22.9      18  0.0004   19.5  -0.8   16    3-18     20-35  (108)
353 TIGR02392 rpoH_proteo alternat  22.8      16 0.00034   23.4  -1.2   21    2-22    238-258 (270)
354 TIGR03624 putative hydrolase.   22.4      19 0.00041   24.5  -0.9   30    2-31    140-169 (345)
355 PRK06596 RNA polymerase factor  22.4      18 0.00039   23.5  -1.0   19    2-20    250-268 (284)
356 PF12793 SgrR_N:  Sugar transpo  22.4      19 0.00042   20.5  -0.7   17    2-18     21-37  (115)
357 PRK07500 rpoH2 RNA polymerase   22.3      17 0.00036   23.7  -1.1   28    2-29    247-274 (289)
358 COG1318 Predicted transcriptio  22.3      18 0.00039   22.7  -0.9   19    2-20     63-81  (182)
359 PRK13719 conjugal transfer tra  22.3      20 0.00044   23.0  -0.7   17    3-19    161-177 (217)
360 PRK10360 DNA-binding transcrip  22.0      13 0.00028   21.4  -1.6   25    3-27    155-179 (196)
361 cd04790 HTH_Cfa-like_unk Helix  21.9      15 0.00032   22.3  -1.4   19    2-20      3-21  (172)
362 COG3149 PulM Type II secretory  21.9      37 0.00081   21.3   0.4   14   10-23    122-135 (181)
363 PF09301 DUF1970:  Domain of un  21.7      18 0.00039   20.3  -0.9   11   17-27     19-29  (117)
364 PRK05863 sulfur carrier protei  21.6      96  0.0021   15.5   1.9   29    2-30     17-48  (65)
365 cd00419 Ferrochelatase_C Ferro  21.6      40 0.00088   19.6   0.5   21    5-25     49-69  (135)
366 PRK15201 fimbriae regulatory p  21.6      21 0.00045   22.7  -0.8   17    3-19    151-167 (198)
367 smart00420 HTH_DEOR helix_turn  21.5      19 0.00041   16.4  -0.8   18    2-19     16-33  (53)
368 PRK09943 DNA-binding transcrip  21.4      18 0.00038   21.8  -1.1   22    3-24     23-44  (185)
369 PF04046 PSP:  PSP;  InterPro:   21.3      27 0.00058   17.3  -0.2   19    4-22      7-25  (48)
370 cd01806 Nedd8 Nebb8-like  ubiq  21.3      48   0.001   16.5   0.7   22    5-26     29-50  (76)
371 PRK09935 transcriptional regul  21.2      14  0.0003   21.4  -1.6   25    3-27    167-191 (210)
372 PRK10281 hypothetical protein;  21.0      31 0.00068   22.6  -0.1   16    2-17     34-49  (299)
373 TIGR03883 DUF2342_F420 unchara  21.0      21 0.00046   24.3  -0.8   30    2-31    144-173 (346)
374 TIGR02997 Sig70-cyanoRpoD RNA   21.0      20 0.00044   23.3  -1.0   19    2-20    271-289 (298)
375 COG3413 Predicted DNA binding   20.9      23 0.00049   21.9  -0.7   26    2-29    180-205 (215)
376 cd08311 Death_p75NR Death doma  20.9      18  0.0004   19.3  -1.0   17    4-20     19-35  (77)
377 PHA00542 putative Cro-like pro  20.9      15 0.00033   19.5  -1.3   23    2-24     33-55  (82)
378 PF00531 Death:  Death domain;   20.8      14 0.00031   18.8  -1.4   17    4-20     16-32  (83)
379 PF13693 HTH_35:  Winged helix-  20.8      18  0.0004   19.5  -1.0   26    2-27     17-42  (78)
380 PRK11303 DNA-binding transcrip  20.8      24 0.00052   22.4  -0.6   24    1-24      1-24  (328)
381 PF09862 DUF2089:  Protein of u  20.7      22 0.00049   20.6  -0.7   17    2-18     51-67  (113)
382 PRK10668 DNA-binding transcrip  20.7      21 0.00046   21.4  -0.8   24    3-26     34-57  (215)
383 COG0384 Predicted epimerase, P  20.6      33 0.00073   22.8   0.0   15    2-16     35-49  (291)
384 cd08803 Death_ank3 Death domai  20.5      24 0.00052   19.1  -0.6   16    4-19     19-34  (84)
385 PF12840 HTH_20:  Helix-turn-he  20.4      11 0.00025   18.6  -1.8   16    2-17     26-41  (61)
386 PRK08215 sporulation sigma fac  20.4      19 0.00041   22.8  -1.1   19    2-20    227-245 (258)
387 PF15599 Imm38:  Immunity prote  20.4      49  0.0011   19.0   0.7   21    2-22      6-26  (124)
388 PF10846 DUF2722:  Protein of u  20.2      31 0.00067   24.1  -0.2   21    1-21     88-108 (416)
389 PF02567 PhzC-PhzF:  Phenazine   20.2      21 0.00046   22.6  -1.0   14    2-15     27-40  (281)

No 1  
>KOG0489|consensus
Probab=99.66  E-value=1.9e-17  Score=106.23  Aligned_cols=35  Identities=60%  Similarity=0.880  Sum_probs=31.7

Q ss_pred             hhhhcCCCCCccceeeccccchhHHHHHhhhhccC
Q psy12003          4 LRDKNPPRGTERQIKIWFQNRRMKWKKEHKMASMN   38 (61)
Q Consensus         4 ~eLA~~l~Lte~~VqvWFqNrRak~kr~~~~~~~~   38 (61)
                      .|||..|+|+|+|||||||||||||||..+.....
T Consensus       190 iEiA~~L~LtErQIKIWFQNRRMK~Kk~~k~~~~~  224 (261)
T KOG0489|consen  190 IEIAHALNLTERQIKIWFQNRRMKWKKENKAKSSQ  224 (261)
T ss_pred             HHHHhhcchhHHHHHHHHHHHHHHHHHhhcccccc
Confidence            48999999999999999999999999998866654


No 2  
>KOG0487|consensus
Probab=99.62  E-value=7.9e-17  Score=105.49  Aligned_cols=32  Identities=53%  Similarity=0.674  Sum_probs=29.3

Q ss_pred             hhhhcCCCCCccceeeccccchhHHHHHhhhh
Q psy12003          4 LRDKNPPRGTERQIKIWFQNRRMKWKKEHKMA   35 (61)
Q Consensus         4 ~eLA~~l~Lte~~VqvWFqNrRak~kr~~~~~   35 (61)
                      .|||+.|||||+||||||||||+|.||..+..
T Consensus       266 ~ElSr~lNLTeRQVKIWFQNRRMK~KK~~re~  297 (308)
T KOG0487|consen  266 LELSRTLNLTERQVKIWFQNRRMKEKKVNREN  297 (308)
T ss_pred             HHHHHhcccchhheeeeehhhhhHHhhhhhhh
Confidence            48999999999999999999999999998633


No 3  
>KOG0848|consensus
Probab=99.60  E-value=1.8e-16  Score=102.39  Aligned_cols=32  Identities=44%  Similarity=0.577  Sum_probs=29.3

Q ss_pred             hhhhcCCCCCccceeeccccchhHHHHHhhhh
Q psy12003          4 LRDKNPPRGTERQIKIWFQNRRMKWKKEHKMA   35 (61)
Q Consensus         4 ~eLA~~l~Lte~~VqvWFqNrRak~kr~~~~~   35 (61)
                      .|||..|+|+|+||||||||||||.||..+.+
T Consensus       230 SELA~~LgLsERQVKIWFQNRRAKERK~nKKk  261 (317)
T KOG0848|consen  230 SELAATLGLSERQVKIWFQNRRAKERKDNKKK  261 (317)
T ss_pred             HHHHHhhCccHhhhhHhhhhhhHHHHHHHHHH
Confidence            58999999999999999999999999986654


No 4  
>KOG0850|consensus
Probab=99.59  E-value=5e-16  Score=98.38  Aligned_cols=36  Identities=42%  Similarity=0.473  Sum_probs=32.3

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHHhhhhcc
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKEHKMASM   37 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~~~~~~~   37 (61)
                      |=+|||+.||||.+||||||||||.|.||..+.+..
T Consensus       151 ERAeLAAsLGLTQTQVKIWFQNrRSK~KKl~k~g~~  186 (245)
T KOG0850|consen  151 ERAELAASLGLTQTQVKIWFQNRRSKFKKLKKQGSG  186 (245)
T ss_pred             HHHHHHHHhCCchhHhhhhhhhhHHHHHHHHhcCCC
Confidence            568999999999999999999999999999885443


No 5  
>KOG0488|consensus
Probab=99.59  E-value=4.7e-16  Score=101.97  Aligned_cols=31  Identities=39%  Similarity=0.678  Sum_probs=29.0

Q ss_pred             hhhhcCCCCCccceeeccccchhHHHHHhhh
Q psy12003          4 LRDKNPPRGTERQIKIWFQNRRMKWKKEHKM   34 (61)
Q Consensus         4 ~eLA~~l~Lte~~VqvWFqNrRak~kr~~~~   34 (61)
                      ++||+.||||++|||+||||||+||||+...
T Consensus       203 ~~LA~~LgLTdaQVKtWfQNRRtKWKrq~a~  233 (309)
T KOG0488|consen  203 IELAASLGLTDAQVKTWFQNRRTKWKRQTAE  233 (309)
T ss_pred             HHHHHHcCCchhhHHHHHhhhhHHHHHHHHh
Confidence            6899999999999999999999999999654


No 6  
>KOG0844|consensus
Probab=99.58  E-value=8.3e-17  Score=105.79  Aligned_cols=34  Identities=35%  Similarity=0.453  Sum_probs=30.3

Q ss_pred             hhhhcCCCCCccceeeccccchhHHHHHhhhhcc
Q psy12003          4 LRDKNPPRGTERQIKIWFQNRRMKWKKEHKMASM   37 (61)
Q Consensus         4 ~eLA~~l~Lte~~VqvWFqNrRak~kr~~~~~~~   37 (61)
                      -|||.+|||+|++|||||||||+|.|||.....+
T Consensus       212 cELAAaLNLPEtTIKVWFQNRRMKDKRQRlamaW  245 (408)
T KOG0844|consen  212 CELAAALNLPETTIKVWFQNRRMKDKRQRLAMAW  245 (408)
T ss_pred             hhHHHhhCCCcceeehhhhhchhhhhhhhhhccC
Confidence            3899999999999999999999999999765444


No 7  
>KOG0842|consensus
Probab=99.57  E-value=1.1e-15  Score=100.19  Aligned_cols=40  Identities=35%  Similarity=0.474  Sum_probs=34.6

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHHhhhhccCccC
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKEHKMASMNVIP   41 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~~~~~~~~~~~   41 (61)
                      |=.+||..|+||++||||||||||.|.||++..+......
T Consensus       182 ERE~LA~~LrLT~TQVKIWFQNrRYK~KR~~~dk~~~~~~  221 (307)
T KOG0842|consen  182 EREHLASSLRLTPTQVKIWFQNRRYKTKRQQKDKALEALL  221 (307)
T ss_pred             hHHHHHHhcCCCchheeeeeecchhhhhhhhhhhhhhccc
Confidence            3468999999999999999999999999998877665533


No 8  
>KOG0485|consensus
Probab=99.50  E-value=2.7e-15  Score=94.96  Aligned_cols=32  Identities=44%  Similarity=0.659  Sum_probs=28.9

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHHhh
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKEHK   33 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~~~   33 (61)
                      |=+.||++|.|||+||||||||||.||||+-.
T Consensus       133 eRa~LA~sLqLTETQVKIWFQNRRnKwKRq~a  164 (268)
T KOG0485|consen  133 ERAGLAASLQLTETQVKIWFQNRRNKWKRQYA  164 (268)
T ss_pred             HHhHHHHhhhhhhhhhhhhhhhhhHHHHHHHh
Confidence            44679999999999999999999999999944


No 9  
>KOG0484|consensus
Probab=99.50  E-value=2.4e-15  Score=86.15  Aligned_cols=32  Identities=34%  Similarity=0.551  Sum_probs=29.4

Q ss_pred             hhhhcCCCCCccceeeccccchhHHHHHhhhh
Q psy12003          4 LRDKNPPRGTERQIKIWFQNRRMKWKKEHKMA   35 (61)
Q Consensus         4 ~eLA~~l~Lte~~VqvWFqNrRak~kr~~~~~   35 (61)
                      .|||.+++|||.+|||||||||+|.||+++..
T Consensus        48 EEiA~kidLTEARVQVWFQNRRAKfRKQEr~a   79 (125)
T KOG0484|consen   48 EEIALKIDLTEARVQVWFQNRRAKFRKQERAA   79 (125)
T ss_pred             HHHHHhhhhhHHHHHHHHHhhHHHHHHHHHHH
Confidence            58999999999999999999999999997743


No 10 
>KOG0843|consensus
Probab=99.47  E-value=9.7e-15  Score=89.96  Aligned_cols=33  Identities=33%  Similarity=0.490  Sum_probs=29.9

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHHhhh
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKEHKM   34 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~~~~   34 (61)
                      |=.+||+.|+|+|+||||||||||.|.||....
T Consensus       131 eR~~LA~~L~LsetQVkvWFQNRRtk~kr~~~e  163 (197)
T KOG0843|consen  131 ERKQLAQSLSLSETQVKVWFQNRRTKHKRMQQE  163 (197)
T ss_pred             HHHHHHHHcCCChhHhhhhhhhhhHHHHHHHHH
Confidence            446899999999999999999999999998664


No 11 
>KOG0492|consensus
Probab=99.47  E-value=1.3e-14  Score=91.25  Aligned_cols=33  Identities=39%  Similarity=0.488  Sum_probs=30.0

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHHhhh
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKEHKM   34 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~~~~   34 (61)
                      |=+|++..|.|||+||||||||||+|.||.+..
T Consensus       173 EraefSsSL~LTeTqVKIWFQNRRAKaKRlQea  205 (246)
T KOG0492|consen  173 ERAEFSSSLELTETQVKIWFQNRRAKAKRLQEA  205 (246)
T ss_pred             HHHhhhhhhhhhhhheehhhhhhhHHHHHHHHH
Confidence            457899999999999999999999999998663


No 12 
>KOG0491|consensus
Probab=99.45  E-value=2e-14  Score=87.76  Aligned_cols=35  Identities=40%  Similarity=0.545  Sum_probs=32.2

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHHhhhhc
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKEHKMAS   36 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~~~~~~   36 (61)
                      |+.|||..|+|+|+|||.||||||+|.||+.+...
T Consensus       129 e~~ELan~L~LS~~QVKTWFQNrRMK~Kk~~r~~~  163 (194)
T KOG0491|consen  129 ERQELANALSLSETQVKTWFQNRRMKHKKQQRNNQ  163 (194)
T ss_pred             HHHHHHHHhhhhHHHHHHHHHHHHHHHHHHHhccC
Confidence            67899999999999999999999999999987544


No 13 
>KOG0483|consensus
Probab=99.39  E-value=2.7e-14  Score=89.07  Aligned_cols=32  Identities=31%  Similarity=0.590  Sum_probs=28.7

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHHhh
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKEHK   33 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~~~   33 (61)
                      +...||..|||.++||.||||||||+||.++.
T Consensus        79 ~K~~LAk~LgL~pRQVavWFQNRRARwK~kql  110 (198)
T KOG0483|consen   79 RKKKLAKELGLQPRQVAVWFQNRRARWKTKQL  110 (198)
T ss_pred             HHHHHHHhhCCChhHHHHHHhhccccccchhh
Confidence            34689999999999999999999999998843


No 14 
>KOG2251|consensus
Probab=99.39  E-value=1.8e-13  Score=86.32  Aligned_cols=32  Identities=22%  Similarity=0.437  Sum_probs=29.8

Q ss_pred             hhhhcCCCCCccceeeccccchhHHHHHhhhh
Q psy12003          4 LRDKNPPRGTERQIKIWFQNRRMKWKKEHKMA   35 (61)
Q Consensus         4 ~eLA~~l~Lte~~VqvWFqNrRak~kr~~~~~   35 (61)
                      .|||.+|||+|.+|||||+|||+|+|++++..
T Consensus        68 EelAlklnLpeSrVqVWFKNRRAK~r~qq~qq   99 (228)
T KOG2251|consen   68 EELALKLNLPESRVQVWFKNRRAKCRRQQQQQ   99 (228)
T ss_pred             HHHHHHhCCchhhhhhhhccccchhhHhhhhh
Confidence            58999999999999999999999999998864


No 15 
>KOG0494|consensus
Probab=99.34  E-value=1.9e-13  Score=88.48  Aligned_cols=32  Identities=38%  Similarity=0.642  Sum_probs=28.7

Q ss_pred             hhcCCCCCccceeeccccchhHHHHHhhhhcc
Q psy12003          6 DKNPPRGTERQIKIWFQNRRMKWKKEHKMASM   37 (61)
Q Consensus         6 LA~~l~Lte~~VqvWFqNrRak~kr~~~~~~~   37 (61)
                      ||.++.|+|.+|+|||||||+||||.++.-..
T Consensus       174 la~ktelpEDRIqVWfQNRRAKWRk~Ek~wg~  205 (332)
T KOG0494|consen  174 LADKTELPEDRIQVWFQNRRAKWRKTEKRWGG  205 (332)
T ss_pred             HhhhccCchhhhhHHhhhhhHHhhhhhhhcCc
Confidence            68899999999999999999999999886443


No 16 
>KOG0847|consensus
Probab=99.27  E-value=7.9e-13  Score=84.07  Aligned_cols=32  Identities=44%  Similarity=0.783  Sum_probs=29.4

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHHhh
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKEHK   33 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~~~   33 (61)
                      |-++||..+|++|.+|+|||||||.||||+..
T Consensus       196 ~ra~lA~~lgmteSqvkVWFQNRRTKWRKkhA  227 (288)
T KOG0847|consen  196 DRAQLAQELNMTESQVKVWFQNRRTKWRKKHA  227 (288)
T ss_pred             hHHHhhccccccHHHHHHHHhcchhhhhhhhc
Confidence            45789999999999999999999999999854


No 17 
>KOG4577|consensus
Probab=99.17  E-value=7.4e-12  Score=82.19  Aligned_cols=34  Identities=32%  Similarity=0.385  Sum_probs=29.8

Q ss_pred             hhhhcCCCCCccceeeccccchhHHHHHhhhhcc
Q psy12003          4 LRDKNPPRGTERQIKIWFQNRRMKWKKEHKMASM   37 (61)
Q Consensus         4 ~eLA~~l~Lte~~VqvWFqNrRak~kr~~~~~~~   37 (61)
                      ..|+.++||+.++|||||||||||.||..+..+.
T Consensus       198 EQLsseTGLDMRVVQVWFQNRRAKEKRLKKDAGR  231 (383)
T KOG4577|consen  198 EQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGR  231 (383)
T ss_pred             HHhhhccCcceeehhhhhhhhhHHHHhhhhhcch
Confidence            3689999999999999999999999999775443


No 18 
>PF00046 Homeobox:  Homeobox domain not present here.;  InterPro: IPR001356 The homeobox domain was first identified in a number of drosophila homeotic and segmentation proteins, but is now known to be well-conserved in many other animals, including vertebrates [, , ]. Hox genes encode homeodomain-containing transcriptional regulators that operate differential genetic programs along the anterior-posterior axis of animal bodies []. The domain binds DNA through a helix-turn-helix (HTH) structure. The HTH motif is characterised by two alpha-helices, which make intimate contacts with the DNA and are joined by a short turn. The second helix binds to DNA via a number of hydrogen bonds and hydrophobic interactions, which occur between specific side chains and the exposed bases and thymine methyl groups within the major groove of the DNA []. The first helix helps to stabilise the structure. The motif is very similar in sequence and structure in a wide range of DNA-binding proteins (e.g., cro and repressor proteins, homeotic proteins, etc.). One of the principal differences between HTH motifs in these different proteins arises from the stereo-chemical requirement for glycine in the turn which is needed to avoid steric interference of the beta-carbon with the main chain: for cro and repressor proteins the glycine appears to be mandatory, while for many of the homeotic and other DNA-binding proteins the requirement is relaxed.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2DA3_A 1LFB_A 2LFB_A 2ECB_A 2DA5_A 3D1N_O 3A03_A 2XSD_C 3CMY_A 1AHD_P ....
Probab=99.16  E-value=1.2e-12  Score=66.48  Aligned_cols=29  Identities=48%  Similarity=0.486  Sum_probs=27.3

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKK   30 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr   30 (61)
                      ++.+||..|||++.+|++||+|||.++|+
T Consensus        29 ~~~~la~~l~l~~~~V~~WF~nrR~k~kk   57 (57)
T PF00046_consen   29 EREELAKELGLTERQVKNWFQNRRRKEKK   57 (57)
T ss_dssp             HHHHHHHHHTSSHHHHHHHHHHHHHHHHH
T ss_pred             ccccccccccccccccccCHHHhHHHhCc
Confidence            57899999999999999999999999986


No 19 
>KOG0493|consensus
Probab=99.07  E-value=1.8e-11  Score=79.53  Aligned_cols=30  Identities=43%  Similarity=0.509  Sum_probs=27.3

Q ss_pred             hhhhcCCCCCccceeeccccchhHHHHHhh
Q psy12003          4 LRDKNPPRGTERQIKIWFQNRRMKWKKEHK   33 (61)
Q Consensus         4 ~eLA~~l~Lte~~VqvWFqNrRak~kr~~~   33 (61)
                      .+||.+|+|.|.||||||||+|+|.||--.
T Consensus       277 Q~La~ELgLNEsQIKIWFQNKRAKiKKsTg  306 (342)
T KOG0493|consen  277 QELAQELGLNESQIKIWFQNKRAKIKKSTG  306 (342)
T ss_pred             HHHHHHhCcCHHHhhHHhhhhhhhhhhccC
Confidence            479999999999999999999999998644


No 20 
>KOG0486|consensus
Probab=99.06  E-value=7.4e-11  Score=77.81  Aligned_cols=33  Identities=30%  Similarity=0.585  Sum_probs=30.0

Q ss_pred             hhhhcCCCCCccceeeccccchhHHHHHhhhhc
Q psy12003          4 LRDKNPPRGTERQIKIWFQNRRMKWKKEHKMAS   36 (61)
Q Consensus         4 ~eLA~~l~Lte~~VqvWFqNrRak~kr~~~~~~   36 (61)
                      .|||..++|||.+|+|||.|||+||||.++...
T Consensus       143 EEIavwtNlTE~rvrvwfknrrakwrkrErN~~  175 (351)
T KOG0486|consen  143 EEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQ  175 (351)
T ss_pred             hHHHhhccccchhhhhhcccchhhhhhhhhhHH
Confidence            488999999999999999999999999987544


No 21 
>KOG3802|consensus
Probab=99.00  E-value=1.6e-10  Score=77.89  Aligned_cols=32  Identities=22%  Similarity=0.376  Sum_probs=30.8

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHHhh
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKEHK   33 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~~~   33 (61)
                      ||.+||.+|+|...+|+|||+|||.|.||...
T Consensus       323 EIt~iA~~L~leKEVVRVWFCNRRQkeKR~~~  354 (398)
T KOG3802|consen  323 EITHIAESLQLEKEVVRVWFCNRRQKEKRITP  354 (398)
T ss_pred             HHHHHHHHhccccceEEEEeeccccccccCCC
Confidence            89999999999999999999999999999876


No 22 
>cd00086 homeodomain Homeodomain;  DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner.
Probab=98.99  E-value=2e-11  Score=61.79  Aligned_cols=30  Identities=47%  Similarity=0.593  Sum_probs=27.7

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKE   31 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~   31 (61)
                      ++.+||..+||++.+|++||+|||.+.++.
T Consensus        29 ~~~~la~~~~l~~~qV~~WF~nrR~~~~~~   58 (59)
T cd00086          29 EREELAKELGLTERQVKIWFQNRRAKLKRS   58 (59)
T ss_pred             HHHHHHHHHCcCHHHHHHHHHHHHHHHhcc
Confidence            678999999999999999999999998763


No 23 
>COG5576 Homeodomain-containing transcription factor [Transcription]
Probab=98.97  E-value=1.4e-10  Score=70.21  Aligned_cols=32  Identities=28%  Similarity=0.395  Sum_probs=28.8

Q ss_pred             hhhhhcCCCCCccceeeccccchhHHHHHhhh
Q psy12003          3 LLRDKNPPRGTERQIKIWFQNRRMKWKKEHKM   34 (61)
Q Consensus         3 ~~eLA~~l~Lte~~VqvWFqNrRak~kr~~~~   34 (61)
                      -.+|+..||++++-|||||||||++.|+....
T Consensus        81 r~~L~~~lnm~~ksVqIWFQNkR~~~k~~~~~  112 (156)
T COG5576          81 RIKLSLLLNMPPKSVQIWFQNKRAKEKKKRSG  112 (156)
T ss_pred             HHHHHHhcCCChhhhhhhhchHHHHHHHhccc
Confidence            35799999999999999999999999998654


No 24 
>KOG0490|consensus
Probab=98.94  E-value=5.4e-10  Score=69.11  Aligned_cols=30  Identities=37%  Similarity=0.512  Sum_probs=27.9

Q ss_pred             hhhhcCCCCCccceeeccccchhHHHHHhh
Q psy12003          4 LRDKNPPRGTERQIKIWFQNRRMKWKKEHK   33 (61)
Q Consensus         4 ~eLA~~l~Lte~~VqvWFqNrRak~kr~~~   33 (61)
                      .+||..++++|.+|||||||||+||+++..
T Consensus        91 ~~la~~~~~~e~rVqvwFqnrrak~r~~~~  120 (235)
T KOG0490|consen   91 ECLALLLTGDEFRVQVWFQNRRAKDRKEER  120 (235)
T ss_pred             HHHhhcCCCCeeeeehhhhhhcHhhhhhhc
Confidence            368999999999999999999999999875


No 25 
>smart00389 HOX Homeodomain. DNA-binding factors that are involved in the transcriptional regulation of key developmental processes
Probab=98.89  E-value=5.3e-11  Score=59.90  Aligned_cols=28  Identities=46%  Similarity=0.741  Sum_probs=25.6

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWK   29 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~k   29 (61)
                      ++.+||..+||+..+|+.||+|||++.+
T Consensus        29 ~~~~la~~~~l~~~qV~~WF~nrR~~~~   56 (56)
T smart00389       29 EREELAAKLGLSERQVKVWFQNRRAKWK   56 (56)
T ss_pred             HHHHHHHHHCcCHHHHHHhHHHHhhccC
Confidence            5789999999999999999999998753


No 26 
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class. This model represents a class of homoebox domain that differs substantially from the typical homoebox domain described in pfam model pfam00046. It is found in both C4 and C3 plants.
Probab=98.82  E-value=7.3e-10  Score=57.47  Aligned_cols=24  Identities=17%  Similarity=0.311  Sum_probs=22.1

Q ss_pred             chhhhhcCCCCCccceeeccccch
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRR   25 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrR   25 (61)
                      +..+||..|||++.+|||||||.+
T Consensus        34 ~r~~la~~lgl~~~vvKVWfqN~k   57 (58)
T TIGR01565        34 EVREFCEEIGVTRKVFKVWMHNNK   57 (58)
T ss_pred             HHHHHHHHhCCCHHHeeeecccCC
Confidence            578999999999999999999975


No 27 
>KOG0849|consensus
Probab=98.46  E-value=6.7e-08  Score=64.60  Aligned_cols=30  Identities=33%  Similarity=0.769  Sum_probs=28.3

Q ss_pred             hhhhcCCCCCccceeeccccchhHHHHHhh
Q psy12003          4 LRDKNPPRGTERQIKIWFQNRRMKWKKEHK   33 (61)
Q Consensus         4 ~eLA~~l~Lte~~VqvWFqNrRak~kr~~~   33 (61)
                      .+||.+++|+|.+|+|||+|||++|+|+..
T Consensus       207 e~La~~i~l~e~riqvwf~nrra~~rr~~~  236 (354)
T KOG0849|consen  207 ETLAKETGLPEPRVQVWFQNRRAKWRRQHR  236 (354)
T ss_pred             HHHhhhccCCchHHHHHHhhhhhhhhhccc
Confidence            579999999999999999999999999984


No 28 
>KOG0775|consensus
Probab=98.23  E-value=6.7e-07  Score=58.47  Aligned_cols=31  Identities=23%  Similarity=0.258  Sum_probs=27.2

Q ss_pred             hhhhhcCCCCCccceeeccccchhHHHHHhh
Q psy12003          3 LLRDKNPPRGTERQIKIWFQNRRMKWKKEHK   33 (61)
Q Consensus         3 ~~eLA~~l~Lte~~VqvWFqNrRak~kr~~~   33 (61)
                      =-|||.++||+.+||-.||+|||.+.|-...
T Consensus       206 KReLA~aTgLt~tQVsNWFKNRRQRDRa~~a  236 (304)
T KOG0775|consen  206 KRELAEATGLTITQVSNWFKNRRQRDRAAAA  236 (304)
T ss_pred             HHHHHHHhCCchhhhhhhhhhhhhhhhhccc
Confidence            3589999999999999999999999985433


No 29 
>KOG1168|consensus
Probab=98.17  E-value=7.8e-07  Score=58.88  Aligned_cols=34  Identities=21%  Similarity=0.358  Sum_probs=30.4

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHHhhhh
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKEHKMA   35 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~~~~~   35 (61)
                      .|+-+|.+|+|...+|+|||+|.|.|.||.....
T Consensus       338 kIAaIAekLDLKKNVVRVWFCNQRQKQKRm~~Sa  371 (385)
T KOG1168|consen  338 KIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKRSA  371 (385)
T ss_pred             HHHHHHHhhhhhhceEEEEeeccHHHHHHhhhhh
Confidence            4788999999999999999999999999976543


No 30 
>PF05920 Homeobox_KN:  Homeobox KN domain;  InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 3K2A_B 2LK2_A 1X2N_A 2DMN_A.
Probab=97.75  E-value=8.9e-07  Score=42.70  Aligned_cols=26  Identities=23%  Similarity=0.311  Sum_probs=22.6

Q ss_pred             chhhhhcCCCCCccceeeccccchhH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMK   27 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak   27 (61)
                      |..+||..+||+..||..||-|.|.+
T Consensus        15 ek~~L~~~tgls~~Qi~~WF~NaRrR   40 (40)
T PF05920_consen   15 EKEELAKQTGLSRKQISNWFINARRR   40 (40)
T ss_dssp             HHHHHHHHHTS-HHHHHHHHHHHHHH
T ss_pred             HHHHHHHHcCCCHHHHHHHHHHhHcc
Confidence            56789999999999999999998864


No 31 
>KOG0490|consensus
Probab=97.41  E-value=5.1e-05  Score=46.84  Aligned_cols=30  Identities=37%  Similarity=0.609  Sum_probs=27.5

Q ss_pred             hhhhcCCCCCccceeeccccchhHHHHHhh
Q psy12003          4 LRDKNPPRGTERQIKIWFQNRRMKWKKEHK   33 (61)
Q Consensus         4 ~eLA~~l~Lte~~VqvWFqNrRak~kr~~~   33 (61)
                      .+|+..+++++..|+|||||+|++.++...
T Consensus       184 ~~l~~~~~~~~~~~q~~~~~~~~~~~~~~~  213 (235)
T KOG0490|consen  184 EQLAEETGLSERVIQVWFQNRRAKLRKHKR  213 (235)
T ss_pred             HHHHHhcCCChhhhhhhcccHHHHHHhhcc
Confidence            578999999999999999999999998765


No 32 
>KOG0774|consensus
Probab=96.46  E-value=0.0024  Score=42.06  Aligned_cols=30  Identities=27%  Similarity=0.386  Sum_probs=27.6

Q ss_pred             hhhhhcCCCCCccceeeccccchhHHHHHh
Q psy12003          3 LLRDKNPPRGTERQIKIWFQNRRMKWKKEH   32 (61)
Q Consensus         3 ~~eLA~~l~Lte~~VqvWFqNrRak~kr~~   32 (61)
                      =.|||.+.|++-.||-.||.|.|-++||..
T Consensus       221 K~eLAkqCnItvsQvsnwfgnkrIrykK~~  250 (334)
T KOG0774|consen  221 KEELAKQCNITVSQVSNWFGNKRIRYKKNM  250 (334)
T ss_pred             HHHHHHHcCceehhhccccccceeehhhhh
Confidence            368999999999999999999999999873


No 33 
>KOG1146|consensus
Probab=95.86  E-value=0.0059  Score=46.96  Aligned_cols=34  Identities=32%  Similarity=0.389  Sum_probs=29.2

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHHhhhh
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKEHKMA   35 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~~~~~   35 (61)
                      ++..|-..++|+.+.|+|||||-|+|.++.....
T Consensus       932 ~~E~l~~~~~~~~~~i~vw~qna~~~s~k~~~n~  965 (1406)
T KOG1146|consen  932 ECEVLEEPIGLPKRVIQVWFQNARAKSKKAKLNG  965 (1406)
T ss_pred             HHHhhcccccCCcchhHHhhhhhhhhhhhhhhcc
Confidence            4667788899999999999999999999986633


No 34 
>PF10668 Phage_terminase:  Phage terminase small subunit;  InterPro: IPR018925  This entry describes the terminase small subunit from Enterococcus phage phiFL1A, related proteins in other bacteriophage, and prophage regions of bacterial genomes. Packaging of double-stranded viral DNA concatemers requires interaction of the prohead with virus DNA. This process is mediated by a phage-encoded DNA recognition and terminase protein. The terminase enzymes described so far, which are hetero-oligomers composed of a small and a large subunit, do not have a significant level of sequence homology. The small terminase subunit is thought to form a nucleoprotein structure that helps to position the terminase large subunit at the packaging initiation site [].
Probab=94.54  E-value=0.0048  Score=32.12  Aligned_cols=28  Identities=25%  Similarity=0.471  Sum_probs=21.6

Q ss_pred             CchhhhhcCCCCCccceeeccccchhHHHH
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQNRRMKWKK   30 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFqNrRak~kr   30 (61)
                      |.+.+||.+||+++.+|+.|  -.+.+|..
T Consensus        23 i~lkdIA~~Lgvs~~tIr~W--K~~dkW~~   50 (60)
T PF10668_consen   23 IKLKDIAEKLGVSESTIRKW--KSRDKWDE   50 (60)
T ss_pred             ccHHHHHHHHCCCHHHHHHH--hhhcchhh
Confidence            45789999999999999998  33444544


No 35 
>KOG3623|consensus
Probab=94.14  E-value=0.012  Score=43.46  Aligned_cols=33  Identities=12%  Similarity=0.152  Sum_probs=29.5

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHHhhh
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKEHKM   34 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~~~~   34 (61)
                      ||..+|.+.||+...|++||++++++...-++.
T Consensus       585 elskia~qvglp~~vvk~wfE~~~a~e~sv~rs  617 (1007)
T KOG3623|consen  585 ELSKIAQQVGLPFAVVKAWFEDEEAEEMSVERS  617 (1007)
T ss_pred             HHHHHHHHhcccHHHHHHHHHhhhhhhhhhccC
Confidence            688899999999999999999999998876653


No 36 
>PF11569 Homez:  Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A.
Probab=93.87  E-value=0.0049  Score=31.72  Aligned_cols=24  Identities=25%  Similarity=0.403  Sum_probs=18.8

Q ss_pred             chhhhhcCCCCCccceeeccccch
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRR   25 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrR   25 (61)
                      .|-+|..+.+|+..+|+.||-.|.
T Consensus        27 DL~~L~~kS~ms~qqVr~WFa~~~   50 (56)
T PF11569_consen   27 DLDELCDKSRMSYQQVRDWFAERM   50 (56)
T ss_dssp             HHHHHHHHTT--HHHHHHHHHHHS
T ss_pred             hHHHHHHHHCCCHHHHHHHHHHhc
Confidence            477899999999999999997553


No 37 
>KOG0773|consensus
Probab=92.06  E-value=0.051  Score=35.90  Aligned_cols=28  Identities=21%  Similarity=0.264  Sum_probs=24.3

Q ss_pred             hhhcCCCCCccceeeccccchhHHHHHh
Q psy12003          5 RDKNPPRGTERQIKIWFQNRRMKWKKEH   32 (61)
Q Consensus         5 eLA~~l~Lte~~VqvWFqNrRak~kr~~   32 (61)
                      .||.++||+-.+|-.||-|.|-+..+..
T Consensus       274 ~La~~TGLs~~Qv~NWFINaR~R~w~p~  301 (342)
T KOG0773|consen  274 MLAKQTGLSRPQVSNWFINARVRLWKPM  301 (342)
T ss_pred             ccchhcCCCcccCCchhhhcccccCCch
Confidence            5899999999999999999988765543


No 38 
>cd04761 HTH_MerR-SF Helix-Turn-Helix DNA binding domain of transcription regulators from the MerR superfamily. Helix-turn-helix (HTH) transcription regulator MerR superfamily, N-terminal domain. The MerR family transcription regulators have been shown to mediate responses to stress including exposure to heavy metals, drugs, or oxygen radicals in eubacterial and some archaeal species. They regulate transcription of multidrug/metal ion transporter genes and oxidative stress regulons by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.
Probab=89.94  E-value=0.035  Score=26.43  Aligned_cols=24  Identities=0%  Similarity=-0.101  Sum_probs=20.2

Q ss_pred             CchhhhhcCCCCCccceeeccccc
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQNR   24 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFqNr   24 (61)
                      |-+.|+|..+|+++.+|+.|.++.
T Consensus         1 ~~~~e~a~~~gv~~~tlr~~~~~g   24 (49)
T cd04761           1 YTIGELAKLTGVSPSTLRYYERIG   24 (49)
T ss_pred             CcHHHHHHHHCcCHHHHHHHHHCC
Confidence            457899999999999999996543


No 39 
>PF13411 MerR_1:  MerR HTH family regulatory protein; PDB: 2JML_A 3GP4_A 3GPV_B.
Probab=87.48  E-value=0.058  Score=27.50  Aligned_cols=21  Identities=0%  Similarity=-0.064  Sum_probs=18.6

Q ss_pred             CchhhhhcCCCCCccceeecc
Q psy12003          1 MNLLRDKNPPRGTERQIKIWF   21 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWF   21 (61)
                      |.+.|+|..+|++..+|+.|-
T Consensus         1 yti~eva~~~gvs~~tlr~y~   21 (69)
T PF13411_consen    1 YTIKEVAKLLGVSPSTLRYYE   21 (69)
T ss_dssp             EEHHHHHHHTTTTHHHHHHHH
T ss_pred             CcHHHHHHHHCcCHHHHHHHH
Confidence            467899999999999999983


No 40 
>COG5484 Uncharacterized conserved protein [Function unknown]
Probab=86.28  E-value=0.1  Score=34.30  Aligned_cols=27  Identities=30%  Similarity=0.464  Sum_probs=23.8

Q ss_pred             CchhhhhcCCCCCccceeeccccchhHHH
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQNRRMKWK   29 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFqNrRak~k   29 (61)
                      |-+.+||.++|+++.+|+-|  -||..|.
T Consensus        20 mk~~dIAeklGvspntiksW--Krr~gWs   46 (279)
T COG5484          20 MKLKDIAEKLGVSPNTIKSW--KRRDGWS   46 (279)
T ss_pred             ccHHHHHHHhCCChHHHHHH--HHhcCCC
Confidence            66899999999999999999  5688883


No 41 
>PF06056 Terminase_5:  Putative ATPase subunit of terminase (gpP-like);  InterPro: IPR010332 This family of proteins are annotated as ATPase subunits of phage terminase after []. Terminases are viral proteins that are involved in packaging viral DNA into the capsid.; GO: 0005524 ATP binding, 0019069 viral capsid assembly
Probab=85.86  E-value=0.11  Score=26.64  Aligned_cols=28  Identities=14%  Similarity=0.284  Sum_probs=21.7

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKE   31 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~   31 (61)
                      -+.|+|..||++..+|.-|-+  |.+|...
T Consensus        15 ~~~eIA~~Lg~~~~TV~~W~~--r~~W~~~   42 (58)
T PF06056_consen   15 SIKEIAEELGVPRSTVYSWKD--RYKWDEL   42 (58)
T ss_pred             CHHHHHHHHCCChHHHHHHHH--hhCcccc
Confidence            468999999999999999943  5555443


No 42 
>cd04762 HTH_MerR-trunc Helix-Turn-Helix DNA binding domain of truncated MerR-like proteins. Proteins in this family mostly have a truncated helix-turn-helix (HTH) MerR-like domain. They lack a portion of the C-terminal region, called Wing 2 and the long dimerization helix that is typically present in MerR-like proteins. These truncated domains are found in response regulator receiver (REC) domain proteins (i.e., CheY), cytosine-C5 specific DNA methylases, IS607 transposase-like proteins, and RacA, a bacterial protein that anchors chromosomes to cell poles.
Probab=85.57  E-value=0.094  Score=24.37  Aligned_cols=26  Identities=4%  Similarity=0.216  Sum_probs=21.4

Q ss_pred             CchhhhhcCCCCCccceeeccccchh
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQNRRM   26 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFqNrRa   26 (61)
                      +.+.|+|..+|++..+|.-|.++...
T Consensus         1 ~s~~e~a~~lgvs~~tl~~~~~~g~~   26 (49)
T cd04762           1 LTTKEAAELLGVSPSTLRRWVKEGKL   26 (49)
T ss_pred             CCHHHHHHHHCcCHHHHHHHHHcCCC
Confidence            45789999999999999999775543


No 43 
>KOG2252|consensus
Probab=83.10  E-value=0.18  Score=36.05  Aligned_cols=25  Identities=12%  Similarity=-0.028  Sum_probs=21.9

Q ss_pred             hhhhcCCCCCccceeeccccchhHH
Q psy12003          4 LRDKNPPRGTERQIKIWFQNRRMKW   28 (61)
Q Consensus         4 ~eLA~~l~Lte~~VqvWFqNrRak~   28 (61)
                      .-|+.+|||.-++|..||-|-|.+.
T Consensus       451 ~tIS~qL~L~~sTV~NfFmNaRRRs  475 (558)
T KOG2252|consen  451 ETISQQLNLELSTVINFFMNARRRS  475 (558)
T ss_pred             HHHHHHhCCcHHHHHHHHHhhhhhc
Confidence            3579999999999999999987764


No 44 
>TIGR03879 near_KaiC_dom probable regulatory domain. This model describes a common domain shared by two different families of proteins, each of which occurs regularly next to its corresponding partner family, a probable regulatory with homology to KaiC. By implication, this protein family likely is also involved in sensory transduction and/or regulation.
Probab=82.04  E-value=0.19  Score=27.04  Aligned_cols=23  Identities=9%  Similarity=0.029  Sum_probs=19.8

Q ss_pred             CchhhhhcCCCCCccceeecccc
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQN   23 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFqN   23 (61)
                      |...|+|..+|+|+..|+.|+.+
T Consensus        33 lS~kEIAe~LGIS~~TVk~~l~~   55 (73)
T TIGR03879        33 KTASEIAEELGRTEQTVRNHLKG   55 (73)
T ss_pred             CCHHHHHHHHCcCHHHHHHHHhc
Confidence            34679999999999999998774


No 45 
>PF08281 Sigma70_r4_2:  Sigma-70, region 4;  InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. RNA polymerase recruits alternative sigma factors as a means of switching on specific regulons. Most bacteria express a multiplicity of sigma factors. Two of these factors, sigma-70 (gene rpoD), generally known as the major or primary sigma factor, and sigma-54 (gene rpoN or ntrA) direct the transcription of a wide variety of genes. The other sigma factors, known as alternative sigma factors, are required for the transcription of specific subsets of genes.  With regard to sequence similarity, sigma factors can be grouped into two classes, the sigma-54 and sigma-70 families. Sequence alignments of the sigma70 family members reveal four conserved regions that can be further divided into subregions eg. sub-region 2.2, which may be involved in the binding of the sigma factor to the core RNA polymerase; and sub-region 4.2, which seems to harbor a DNA-binding 'helix-turn-helix' motif involved in binding the conserved -35 region of promoters recognised by the major sigma factors [, ].  Region 4 of sigma-70 like sigma-factors are involved in binding to the -35 promoter element via a helix-turn-helix motif [].; GO: 0003677 DNA binding, 0003700 sequence-specific DNA binding transcription factor activity, 0016987 sigma factor activity, 0006352 transcription initiation, DNA-dependent, 0006355 regulation of transcription, DNA-dependent; PDB: 2LFW_A 1OR7_B 2H27_D 2O8X_B.
Probab=81.88  E-value=0.13  Score=25.14  Aligned_cols=22  Identities=9%  Similarity=-0.037  Sum_probs=17.4

Q ss_pred             chhhhhcCCCCCccceeecccc
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQN   23 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqN   23 (61)
                      ...|+|..+|+++..|+.|.+.
T Consensus        28 s~~eIa~~l~~s~~~v~~~l~r   49 (54)
T PF08281_consen   28 SYAEIAEILGISESTVKRRLRR   49 (54)
T ss_dssp             -HHHHHHHCTS-HHHHHHHHHH
T ss_pred             CHHHHHHHHCcCHHHHHHHHHH
Confidence            4679999999999999988763


No 46 
>cd04763 HTH_MlrA-like Helix-Turn-Helix DNA binding domain of MlrA-like transcription regulators. Helix-turn-helix (HTH) transcription regulator MlrA (merR-like regulator A) and related proteins, N-terminal domain. The MlrA protein, also known as YehV, has been shown to control cell-cell aggregation by co-regulating the expression of curli and extracellular matrix production in Escherichia coli and Salmonella typhimurium. Its close homolog, CarA from Myxococcus xanthus, is involved in activation of the carotenoid biosynthesis genes by light. These proteins belong to the MerR superfamily of transcription regulators that promote expression of several stress regulon genes by reconfiguring the spacer between the -35 and -10 promoter elements. Their conserved N-terminal domains contain predicted HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules. Many MlrA-like proteins in this group appear to lack the long dimerization helix seen
Probab=80.88  E-value=0.19  Score=25.74  Aligned_cols=22  Identities=5%  Similarity=0.007  Sum_probs=19.1

Q ss_pred             CchhhhhcCCCCCccceeeccc
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      +.+.|+|+.+|++..+++-|.+
T Consensus         1 ~~i~e~A~~~gVs~~tlr~ye~   22 (68)
T cd04763           1 YTIGEVALLTGIKPHVLRAWER   22 (68)
T ss_pred             CCHHHHHHHHCcCHHHHHHHHH
Confidence            3578999999999999998855


No 47 
>cd04764 HTH_MlrA-like_sg1 Helix-Turn-Helix DNA binding domain of putative MlrA-like transcription regulators. Putative helix-turn-helix (HTH) MlrA-like transcription regulators (subgroup 1). The MlrA protein, also known as YehV, has been shown to control cell-cell aggregation by co-regulating the expression of curli and extracellular matrix production in Escherichia coli and Salmonella typhimurium. These proteins belong to the MerR superfamily of transcription regulators that promote expression of several stress regulon genes by reconfiguring the spacer between the -35 and -10 promoter elements. Their conserved N-terminal domains contain predicted HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules. Many MlrA-like proteins in this group appear to lack the long dimerization helix seen in the N-terminal domains of typical MerR-like proteins.
Probab=80.41  E-value=0.24  Score=25.24  Aligned_cols=22  Identities=0%  Similarity=-0.047  Sum_probs=19.1

Q ss_pred             CchhhhhcCCCCCccceeeccc
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      +.+.|+|..+|++..+++-|-+
T Consensus         1 ~~i~evA~~~gvs~~tlR~~~~   22 (67)
T cd04764           1 YTIKEVSEIIGVKPHTLRYYEK   22 (67)
T ss_pred             CCHHHHHHHHCcCHHHHHHHHH
Confidence            4578999999999999998855


No 48 
>cd06171 Sigma70_r4 Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs). A SF is a dissociable subunit of RNA polymerase, it directs bacterial or plastid core RNA polymerase to specific promoter elements located upstream of transcription initiation points. The SR4 of Ec sigma70 and other essential primary SFs contact promoter sequences located 35 base-pairs upstream of the initiation point, recognizing a 6-base-pair -35 consensus TTGACA.  Sigma70 related SFs also include SFs which are dispensable for bacterial cell growth for example Ec sigmaS, SFs which activate regulons in response to a specific signal for example heat-shock Ec sigmaH, and a group of SFs which includes the extracytoplasmic function (ECF) SFs and is typified by Ec sigmaE which contains SR2 and -4 only. ECF SFs direct the transcription of genes that regulate various responses including periplas
Probab=79.02  E-value=0.14  Score=23.80  Aligned_cols=22  Identities=0%  Similarity=-0.114  Sum_probs=17.8

Q ss_pred             chhhhhcCCCCCccceeecccc
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQN   23 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqN   23 (61)
                      ...++|..+|+++.+|..|...
T Consensus        28 ~~~~ia~~~~~s~~~i~~~~~~   49 (55)
T cd06171          28 SYEEIAEILGISRSTVRQRLHR   49 (55)
T ss_pred             CHHHHHHHHCcCHHHHHHHHHH
Confidence            4578899999999999877654


No 49 
>PF13518 HTH_28:  Helix-turn-helix domain
Probab=78.71  E-value=0.25  Score=23.64  Aligned_cols=20  Identities=5%  Similarity=0.057  Sum_probs=17.8

Q ss_pred             hhhhhcCCCCCccceeeccc
Q psy12003          3 LLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         3 ~~eLA~~l~Lte~~VqvWFq   22 (61)
                      +.++|..+|++..+|.-|.+
T Consensus        15 ~~~~a~~~gis~~tv~~w~~   34 (52)
T PF13518_consen   15 VREIAREFGISRSTVYRWIK   34 (52)
T ss_pred             HHHHHHHHCCCHhHHHHHHH
Confidence            57899999999999999965


No 50 
>TIGR01764 excise DNA binding domain, excisionase family. An excisionase, or Xis protein, is a small protein that binds and promotes excisive recombination; it is not enzymatically active. This model represents a number of putative excisionases and related proteins from temperate phage, plasmids, and transposons, as well as DNA binding domains of other proteins, such as a DNA modification methylase. This model identifies mostly small proteins and N-terminal regions of large proteins, but some proteins appear to have two copies. This domain appears similar, in both sequence and predicted secondary structure (PSIPRED) to the MerR family of transcriptional regulators (pfam00376).
Probab=77.76  E-value=0.29  Score=22.74  Aligned_cols=25  Identities=0%  Similarity=-0.051  Sum_probs=20.4

Q ss_pred             CchhhhhcCCCCCccceeeccccch
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQNRR   25 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFqNrR   25 (61)
                      |.+.|+|..+|++.++|.-|.++.+
T Consensus         2 lt~~e~a~~lgis~~ti~~~~~~g~   26 (49)
T TIGR01764         2 LTVEEAAEYLGVSKDTVYRLIHEGE   26 (49)
T ss_pred             CCHHHHHHHHCCCHHHHHHHHHcCC
Confidence            4678999999999999988875543


No 51 
>PRK10072 putative transcriptional regulator; Provisional
Probab=77.55  E-value=0.41  Score=26.86  Aligned_cols=25  Identities=12%  Similarity=-0.016  Sum_probs=21.7

Q ss_pred             hhhhhcCCCCCccceeeccccchhH
Q psy12003          3 LLRDKNPPRGTERQIKIWFQNRRMK   27 (61)
Q Consensus         3 ~~eLA~~l~Lte~~VqvWFqNrRak   27 (61)
                      -.+||..+|++...|.-|.+.+|..
T Consensus        49 Q~elA~~lGvS~~TVs~WE~G~r~P   73 (96)
T PRK10072         49 IDDFARVLGVSVAMVKEWESRRVKP   73 (96)
T ss_pred             HHHHHHHhCCCHHHHHHHHcCCCCC
Confidence            4689999999999999999988754


No 52 
>PRK06759 RNA polymerase factor sigma-70; Validated
Probab=76.47  E-value=0.39  Score=27.61  Aligned_cols=26  Identities=8%  Similarity=-0.092  Sum_probs=20.5

Q ss_pred             CchhhhhcCCCCCccceeeccccchh
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQNRRM   26 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFqNrRa   26 (61)
                      +.+.|+|..+|+++.+|+.+...-+.
T Consensus       123 ~s~~EIA~~l~is~~tV~~~~~ra~~  148 (154)
T PRK06759        123 KTMGEIALETEMTYYQVRWIYRQALE  148 (154)
T ss_pred             CCHHHHHHHHCCCHHHHHHHHHHHHH
Confidence            35789999999999999987654333


No 53 
>PRK09646 RNA polymerase sigma factor SigK; Reviewed
Probab=76.07  E-value=0.59  Score=28.20  Aligned_cols=29  Identities=3%  Similarity=-0.004  Sum_probs=22.5

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKK   30 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr   30 (61)
                      ...|+|..||+++..|+++...-|.+-|+
T Consensus       160 s~~EIA~~Lgis~~tVk~~l~ra~~~Lr~  188 (194)
T PRK09646        160 TYREVAERLAVPLGTVKTRMRDGLIRLRD  188 (194)
T ss_pred             CHHHHHHHhCCChHhHHHHHHHHHHHHHH
Confidence            46799999999999999887655544444


No 54 
>cd04780 HTH_MerR-like_sg5 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily. Putative helix-turn-helix (HTH) MerR-like transcription regulators (subgroup 5), N-terminal domain. Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.
Probab=76.02  E-value=0.39  Score=26.55  Aligned_cols=21  Identities=14%  Similarity=0.151  Sum_probs=18.7

Q ss_pred             CchhhhhcCCCCCccceeecc
Q psy12003          1 MNLLRDKNPPRGTERQIKIWF   21 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWF   21 (61)
                      |.|.|+|..+|++..+|+-|=
T Consensus         1 m~I~eva~~~gvs~~tlR~Ye   21 (95)
T cd04780           1 MRMSELSKRSGVSVATIKYYL   21 (95)
T ss_pred             CCHHHHHHHHCcCHHHHHHHH
Confidence            678999999999999998873


No 55 
>PF08280 HTH_Mga:  M protein trans-acting positive regulator (MGA) HTH domain;  InterPro: IPR013199 Mga is a DNA-binding protein that activates the expression of several important virulence genes in group A streptococcus in response to changing environmental conditions [].; PDB: 2WTE_A 3SQN_A.
Probab=75.81  E-value=0.43  Score=24.07  Aligned_cols=17  Identities=29%  Similarity=0.180  Sum_probs=14.1

Q ss_pred             chhhhhcCCCCCcccee
Q psy12003          2 NLLRDKNPPRGTERQIK   18 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~Vq   18 (61)
                      .+.|||..+|+|+++|+
T Consensus        21 ~~~ela~~l~~S~rti~   37 (59)
T PF08280_consen   21 TLKELAKKLNISERTIK   37 (59)
T ss_dssp             BHHHHHHHCTS-HHHHH
T ss_pred             cHHHHHHHHCCCHHHHH
Confidence            57899999999999886


No 56 
>TIGR02985 Sig70_bacteroi1 RNA polymerase sigma-70 factor, Bacteroides expansion family 1. This group of sigma factors are members of the sigma-70 family (TIGR02937) and are found primarily in the genus Bacteroides. This family appears to have resulted from a lineage-specific expansion as B. thetaiotaomicron VPI-5482, Bacteroides forsythus ATCC 43037, Bacteroides fragilis YCH46 and Bacteroides fragilis NCTC 9343 contain 25, 12, 24 and 23 members, respectively. There are currentlyonly two known members of this family outside of the Bacteroides, in Rhodopseudomonas and Bradyrhizobium.
Probab=75.48  E-value=0.5  Score=26.92  Aligned_cols=26  Identities=0%  Similarity=-0.104  Sum_probs=20.0

Q ss_pred             chhhhhcCCCCCccceeeccccchhH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMK   27 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak   27 (61)
                      .+.|+|..+|+++..|+.+...=+.|
T Consensus       131 ~~~eIA~~lgis~~tv~~~~~ra~~~  156 (161)
T TIGR02985       131 SYKEIAEELGISVKTVEYHISKALKE  156 (161)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHHHHH
Confidence            46799999999999999765543333


No 57 
>PF13443 HTH_26:  Cro/C1-type HTH DNA-binding domain; PDB: 3TYR_A 3TYS_A 3B7H_A.
Probab=75.28  E-value=0.23  Score=24.80  Aligned_cols=27  Identities=0%  Similarity=-0.168  Sum_probs=18.4

Q ss_pred             chhhhhcCCCCCccceeeccccchhHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKW   28 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~   28 (61)
                      ...+||..+|+++.+|.-|+.++....
T Consensus        12 t~~~La~~~gis~~tl~~~~~~~~~~~   38 (63)
T PF13443_consen   12 TQKDLARKTGISRSTLSRILNGKPSNP   38 (63)
T ss_dssp             -HHHHHHHHT--HHHHHHHHTTT----
T ss_pred             CHHHHHHHHCcCHHHHHHHHhcccccc
Confidence            457899999999999999999884333


No 58 
>PF04218 CENP-B_N:  CENP-B N-terminal DNA-binding domain;  InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere. Within the N-terminal 125 residues, there is a DNA-binding region, which binds to a corresponding 17bp CENP-B box sequence. CENP-B dimers either bind two separate DNA molecules or alternatively, they may bind two CENP-B boxes on one DNA molecule, with the intervening stretch of DNA forming a loop structure. The CENP-B DNA-binding domain consists of two repeating domains, RP1 and RP2. This family corresponds to RP1 has been shown to consist of four helices in a helix-turn-helix structure [].; GO: 0003677 DNA binding, 0000775 chromosome, centromeric region; PDB: 1BW6_A 1HLV_A 2ELH_A.
Probab=74.76  E-value=0.26  Score=24.56  Aligned_cols=23  Identities=4%  Similarity=-0.068  Sum_probs=17.9

Q ss_pred             hhhhhcCCCCCccceeeccccch
Q psy12003          3 LLRDKNPPRGTERQIKIWFQNRR   25 (61)
Q Consensus         3 ~~eLA~~l~Lte~~VqvWFqNrR   25 (61)
                      ..+||..+|++.++|.-|..|+.
T Consensus        25 ~~~ia~~fgv~~sTv~~I~K~k~   47 (53)
T PF04218_consen   25 KRDIAREFGVSRSTVSTILKNKD   47 (53)
T ss_dssp             HHHHHHHHT--CCHHHHHHHCHH
T ss_pred             HHHHHHHhCCCHHHHHHHHHhHH
Confidence            46899999999999999988753


No 59 
>PRK12526 RNA polymerase sigma factor; Provisional
Probab=74.61  E-value=0.59  Score=28.59  Aligned_cols=30  Identities=10%  Similarity=-0.100  Sum_probs=23.3

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKE   31 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~   31 (61)
                      ...|+|..+|+++..|+++...-+.+-++.
T Consensus       171 s~~EIA~~lgis~~tV~~~l~Ra~~~Lr~~  200 (206)
T PRK12526        171 SQEQLAQQLNVPLGTVKSRLRLALAKLKVQ  200 (206)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHHHHHHHHH
Confidence            467999999999999998876555555544


No 60 
>TIGR02939 RpoE_Sigma70 RNA polymerase sigma factor RpoE. A sigma factor is a DNA-binding protein protein that binds to the DNA-directed RNA polymerase core to produce the holoenzyme capable of initiating transcription at specific sites. Different sigma factors act in vegetative growth, heat shock, extracytoplasmic functions (ECF), etc. This model represents the clade of sigma factors called RpoE. This protein may be called sigma-24, sigma-E factor, sigma-H factor, fecI-like sigma factor or alternative sigma factor AlgU.
Probab=74.37  E-value=0.55  Score=27.82  Aligned_cols=29  Identities=3%  Similarity=-0.200  Sum_probs=22.0

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKK   30 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr   30 (61)
                      ...|+|..+|+++..|+++...-|.+-|+
T Consensus       156 s~~EIA~~lgis~~tv~~~l~rar~~Lr~  184 (190)
T TIGR02939       156 SYEDIARIMDCPVGTVRSRIFRAREAIAI  184 (190)
T ss_pred             CHHHHHHHHCcCHHHHHHHHHHHHHHHHH
Confidence            46899999999999999887544444443


No 61 
>TIGR02947 SigH_actino RNA polymerase sigma-70 factor, TIGR02947 family. This group of sigma factors are members of the sigma-70 family (TIGR02937). They and appear by homology, tree building, bidirectional best hits and (with the exception of a paralog in Thermobifida fusca YX) one-to-a-genome distribution, to represent a conserved family. This family is restricted to the Actinobacteria and each gene examined is followed by an anti-sigma factor in an apparent operon.
Probab=74.20  E-value=0.67  Score=27.85  Aligned_cols=32  Identities=6%  Similarity=-0.037  Sum_probs=24.9

Q ss_pred             CchhhhhcCCCCCccceeeccccchhHHHHHh
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQNRRMKWKKEH   32 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFqNrRak~kr~~   32 (61)
                      |...|+|..||+++..|++...-=|.+-|+.-
T Consensus       148 ~s~~EIA~~lgis~~tVk~~l~Rar~~Lr~~l  179 (193)
T TIGR02947       148 FAYKEIAEIMGTPIGTVMSRLHRGRKQLRKQL  179 (193)
T ss_pred             CCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHH
Confidence            35689999999999999998775555555543


No 62 
>TIGR02937 sigma70-ECF RNA polymerase sigma factor, sigma-70 family. Several PFAM models hit segments of these sequences including Sigma-70 region 2 (pfam04542) and Sigma-70, region 4 (pfam04545), but not always above their respective trusted cutoffs.
Probab=73.96  E-value=0.59  Score=25.90  Aligned_cols=26  Identities=12%  Similarity=-0.047  Sum_probs=20.1

Q ss_pred             chhhhhcCCCCCccceeeccccchhH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMK   27 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak   27 (61)
                      .+.|+|..+|+++..|..+...-+.|
T Consensus       128 s~~eIA~~l~~s~~~v~~~~~~~~~k  153 (158)
T TIGR02937       128 SYKEIAEILGISVGTVKRRLKRARKK  153 (158)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHHHHH
Confidence            56899999999999998766544333


No 63 
>PRK12519 RNA polymerase sigma factor; Provisional
Probab=73.87  E-value=0.68  Score=27.74  Aligned_cols=29  Identities=7%  Similarity=-0.094  Sum_probs=22.9

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKK   30 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr   30 (61)
                      ...|+|..+|+++..|+.++..-|.+-++
T Consensus       159 s~~EIA~~lgis~~tV~~~l~Ra~~~Lr~  187 (194)
T PRK12519        159 SQSEIAKRLGIPLGTVKARARQGLLKLRE  187 (194)
T ss_pred             CHHHHHHHhCCCHHHHHHHHHHHHHHHHH
Confidence            46799999999999999988655554444


No 64 
>PRK09644 RNA polymerase sigma factor SigM; Provisional
Probab=73.84  E-value=0.58  Score=27.38  Aligned_cols=30  Identities=10%  Similarity=-0.097  Sum_probs=23.7

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKE   31 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~   31 (61)
                      ...|+|..+|+++..|+++.+-=|.+-|+.
T Consensus       126 s~~eIA~~lgis~~tv~~~l~Rar~~Lr~~  155 (165)
T PRK09644        126 TYEEAASVLDLKLNTYKSHLFRGRKRLKAL  155 (165)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHHHHHHHHH
Confidence            568999999999999999877555555544


No 65 
>PRK12514 RNA polymerase sigma factor; Provisional
Probab=73.50  E-value=0.76  Score=27.18  Aligned_cols=29  Identities=7%  Similarity=0.198  Sum_probs=22.2

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKK   30 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr   30 (61)
                      -..|+|..+|+++..|++..+.-|.+-|+
T Consensus       147 s~~eIA~~lgis~~tV~~~l~Rar~~Lr~  175 (179)
T PRK12514        147 SYKELAERHDVPLNTMRTWLRRSLLKLRE  175 (179)
T ss_pred             CHHHHHHHHCCChHHHHHHHHHHHHHHHH
Confidence            46799999999999999877644444443


No 66 
>PRK09642 RNA polymerase sigma factor SigW; Reviewed
Probab=73.25  E-value=0.66  Score=26.89  Aligned_cols=29  Identities=10%  Similarity=-0.016  Sum_probs=22.1

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKK   30 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr   30 (61)
                      -..|+|..+|+++..|++...--|.+-|+
T Consensus       124 s~~EIA~~lgis~~tV~~~l~Rar~~Lr~  152 (160)
T PRK09642        124 SYQEIALQEKIEVKTVEMKLYRARKWIKK  152 (160)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHHHHHHHH
Confidence            46799999999999999876644444444


No 67 
>smart00422 HTH_MERR helix_turn_helix, mercury resistance.
Probab=73.14  E-value=0.49  Score=23.90  Aligned_cols=21  Identities=5%  Similarity=-0.004  Sum_probs=18.2

Q ss_pred             CchhhhhcCCCCCccceeecc
Q psy12003          1 MNLLRDKNPPRGTERQIKIWF   21 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWF   21 (61)
                      |-+.|+|+.+|+++.+|+-|-
T Consensus         1 ~s~~eva~~~gvs~~tlr~~~   21 (70)
T smart00422        1 YTIGEVAKLAGVSVRTLRYYE   21 (70)
T ss_pred             CCHHHHHHHHCcCHHHHHHHH
Confidence            457899999999999999884


No 68 
>PF04545 Sigma70_r4:  Sigma-70, region 4;  InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. RNA polymerase recruits alternative sigma factors as a means of switching on specific regulons. Most bacteria express a multiplicity of sigma factors. Two of these factors, sigma-70 (gene rpoD), generally known as the major or primary sigma factor, and sigma-54 (gene rpoN or ntrA) direct the transcription of a wide variety of genes. The other sigma factors, known as alternative sigma factors, are required for the transcription of specific subsets of genes.  With regard to sequence similarity, sigma factors can be grouped into two classes, the sigma-54 and sigma-70 families. Sequence alignments of the sigma70 family members reveal four conserved regions that can be further divided into subregions eg. sub-region 2.2, which may be involved in the binding of the sigma factor to the core RNA polymerase; and sub-region 4.2, which seems to harbor a DNA-binding 'helix-turn-helix' motif involved in binding the conserved -35 region of promoters recognised by the major sigma factors [, ].  Region 4 of sigma-70 like sigma-factors is involved in binding to the -35 promoter element via a helix-turn-helix motif []. Due to the way Pfam works, the threshold has been set artificially high to prevent overlaps with other helix-turn-helix families. Therefore there are many false negatives.; GO: 0003677 DNA binding, 0003700 sequence-specific DNA binding transcription factor activity, 0016987 sigma factor activity, 0006352 transcription initiation, DNA-dependent, 0006355 regulation of transcription, DNA-dependent; PDB: 2P7V_B 3IYD_F 1TLH_B 1KU7_A 1RIO_H 3N97_A 1KU3_A 1RP3_C 1SC5_A 1NR3_A ....
Probab=71.91  E-value=0.34  Score=23.33  Aligned_cols=19  Identities=5%  Similarity=-0.113  Sum_probs=16.2

Q ss_pred             chhhhhcCCCCCccceeec
Q psy12003          2 NLLRDKNPPRGTERQIKIW   20 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvW   20 (61)
                      .+.|+|..+|+++.+|+.+
T Consensus        22 t~~eIa~~lg~s~~~V~~~   40 (50)
T PF04545_consen   22 TLEEIAERLGISRSTVRRI   40 (50)
T ss_dssp             SHHHHHHHHTSCHHHHHHH
T ss_pred             CHHHHHHHHCCcHHHHHHH
Confidence            4689999999999999754


No 69 
>PRK09652 RNA polymerase sigma factor RpoE; Provisional
Probab=71.10  E-value=0.74  Score=26.81  Aligned_cols=28  Identities=4%  Similarity=-0.135  Sum_probs=21.5

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWK   29 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~k   29 (61)
                      .+.|+|..+|+++.+|+.+...=+.+-+
T Consensus       146 s~~eIA~~lgis~~tV~~~l~ra~~~Lr  173 (182)
T PRK09652        146 SYEEIAEIMGCPIGTVRSRIFRAREALR  173 (182)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHHHHHHH
Confidence            4678999999999999988774343333


No 70 
>PRK12530 RNA polymerase sigma factor; Provisional
Probab=71.02  E-value=0.79  Score=27.63  Aligned_cols=30  Identities=3%  Similarity=0.037  Sum_probs=22.4

Q ss_pred             CchhhhhcCCCCCccceeeccccchhHHHH
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQNRRMKWKK   30 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFqNrRak~kr   30 (61)
                      +...|+|..+|+++..|+++..-=|.+-|+
T Consensus       151 ~s~~EIA~~lgis~~tVk~~l~RAr~~Lr~  180 (189)
T PRK12530        151 LSSEQICQECDISTSNLHVLLYRARLQLQA  180 (189)
T ss_pred             CCHHHHHHHHCCCHHHHHHHHHHHHHHHHH
Confidence            346899999999999999886644444443


No 71 
>PRK12547 RNA polymerase sigma factor; Provisional
Probab=70.65  E-value=0.84  Score=26.76  Aligned_cols=29  Identities=10%  Similarity=-0.029  Sum_probs=21.7

Q ss_pred             CchhhhhcCCCCCccceeeccccchhHHH
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQNRRMKWK   29 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFqNrRak~k   29 (61)
                      +...|+|..+|+++..|++...-=|.+-|
T Consensus       129 ~s~~eIA~~lgis~~tV~~~l~Rar~~Lr  157 (164)
T PRK12547        129 FSYEDAAAICGCAVGTIKSRVSRARNRLQ  157 (164)
T ss_pred             CCHHHHHHHhCCCHHHHHHHHHHHHHHHH
Confidence            35789999999999999987654343333


No 72 
>PRK09639 RNA polymerase sigma factor SigX; Provisional
Probab=70.35  E-value=0.82  Score=26.55  Aligned_cols=31  Identities=10%  Similarity=0.030  Sum_probs=23.4

Q ss_pred             CchhhhhcCCCCCccceeeccccchhHHHHH
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQNRRMKWKKE   31 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFqNrRak~kr~   31 (61)
                      +...|+|..+|+++..|+.....-|.+.|+.
T Consensus       128 ~s~~eIA~~lgis~~tV~~~i~ra~~~Lr~~  158 (166)
T PRK09639        128 YSYKEIAEALGIKESSVGTTLARAKKKFRKI  158 (166)
T ss_pred             CCHHHHHHHHCCCHHHHHHHHHHHHHHHHHH
Confidence            3568999999999999998875545554443


No 73 
>cd04774 HTH_YfmP Helix-Turn-Helix DNA binding domain of the YfmP transcription regulator. Helix-turn-helix (HTH) transcription regulator, YfmP, and related proteins; N-terminal domain. YfmP regulates the multidrug efflux protein, YfmO, and indirectly regulates the expression of the Bacillus subtilis copZA operon encoding a metallochaperone, CopZ, and a CPx-type ATPase efflux protein, CopA. These proteins belong to the MerR superfamily of transcription regulators that promote expression of several stress regulon genes by reconfiguring the spacer between the -35 and -10 promoter elements. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.
Probab=69.72  E-value=0.69  Score=25.59  Aligned_cols=22  Identities=14%  Similarity=0.052  Sum_probs=19.6

Q ss_pred             CchhhhhcCCCCCccceeeccc
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      |.|.|+|..+|++..+|+-|.+
T Consensus         1 ~~I~e~a~~~gvs~~tLR~ye~   22 (96)
T cd04774           1 YKVDEVAKRLGLTKRTLKYYEE   22 (96)
T ss_pred             CCHHHHHHHHCcCHHHHHHHHH
Confidence            5688999999999999999954


No 74 
>TIGR02999 Sig-70_X6 RNA polymerase sigma factor, TIGR02999 family. This group of sigma factors are members of the sigma-70 family (TIGR02937) and are found in a variety of species including Rhodopirellula baltica which encodes a paralogous group of five.
Probab=69.56  E-value=0.89  Score=26.86  Aligned_cols=28  Identities=7%  Similarity=-0.122  Sum_probs=21.2

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWK   29 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~k   29 (61)
                      -..|+|..||+++.+|++....-|.+-+
T Consensus       152 s~~EIA~~lgis~~tVk~~l~Rar~~Lr  179 (183)
T TIGR02999       152 TVEEIAELLGVSVRTVERDWRFARAWLA  179 (183)
T ss_pred             CHHHHHHHhCCCHHHHHHHHHHHHHHHH
Confidence            4679999999999999987664444433


No 75 
>PRK12518 RNA polymerase sigma factor; Provisional
Probab=69.31  E-value=1.2  Score=26.18  Aligned_cols=31  Identities=10%  Similarity=-0.160  Sum_probs=24.0

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHHh
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKEH   32 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~~   32 (61)
                      -..|+|..+|+|+..|++.+..-|.+-++.-
T Consensus       138 s~~eIA~~lg~s~~tv~~~l~Rar~~L~~~l  168 (175)
T PRK12518        138 PQKEIAEILNIPVGTVKSRLFYARRQLRKFL  168 (175)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHHHHHHHHHH
Confidence            3578999999999999988765565555543


No 76 
>TIGR02983 SigE-fam_strep RNA polymerase sigma-70 factor, sigma-E family. This group of similar sigma-70 factors includes the sigE factor from Streptomyces coelicolor. The family appears to include a paralagous expansion in the Streptomycetes lineage, while related Actinomycetales have at most two representatives.
Probab=68.72  E-value=1  Score=26.14  Aligned_cols=30  Identities=3%  Similarity=-0.023  Sum_probs=22.5

Q ss_pred             CchhhhhcCCCCCccceeeccccchhHHHH
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQNRRMKWKK   30 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFqNrRak~kr   30 (61)
                      +...|+|..+|+++..|+.+...-|.+-++
T Consensus       127 ~s~~eIA~~lgis~~tV~~~l~ra~~~Lr~  156 (162)
T TIGR02983       127 LSEAQVAEALGISVGTVKSRLSRALARLRE  156 (162)
T ss_pred             CCHHHHHHHhCCCHHHHHHHHHHHHHHHHH
Confidence            346789999999999999876655544444


No 77 
>PF08765 Mor:  Mor transcription activator family;  InterPro: IPR014875 Mor (Middle operon regulator) is a sequence specific DNA binding protein. It mediates transcription activation through its interactions with the C-terminal domains of the alpha and sigma subunits of bacterial RNA polymerase. The N-terminal region of Mor is the dimerisation region, and the C-terminal contains a helix-turn-helix motif which binds DNA []. ; PDB: 1RR7_A.
Probab=68.63  E-value=0.63  Score=26.20  Aligned_cols=18  Identities=33%  Similarity=0.174  Sum_probs=13.3

Q ss_pred             CchhhhhcCCCCCcccee
Q psy12003          1 MNLLRDKNPPRGTERQIK   18 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~Vq   18 (61)
                      +++.+||.+.|||+++|.
T Consensus        73 ~n~~eLA~kyglS~r~I~   90 (108)
T PF08765_consen   73 MNVRELARKYGLSERQIY   90 (108)
T ss_dssp             S-HHHHHHHHT--HHHHH
T ss_pred             CCHHHHHHHHCcCHHHHH
Confidence            578999999999998885


No 78 
>PRK12515 RNA polymerase sigma factor; Provisional
Probab=68.61  E-value=1.2  Score=26.66  Aligned_cols=33  Identities=15%  Similarity=-0.042  Sum_probs=25.0

Q ss_pred             CchhhhhcCCCCCccceeeccccchhHHHHHhh
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQNRRMKWKKEHK   33 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFqNrRak~kr~~~   33 (61)
                      +.+.|+|..+|+++..|++-...=|.+.++.-.
T Consensus       148 ~s~~eIA~~lgis~~tV~~~l~Rar~~Lr~~l~  180 (189)
T PRK12515        148 KSVEEVGEIVGIPESTVKTRMFYARKKLAELLK  180 (189)
T ss_pred             CCHHHHHHHHCcCHHHHHHHHHHHHHHHHHHHH
Confidence            356899999999999999877655666555433


No 79 
>PF13384 HTH_23:  Homeodomain-like domain; PDB: 2X48_C.
Probab=68.58  E-value=0.38  Score=22.99  Aligned_cols=20  Identities=5%  Similarity=0.121  Sum_probs=16.6

Q ss_pred             hhhhhcCCCCCccceeeccc
Q psy12003          3 LLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         3 ~~eLA~~l~Lte~~VqvWFq   22 (61)
                      ..++|..+|++..+|.-|.+
T Consensus        20 ~~~ia~~lgvs~~Tv~~w~k   39 (50)
T PF13384_consen   20 IREIAKRLGVSRSTVYRWIK   39 (50)
T ss_dssp             HHHHHHHHTS-HHHHHHHHT
T ss_pred             HHHHHHHHCcCHHHHHHHHH
Confidence            56899999999999999855


No 80 
>PF13404 HTH_AsnC-type:  AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B ....
Probab=68.32  E-value=0.57  Score=22.32  Aligned_cols=16  Identities=6%  Similarity=-0.035  Sum_probs=12.9

Q ss_pred             hhhhhcCCCCCcccee
Q psy12003          3 LLRDKNPPRGTERQIK   18 (61)
Q Consensus         3 ~~eLA~~l~Lte~~Vq   18 (61)
                      ..+||..+||++..|.
T Consensus        20 ~~~la~~lglS~~~v~   35 (42)
T PF13404_consen   20 YAELAEELGLSESTVR   35 (42)
T ss_dssp             HHHHHHHHTS-HHHHH
T ss_pred             HHHHHHHHCcCHHHHH
Confidence            5789999999998884


No 81 
>PHA03273 envelope glycoprotein C; Provisional
Probab=68.18  E-value=2.5  Score=29.97  Aligned_cols=20  Identities=15%  Similarity=0.316  Sum_probs=15.1

Q ss_pred             cCCCCCccceeeccccchhHH
Q psy12003          8 NPPRGTERQIKIWFQNRRMKW   28 (61)
Q Consensus         8 ~~l~Lte~~VqvWFqNrRak~   28 (61)
                      ...++++.+++|||| ||.+-
T Consensus       114 ~~~~~~~~RLeiWf~-~r~rf  133 (486)
T PHA03273        114 VGVNYSEYRLEIYLN-QRTPF  133 (486)
T ss_pred             CCCCCcceEEEEEEc-ccccc
Confidence            456777899999999 55553


No 82 
>PRK11924 RNA polymerase sigma factor; Provisional
Probab=68.12  E-value=1.3  Score=25.68  Aligned_cols=29  Identities=7%  Similarity=-0.058  Sum_probs=22.6

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKK   30 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr   30 (61)
                      ...|+|..+|+++..|..+..-=|.+.|+
T Consensus       143 ~~~eIA~~lgis~~tv~~~~~ra~~~lr~  171 (179)
T PRK11924        143 SYREIAEILGVPVGTVKSRLRRARQLLRE  171 (179)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHHHHHHHH
Confidence            46799999999999999887655555444


No 83 
>PRK00118 putative DNA-binding protein; Validated
Probab=67.87  E-value=1  Score=25.65  Aligned_cols=31  Identities=3%  Similarity=-0.161  Sum_probs=24.6

Q ss_pred             CchhhhhcCCCCCccceeeccccchhHHHHH
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQNRRMKWKKE   31 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFqNrRak~kr~   31 (61)
                      +-..|+|..+|+++.+|..+...-|.+.+..
T Consensus        34 ~S~~EIAe~lGIS~~TV~r~L~RArkkLr~~   64 (104)
T PRK00118         34 YSLGEIAEEFNVSRQAVYDNIKRTEKLLEDY   64 (104)
T ss_pred             CCHHHHHHHHCcCHHHHHHHHHHHHHHHHHH
Confidence            3468999999999999998887666665554


No 84 
>TIGR02989 Sig-70_gvs1 RNA polymerase sigma-70 factor, Rhodopirellula/Verrucomicrobium family. This group of sigma factors are members of the sigma-70 family (TIGR02937) and are abundantly found in the species Rhodopirellula baltica (11), and Verrucomicrobium spinosum (16) and to a lesser extent in Gemmata obscuriglobus (2).
Probab=67.12  E-value=0.92  Score=26.10  Aligned_cols=21  Identities=10%  Similarity=-0.105  Sum_probs=17.9

Q ss_pred             chhhhhcCCCCCccceeeccc
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      .+.|+|..+|+|+.+|+++..
T Consensus       129 ~~~eIA~~l~is~~tv~~~l~  149 (159)
T TIGR02989       129 SLTALAEQLGRTVNAVYKALS  149 (159)
T ss_pred             CHHHHHHHhCCCHHHHHHHHH
Confidence            467999999999999997644


No 85 
>cd04788 HTH_NolA-AlbR Helix-Turn-Helix DNA binding domain of the transcription regulators NolA and AlbR. Helix-turn-helix (HTH) transcription regulators NolA and AlbR, N-terminal domain. In Bradyrhizobium (Arachis) sp. NC92, NolA is required for efficient nodulation of host plants. In Xanthomonas albilineans, AlbR regulates the expression of the pathotoxin, albicidin. These proteins are putatively comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the C-terminal domains are often unrelated and bind specific coactivator molecules. They share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements.
Probab=66.84  E-value=0.86  Score=25.06  Aligned_cols=22  Identities=5%  Similarity=-0.079  Sum_probs=19.6

Q ss_pred             CchhhhhcCCCCCccceeeccc
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      |-|.|+|+.+|++..+++-|-+
T Consensus         1 m~i~eva~~~gvs~~tlR~ye~   22 (96)
T cd04788           1 WKIGELARRTGLSVRTLHHYDH   22 (96)
T ss_pred             CCHHHHHHHHCcCHHHHHHHHH
Confidence            6788999999999999998854


No 86 
>PRK09047 RNA polymerase factor sigma-70; Validated
Probab=66.70  E-value=1.1  Score=25.85  Aligned_cols=28  Identities=7%  Similarity=0.035  Sum_probs=20.9

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWK   29 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~k   29 (61)
                      ...|+|..||+++..|++...--|.+-|
T Consensus       124 s~~EIA~~lgis~~tV~~~l~ra~~~Lr  151 (161)
T PRK09047        124 DVAETAAAMGCSEGSVKTHCSRATHALA  151 (161)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHHHHHHH
Confidence            4679999999999999976553333333


No 87 
>TIGR02948 SigW_bacill RNA polymerase sigma-W factor. This sigma factor is restricted to certain lineages of the order Bacillales.
Probab=66.66  E-value=1.2  Score=26.35  Aligned_cols=29  Identities=14%  Similarity=0.015  Sum_probs=22.2

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKK   30 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr   30 (61)
                      ...|+|..+|+++..|++.++.-|.+-+.
T Consensus       154 s~~eIA~~lgis~~~v~~~l~Rar~~Lr~  182 (187)
T TIGR02948       154 SLKEISEILDLPVGTVKTRIHRGREALRK  182 (187)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHHHHHHHH
Confidence            46789999999999999887654444443


No 88 
>cd01104 HTH_MlrA-CarA Helix-Turn-Helix DNA binding domain of the transcription regulators MlrA and CarA. Helix-turn-helix (HTH) transcription regulator MlrA (merR-like regulator A), N-terminal domain. The MlrA protein, also known as YehV, has been shown to control cell-cell aggregation by co-regulating the expression of curli and extracellular matrix production in Escherichia coli and Salmonella typhimurium.  Its close homolog, CarA from Myxococcus xanthus, is involved in activation of the carotenoid biosynthesis genes by light. These proteins belong to the MerR superfamily of transcription regulators that promote expression of several stress regulon genes by reconfiguring the spacer between the -35 and -10 promoter elements. Their conserved N-terminal domains contain predicted HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules. Many MlrA- and CarA-like proteins in this group appear to lack the long dimerization helix seen i
Probab=66.55  E-value=0.82  Score=23.01  Aligned_cols=21  Identities=5%  Similarity=0.097  Sum_probs=18.2

Q ss_pred             chhhhhcCCCCCccceeeccc
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      -+.|+|..+|++..+++-|-+
T Consensus         2 s~~eva~~~gvs~~tlr~w~~   22 (68)
T cd01104           2 TIGAVARLTGVSPDTLRAWER   22 (68)
T ss_pred             CHHHHHHHHCcCHHHHHHHHH
Confidence            467999999999999998854


No 89 
>cd01392 HTH_LacI Helix-turn-helix (HTH) DNA binding domain of the LacI family of transcriptional regulators. HTH-DNA binding domain of the LacI (lactose operon repressor) family of bacterial transcriptional regulators and their putative homologs found in plants. The LacI family has more than 500 members distributed among almost all bacterial species. The monomeric proteins of the LacI family contain common structural features that include a small DNA-binding domain with a helix-turn-helix motif in the N-terminus, a regulatory ligand-binding domain which exhibits the type I periplasmic binding protein fold in the C-terminus for oligomerization and for effector binding, and an approximately 18-amino acid linker connecting these two functional domains. In LacI-like transcriptional regulators, the ligands are monosaccharides including lactose, ribose, fructose, xylose, arabinose, galactose/glucose, and other sugars, with a few exceptions. When the C-terminal domain of the LacI family repre
Probab=66.50  E-value=0.74  Score=21.97  Aligned_cols=21  Identities=0%  Similarity=-0.089  Sum_probs=19.1

Q ss_pred             hhhcCCCCCccceeeccccch
Q psy12003          5 RDKNPPRGTERQIKIWFQNRR   25 (61)
Q Consensus         5 eLA~~l~Lte~~VqvWFqNrR   25 (61)
                      +||..+|++..+|--|+.++.
T Consensus         2 ~lA~~~gvs~~tvs~~l~g~~   22 (52)
T cd01392           2 DIARAAGVSVATVSRVLNGKP   22 (52)
T ss_pred             cHHHHHCcCHHHHHHHHcCCC
Confidence            689999999999999999983


No 90 
>PF08279 HTH_11:  HTH domain;  InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets. The winged helix motif consists of two wings (W1, W2), three alpha helices (H1, H2, H3) and three beta-sheets (S1, S2, S3) arranged in the order H1-S1-H2-H3-S2-W1-S3-W2 []. The DNA-recognition helix makes sequence-specific DNA contacts with the major groove of DNA, while the wings make different DNA contacts, often with the minor groove or the backbone of DNA. Several winged-helix proteins display an exposed patch of hydrophobic residues thought to mediate protein-protein interactions. This entry represents a subset of the winged helix domain superfamily which is predominantly found in bacterial proteins, though there are also some archaeal and eukaryotic examples. This domain is commonly found in the biotin (vitamin H) repressor protein BirA which regulates transcription of the biotin operon []. It is also found in other proteins including regulators of amino acid biosynthsis such as LysM [], and regulators of carbohydrate metabolisms such as LicR and FrvR [, ].; PDB: 1HXD_B 2EWN_B 1BIA_A 1BIB_A 1J5Y_A 3V7S_A 3V7C_A 3RKW_A 3RIR_A 3RKX_A ....
Probab=66.24  E-value=0.95  Score=21.98  Aligned_cols=16  Identities=13%  Similarity=-0.002  Sum_probs=13.0

Q ss_pred             hhhhhcCCCCCcccee
Q psy12003          3 LLRDKNPPRGTERQIK   18 (61)
Q Consensus         3 ~~eLA~~l~Lte~~Vq   18 (61)
                      +.+||..+++|.++|+
T Consensus        18 ~~eLa~~l~vS~rTi~   33 (55)
T PF08279_consen   18 AKELAEELGVSRRTIR   33 (55)
T ss_dssp             HHHHHHHCTS-HHHHH
T ss_pred             HHHHHHHhCCCHHHHH
Confidence            5789999999999885


No 91 
>PRK12538 RNA polymerase sigma factor; Provisional
Probab=65.52  E-value=1.1  Score=28.19  Aligned_cols=32  Identities=9%  Similarity=-0.032  Sum_probs=24.6

Q ss_pred             CchhhhhcCCCCCccceeeccccchhHHHHHh
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQNRRMKWKKEH   32 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFqNrRak~kr~~   32 (61)
                      +...|+|..+|+++..|++..+.-|.+-|+.-
T Consensus       188 ~s~~EIA~~Lgis~~tVk~~l~RAr~kLr~~l  219 (233)
T PRK12538        188 MSNGEIAEVMDTTVAAVESLLKRGRQQLRDLL  219 (233)
T ss_pred             CCHHHHHHHHCcCHHHHHHHHHHHHHHHHHHH
Confidence            34689999999999999988775555555543


No 92 
>PRK12535 RNA polymerase sigma factor; Provisional
Probab=65.47  E-value=1.8  Score=26.40  Aligned_cols=32  Identities=6%  Similarity=-0.073  Sum_probs=24.0

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHHhh
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKEHK   33 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~~~   33 (61)
                      ...|+|..+|+++..|+++...-|.+-|+.-.
T Consensus       151 s~~EIAe~lgis~~tV~~~l~Rar~~Lr~~l~  182 (196)
T PRK12535        151 TYEEAAKIADVRVGTIRSRVARARADLIAATA  182 (196)
T ss_pred             CHHHHHHHhCCCHHHHHHHHHHHHHHHHHHhc
Confidence            46799999999999999887655555554433


No 93 
>PRK09637 RNA polymerase sigma factor SigZ; Provisional
Probab=65.27  E-value=1.2  Score=26.70  Aligned_cols=30  Identities=17%  Similarity=0.009  Sum_probs=22.6

Q ss_pred             CchhhhhcCCCCCccceeeccccchhHHHH
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQNRRMKWKK   30 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFqNrRak~kr   30 (61)
                      +.+.|+|..+|+++..|+..+..=|.+.++
T Consensus       123 ~~~~EIA~~lgis~~tV~~~l~Rar~~Lr~  152 (181)
T PRK09637        123 LSQKEIAEKLGLSLSGAKSRVQRGRVKLKE  152 (181)
T ss_pred             CCHHHHHHHhCCCHHHHHHHHHHHHHHHHH
Confidence            457899999999999999877644444443


No 94 
>PRK05602 RNA polymerase sigma factor; Reviewed
Probab=65.16  E-value=1.3  Score=26.43  Aligned_cols=30  Identities=3%  Similarity=-0.012  Sum_probs=23.0

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKE   31 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~   31 (61)
                      ...|+|..+|++..+|+.....-|.+-|+.
T Consensus       146 s~~EIA~~lgis~~tV~~~l~Rar~~Lr~~  175 (186)
T PRK05602        146 SNIEAAAVMDISVDALESLLARGRRALRAQ  175 (186)
T ss_pred             CHHHHHHHhCcCHHHHHHHHHHHHHHHHHH
Confidence            467999999999999998876555554443


No 95 
>PRK09648 RNA polymerase sigma factor SigD; Reviewed
Probab=65.04  E-value=1.2  Score=26.55  Aligned_cols=22  Identities=5%  Similarity=0.013  Sum_probs=18.6

Q ss_pred             chhhhhcCCCCCccceeecccc
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQN   23 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqN   23 (61)
                      .+.|+|..+|+++..|+.....
T Consensus       157 s~~EIA~~lgis~~tV~~~l~R  178 (189)
T PRK09648        157 SAEETAEAVGSTPGAVRVAQHR  178 (189)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHH
Confidence            4689999999999999987643


No 96 
>PRK12536 RNA polymerase sigma factor; Provisional
Probab=65.00  E-value=1.2  Score=26.47  Aligned_cols=29  Identities=7%  Similarity=0.011  Sum_probs=23.0

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKK   30 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr   30 (61)
                      ...|+|..+|+++..|++....-|.+.|+
T Consensus       147 s~~EIA~~l~is~~tV~~~l~rar~~Lr~  175 (181)
T PRK12536        147 SVAETAQLTGLSESAVKVGIHRGLKALAA  175 (181)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHHHHHHHH
Confidence            46799999999999999887655555554


No 97 
>PRK12520 RNA polymerase sigma factor; Provisional
Probab=64.60  E-value=2  Score=25.69  Aligned_cols=32  Identities=9%  Similarity=-0.027  Sum_probs=24.0

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHHhh
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKEHK   33 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~~~   33 (61)
                      ...|+|..+|+++..|++....-|.+-|+.-.
T Consensus       149 s~~EIA~~lgis~~tV~~~l~Rar~~Lr~~l~  180 (191)
T PRK12520        149 ETEEICQELQITATNAWVLLYRARMRLRECLD  180 (191)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHH
Confidence            46799999999999999876655555555433


No 98 
>PRK12543 RNA polymerase sigma factor; Provisional
Probab=64.49  E-value=1.3  Score=26.37  Aligned_cols=30  Identities=7%  Similarity=-0.100  Sum_probs=24.6

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKE   31 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~   31 (61)
                      ...|+|..+|+++..|++-...-+.+-|+.
T Consensus       135 s~~EIA~~lgis~~tV~~~l~ra~~~Lr~~  164 (179)
T PRK12543        135 SQEEIAQLLQIPIGTVKSRIHAALKKLRQK  164 (179)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHHHHHHHHH
Confidence            467999999999999998877666666665


No 99 
>TIGR02959 SigZ RNA polymerase sigma factor, SigZ family. This family of RNA polymerase sigma factors is a member of the Sigma-70 subfamily (TIGR02937). One of these is designated as SigZ in B. subtilis (Swiss_Prot: SIGZ_BACSU). Interestingly, this group has a very sporatic distribution, B. subtilis, for instance, being the only sequenced strain of Bacilli with a member. Dechloromonas aromatica RCB appears to have two of these sigma factors. A member appears on a plasmid found in Photobacterium profundum SS9 and Vibrio fischeri ES114 (where a second one is chromosomally encoded).
Probab=64.19  E-value=1.3  Score=26.18  Aligned_cols=31  Identities=16%  Similarity=-0.098  Sum_probs=23.7

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHHh
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKEH   32 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~~   32 (61)
                      .+.|+|..+|+++..|+...+--|.+.+..-
T Consensus       118 s~~eIA~~lgis~~tV~~~l~Rar~~Lr~~l  148 (170)
T TIGR02959       118 SQQEIAEKLGLSLSGAKSRVQRGRKKLKELL  148 (170)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHHHHHHHHHH
Confidence            5689999999999999988765555555543


No 100
>cd04767 HTH_HspR-like_MBC Helix-Turn-Helix DNA binding domain of putative HspR-like transcription regulators. Putative helix-turn-helix (HTH) transcription regulator HspR-like proteins. Unlike the characterized HspR, these proteins have a C-terminal domain with putative metal binding cysteines (MBC). Heat shock protein regulators (HspR) have been shown to regulate expression of specific regulons in response to high temperature or high osmolarity in Streptomyces and Helicobacter, respectively. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind spe
Probab=63.77  E-value=1.1  Score=26.16  Aligned_cols=24  Identities=8%  Similarity=0.074  Sum_probs=20.4

Q ss_pred             CchhhhhcCCCCCccceeeccccc
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQNR   24 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFqNr   24 (61)
                      |.|.++|..+|++..+++.|-+..
T Consensus         2 ysI~eVA~~~GVs~~TLR~wE~~G   25 (120)
T cd04767           2 YPIGVVAELLNIHPETLRIWERHG   25 (120)
T ss_pred             CCHHHHHHHHCcCHHHHHHHHHCC
Confidence            568899999999999999996543


No 101
>TIGR02950 SigM_subfam RNA polymerase sigma factor, SigM family. This family of RNA polymerase sigma factors is a member of the Sigma-70 subfamily (TIGR02937) and is restricted to certain lineages of the order Bacillales. This family encompasses at least two distinct sigma factors as two proteins are found in each of B. anthracis, B. subtilis subsp. subtilis str. 168, and B. lichiniformis (although these are not apparently the same two in each). One of these is designated as SigM in B. subtilis (Swiss_Prot:  SIGM_BACSU) and is activated by various stressors.
Probab=63.62  E-value=1.3  Score=25.32  Aligned_cols=21  Identities=5%  Similarity=-0.201  Sum_probs=17.9

Q ss_pred             chhhhhcCCCCCccceeeccc
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      ...|+|..+|+++.+|++...
T Consensus       123 s~~eIA~~lgis~~tv~~~l~  143 (154)
T TIGR02950       123 SYKEIAELLNLSLAKVKSNLF  143 (154)
T ss_pred             cHHHHHHHHCCCHHHHHHHHH
Confidence            467899999999999997755


No 102
>cd04773 HTH_TioE_rpt2 Second Helix-Turn-Helix DNA binding domain of the regulatory protein TioE. Putative helix-turn-helix (HTH) regulatory protein, TioE, and related proteins. TioE is part of the thiocoraline gene cluster, which is involved in the biosynthesis of the antitumor thiocoraline from the marine actinomycete, Micromonospora. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. Proteins in this family are unique within the MerR superfamily in that they are composed of just two adjacent MerR-like N-terminal domains; this CD mainly contains the C-terminal or second repeat (rpt2) of these tandem MerR-like domain proteins.
Probab=63.35  E-value=1  Score=25.26  Aligned_cols=22  Identities=9%  Similarity=0.093  Sum_probs=19.4

Q ss_pred             CchhhhhcCCCCCccceeeccc
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      |-+.|+|..+|++..+|+-|-+
T Consensus         1 ~~i~eva~~~gvs~~tlR~ye~   22 (108)
T cd04773           1 MTIGELAHLLGVPPSTLRHWEK   22 (108)
T ss_pred             CCHHHHHHHHCcCHHHHHHHHH
Confidence            5688999999999999998854


No 103
>TIGR03070 couple_hipB transcriptional regulator, y4mF family. Members of this family belong to a clade of helix-turn-helix DNA-binding proteins, among the larger family pfam01381 (HTH_3; Helix-turn-helix). Members are similar in sequence to the HipB protein of E. coli. Genes for members of the seed alignment for this protein family were found to be closely linked to genes encoding proteins related to HipA. The HibBA operon appears to have some features in common with toxin-antitoxin post-segregational killing systems.
Probab=63.24  E-value=1.4  Score=21.03  Aligned_cols=23  Identities=9%  Similarity=-0.201  Sum_probs=19.7

Q ss_pred             hhhhhcCCCCCccceeeccccch
Q psy12003          3 LLRDKNPPRGTERQIKIWFQNRR   25 (61)
Q Consensus         3 ~~eLA~~l~Lte~~VqvWFqNrR   25 (61)
                      ..+||..+|++...|.-|..+++
T Consensus        18 q~~lA~~~gvs~~~vs~~e~g~~   40 (58)
T TIGR03070        18 QADLADLAGVGLRFIRDVENGKP   40 (58)
T ss_pred             HHHHHHHhCCCHHHHHHHHCCCC
Confidence            56899999999999999987764


No 104
>PF12728 HTH_17:  Helix-turn-helix domain
Probab=63.02  E-value=0.98  Score=21.67  Aligned_cols=25  Identities=4%  Similarity=0.174  Sum_probs=20.0

Q ss_pred             CchhhhhcCCCCCccceeeccccch
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQNRR   25 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFqNrR   25 (61)
                      +.+.|+|.-||++..+|.-|.+...
T Consensus         2 lt~~e~a~~l~is~~tv~~~~~~g~   26 (51)
T PF12728_consen    2 LTVKEAAELLGISRSTVYRWIRQGK   26 (51)
T ss_pred             CCHHHHHHHHCcCHHHHHHHHHcCC
Confidence            3567899999999999998876543


No 105
>cd00592 HTH_MerR-like Helix-Turn-Helix DNA binding domain of MerR-like transcription regulators. Helix-turn-helix (HTH) MerR-like transcription regulator, N-terminal domain. The MerR family transcription regulators have been shown to mediate responses to stress including exposure to heavy metals, drugs, or oxygen radicals in eubacterial and some archaeal species. They regulate transcription of multidrug/metal ion transporter genes and oxidative stress regulons by reconfiguring the spacer between the -35 and -10 promoter elements.  A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.
Probab=62.85  E-value=1.1  Score=24.32  Aligned_cols=22  Identities=5%  Similarity=-0.017  Sum_probs=19.0

Q ss_pred             CchhhhhcCCCCCccceeeccc
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      |.+.|+|..+|+++.+|+-|-+
T Consensus         1 ~~~~eva~~~gi~~~tlr~~~~   22 (100)
T cd00592           1 YTIGEVAKLLGVSVRTLRYYEE   22 (100)
T ss_pred             CCHHHHHHHHCcCHHHHHHHHH
Confidence            5678999999999999998844


No 106
>PF01381 HTH_3:  Helix-turn-helix;  InterPro: IPR001387 This is large family of DNA binding helix-turn helix proteins that include a bacterial plasmid copy control protein, bacterial methylases, various bacteriophage transcription control proteins and a vegetative specific protein from Dictyostelium discoideum (Slime mould).; GO: 0043565 sequence-specific DNA binding; PDB: 2AXU_A 2AWI_D 2AXV_D 2AXZ_C 2AW6_A 3KXA_C 3BS3_A 2CRO_A 1ZUG_A 3CRO_R ....
Probab=62.82  E-value=0.67  Score=22.35  Aligned_cols=24  Identities=8%  Similarity=-0.110  Sum_probs=18.8

Q ss_pred             chhhhhcCCCCCccceeeccccch
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRR   25 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrR   25 (61)
                      ...+||..+|++...|.-|..+++
T Consensus        11 s~~~la~~~gis~~~i~~~~~g~~   34 (55)
T PF01381_consen   11 SQKELAEKLGISRSTISRIENGKR   34 (55)
T ss_dssp             -HHHHHHHHTS-HHHHHHHHTTSS
T ss_pred             CHHHHHHHhCCCcchhHHHhcCCC
Confidence            457899999999999998888755


No 107
>PRK09645 RNA polymerase sigma factor SigL; Provisional
Probab=62.80  E-value=1.6  Score=25.62  Aligned_cols=29  Identities=7%  Similarity=-0.107  Sum_probs=21.0

Q ss_pred             CchhhhhcCCCCCccceeeccccchhHHH
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQNRRMKWK   29 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFqNrRak~k   29 (61)
                      +...|+|..||+++..|+....--|.+-|
T Consensus       135 ~s~~EIA~~lgis~~tV~~~l~ra~~~Lr  163 (173)
T PRK09645        135 WSTAQIAADLGIPEGTVKSRLHYALRALR  163 (173)
T ss_pred             CCHHHHHHHHCcCHHHHHHHHHHHHHHHH
Confidence            35689999999999999976543333333


No 108
>TIGR02607 antidote_HigA addiction module antidote protein, HigA family. Members of this family form a distinct clade within the larger family HTH_3 of helix-turn-helix proteins, described by Pfam model pfam01381. Members of this clade are strictly bacterial and nearly always shorter than 110 amino acids. This family includes the characterized member HigA, without which the killer protein HigB cannot be cloned. The hig (host inhibition of growth) system is noted to be unusual in that killer protein is uncoded by the upstream member of the gene pair.
Probab=62.44  E-value=1.3  Score=22.75  Aligned_cols=24  Identities=8%  Similarity=0.030  Sum_probs=20.5

Q ss_pred             chhhhhcCCCCCccceeeccccch
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRR   25 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrR   25 (61)
                      -..+||..+|++...|--|..+++
T Consensus        20 t~~~lA~~~gis~~tis~~~~g~~   43 (78)
T TIGR02607        20 SIRALAKALGVSRSTLSRIVNGRR   43 (78)
T ss_pred             CHHHHHHHhCCCHHHHHHHHcCCC
Confidence            357899999999999999988765


No 109
>PF00376 MerR:  MerR family regulatory protein;  InterPro: IPR000551 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities. One of these is the MerR subfamily. MerR, which is found in many bacterial species mediates the mercuric-dependent induction of the mercury resistance operon. In the absence of mercury merR represses transcription by binding tightly, as a dimer, to the 'mer' operator region; when mercury is present the dimeric complex binds a single ion and becomes a potent transcriptional activator, while remaining bound to the mer site. Members of the family include the mercuric resistance operon regulatory protein merR; Bacillus subtilis bltR and bmrR; Bacillus glnR; Streptomyces coelicolor hspR; Bradyrhizobium japonicum nolA; Escherichia coli superoxide response regulator soxR; and Streptomyces lividans transcriptional activator tipA [, , , , , ]. Other members include hypothetical proteins from E. coli, B. subtilis and Haemophilus influenzae. Within this family, the HTH motif is situated towards the N terminus.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent; PDB: 3HH0_A 2DG6_A 1R8D_B 1JBG_A 2VZ4_A 2ZHH_A 2ZHG_A 1Q07_A 1Q06_A 1Q05_B ....
Probab=62.44  E-value=0.58  Score=21.84  Aligned_cols=18  Identities=6%  Similarity=0.039  Sum_probs=14.6

Q ss_pred             hhhhhcCCCCCccceeec
Q psy12003          3 LLRDKNPPRGTERQIKIW   20 (61)
Q Consensus         3 ~~eLA~~l~Lte~~VqvW   20 (61)
                      |-|+|..+|++..+|+-|
T Consensus         2 i~e~A~~~gvs~~tlR~y   19 (38)
T PF00376_consen    2 IGEVAKLLGVSPRTLRYY   19 (38)
T ss_dssp             HHHHHHHHTS-HHHHHHH
T ss_pred             HHHHHHHHCCCHHHHHHH
Confidence            568899999999999877


No 110
>cd01106 HTH_TipAL-Mta Helix-Turn-Helix DNA binding domain of the transcription regulators TipAL, Mta, and SkgA. Helix-turn-helix (HTH) TipAL, Mta, and SkgA transcription regulators, and related proteins, N-terminal domain. TipAL regulates resistance to and activation by numerous cyclic thiopeptide antibiotics, such as thiostrepton. Mta is a global transcriptional regulator; the N-terminal DNA-binding domain of Mta interacts directly with the promoters of mta, bmr, blt, and ydfK, and induces transcription of these multidrug-efflux transport genes. SkgA has been shown to control stationary-phase expression of catalase-peroxidase in Caulobacter crescentus. These proteins are comprised of distinct domains that harbor an  N-terminal active (DNA-binding) site and a regulatory (effector-binding) site. The conserved N-terminal domain of these transcription regulators contains winged HTH motifs that mediate DNA binding. These proteins share the N-terminal DNA binding domain with other transcrip
Probab=62.39  E-value=1.1  Score=24.74  Aligned_cols=24  Identities=4%  Similarity=-0.086  Sum_probs=20.0

Q ss_pred             CchhhhhcCCCCCccceeeccccc
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQNR   24 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFqNr   24 (61)
                      +.+.|+|..+|++..+++-|..+.
T Consensus         1 ~ti~eva~~~gvs~~tlR~ye~~G   24 (103)
T cd01106           1 YTVGEVAKLTGVSVRTLHYYDEIG   24 (103)
T ss_pred             CCHHHHHHHHCcCHHHHHHHHHCC
Confidence            457899999999999999886643


No 111
>PRK12532 RNA polymerase sigma factor; Provisional
Probab=62.35  E-value=1.5  Score=26.30  Aligned_cols=31  Identities=3%  Similarity=-0.111  Sum_probs=23.7

Q ss_pred             CchhhhhcCCCCCccceeeccccchhHHHHH
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQNRRMKWKKE   31 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFqNrRak~kr~   31 (61)
                      |...|+|..+|+++..|+.....-|.+-|+.
T Consensus       153 ~s~~EIA~~lgis~~tVk~~l~Rar~~Lr~~  183 (195)
T PRK12532        153 FSSDEIQQMCGISTSNYHTIMHRARESLRQC  183 (195)
T ss_pred             CCHHHHHHHHCCCHHHHHHHHHHHHHHHHHH
Confidence            3467999999999999998776555555554


No 112
>PRK12516 RNA polymerase sigma factor; Provisional
Probab=62.17  E-value=1.5  Score=26.43  Aligned_cols=32  Identities=9%  Similarity=-0.037  Sum_probs=24.1

Q ss_pred             CchhhhhcCCCCCccceeeccccchhHHHHHh
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQNRRMKWKKEH   32 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFqNrRak~kr~~   32 (61)
                      +...|+|..||+++..|++....-|.+-++.-
T Consensus       133 ~s~~EIA~~Lgis~~tVk~~l~Rar~~Lr~~l  164 (187)
T PRK12516        133 FAYEEAAEICGCAVGTIKSRVNRARQRLQEIL  164 (187)
T ss_pred             CCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHH
Confidence            34679999999999999988765555555443


No 113
>TIGR02952 Sig70_famx2 RNA polymerase sigma-70 factor, TIGR02952 family. This group of sigma factors are members of the sigma-70 family (TIGR02937). They and appear by homology, tree building, bidirectional best hits and one-to-a-genome distribution, to represent a conserved family. This family is found in a limited number of Gram-positive bacterial lineages.
Probab=61.66  E-value=1.4  Score=25.55  Aligned_cols=21  Identities=19%  Similarity=0.094  Sum_probs=17.5

Q ss_pred             CchhhhhcCCCCCccceeecc
Q psy12003          1 MNLLRDKNPPRGTERQIKIWF   21 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWF   21 (61)
                      +...|+|..||+++..|+...
T Consensus       139 ~s~~eIA~~l~is~~tv~~~l  159 (170)
T TIGR02952       139 LPIAEVARILGKTEGAVKILQ  159 (170)
T ss_pred             CCHHHHHHHHCCCHHHHHHHH
Confidence            356899999999999998654


No 114
>TIGR02954 Sig70_famx3 RNA polymerase sigma-70 factor, TIGR02954 family. This group of sigma factors are members of the sigma-70 family (TIGR02937). They and appear by homology, tree building, bidirectional best hits and one-to-a-genome distribution, to represent a conserved family. This family is found in certain Bacillus and Clostridium species.
Probab=61.18  E-value=1.8  Score=25.32  Aligned_cols=21  Identities=10%  Similarity=0.145  Sum_probs=17.7

Q ss_pred             chhhhhcCCCCCccceeeccc
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      -..|+|..+|+|+..|++...
T Consensus       137 s~~eiA~~lgis~~tv~~~l~  157 (169)
T TIGR02954       137 TIKEIAEVMNKPEGTVKTYLH  157 (169)
T ss_pred             CHHHHHHHHCCCHHHHHHHHH
Confidence            467999999999999987654


No 115
>cd00093 HTH_XRE Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.
Probab=60.79  E-value=1.3  Score=20.02  Aligned_cols=23  Identities=9%  Similarity=-0.120  Sum_probs=19.3

Q ss_pred             hhhhhcCCCCCccceeeccccch
Q psy12003          3 LLRDKNPPRGTERQIKIWFQNRR   25 (61)
Q Consensus         3 ~~eLA~~l~Lte~~VqvWFqNrR   25 (61)
                      ..++|..+++++..|.-|..+.+
T Consensus        15 ~~~~a~~~~~~~~~v~~~~~g~~   37 (58)
T cd00093          15 QEELAEKLGVSRSTISRIENGKR   37 (58)
T ss_pred             HHHHHHHHCCCHHHHHHHHcCCC
Confidence            56889999999999998888763


No 116
>PRK12512 RNA polymerase sigma factor; Provisional
Probab=60.71  E-value=1.8  Score=25.68  Aligned_cols=30  Identities=3%  Similarity=0.034  Sum_probs=23.3

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKE   31 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~   31 (61)
                      ...|+|..+|++..+|+..+..-|.+-|..
T Consensus       149 s~~eIA~~l~is~~tV~~~l~ra~~~Lr~~  178 (184)
T PRK12512        149 SIKETAAKLSMSEGAVRVALHRGLAALAAK  178 (184)
T ss_pred             CHHHHHHHhCCCHHHHHHHHHHHHHHHHHH
Confidence            467999999999999998877555555543


No 117
>KOG3755|consensus
Probab=60.69  E-value=2.4  Score=31.25  Aligned_cols=21  Identities=24%  Similarity=0.575  Sum_probs=17.3

Q ss_pred             CccceeeccccchhHHHHHhh
Q psy12003         13 TERQIKIWFQNRRMKWKKEHK   33 (61)
Q Consensus        13 te~~VqvWFqNrRak~kr~~~   33 (61)
                      .+.-|+.||.|||++.++...
T Consensus       739 ~~kn~~~~fk~~~ee~~~~k~  759 (769)
T KOG3755|consen  739 ESKNVQFWFKVRREEEKRLKM  759 (769)
T ss_pred             hhcchHHHHHHHHHHHhhhhc
Confidence            455788999999999998654


No 118
>PRK11923 algU RNA polymerase sigma factor AlgU; Provisional
Probab=60.38  E-value=1.6  Score=26.07  Aligned_cols=30  Identities=7%  Similarity=-0.089  Sum_probs=23.0

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKE   31 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~   31 (61)
                      ...|+|..+|+++..|++..+--|.+-|+.
T Consensus       156 s~~eIA~~lgis~~tv~~~l~Rar~~Lr~~  185 (193)
T PRK11923        156 SYEDIASVMQCPVGTVRSRIFRAREAIDKA  185 (193)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHHHHHHHHH
Confidence            367999999999999998776555555554


No 119
>PRK06986 fliA flagellar biosynthesis sigma factor; Validated
Probab=60.34  E-value=1.7  Score=27.10  Aligned_cols=29  Identities=10%  Similarity=-0.008  Sum_probs=23.3

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKK   30 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr   30 (61)
                      -+.|+|..+|+++..|+.+...-+.+-|+
T Consensus       202 s~~EIA~~lgis~~tV~~~~~ra~~~Lr~  230 (236)
T PRK06986        202 NLKEIGAVLGVSESRVSQIHSQAIKRLRA  230 (236)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHHHHHHHH
Confidence            46799999999999999887765555554


No 120
>PRK12537 RNA polymerase sigma factor; Provisional
Probab=60.32  E-value=2  Score=25.53  Aligned_cols=24  Identities=8%  Similarity=0.105  Sum_probs=19.2

Q ss_pred             chhhhhcCCCCCccceeeccccch
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRR   25 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrR   25 (61)
                      -..|+|..+|+++..|+++...=+
T Consensus       151 s~~eIA~~lgis~~tV~~~l~ra~  174 (182)
T PRK12537        151 SHAEIAQRLGAPLGTVKAWIKRSL  174 (182)
T ss_pred             CHHHHHHHHCCChhhHHHHHHHHH
Confidence            357899999999999998765333


No 121
>PRK12542 RNA polymerase sigma factor; Provisional
Probab=60.00  E-value=1.8  Score=25.80  Aligned_cols=29  Identities=14%  Similarity=0.095  Sum_probs=21.5

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKK   30 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr   30 (61)
                      ...|+|..+|+++..|++....-|.+-++
T Consensus       140 s~~EIA~~lgis~~tVk~~l~Rar~~Lr~  168 (185)
T PRK12542        140 TYQEISSVMGITEANVRKQFERARKRVQN  168 (185)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHHHHHHHH
Confidence            46799999999999999866544444333


No 122
>PRK13182 racA polar chromosome segregation protein; Reviewed
Probab=59.51  E-value=1.5  Score=27.06  Aligned_cols=23  Identities=9%  Similarity=0.161  Sum_probs=20.3

Q ss_pred             CchhhhhcCCCCCccceeecccc
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQN   23 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFqN   23 (61)
                      |.+.|+|..+|++..+|+-|...
T Consensus         1 mti~evA~~lGVS~~TLRrw~k~   23 (175)
T PRK13182          1 MKTPFVAKKLGVSPKTVQRWVKQ   23 (175)
T ss_pred             CCHHHHHHHHCcCHHHHHHHHHc
Confidence            67899999999999999988653


No 123
>PRK12529 RNA polymerase sigma factor; Provisional
Probab=59.40  E-value=1.7  Score=25.86  Aligned_cols=27  Identities=4%  Similarity=-0.085  Sum_probs=21.0

Q ss_pred             chhhhhcCCCCCccceeeccccchhHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKW   28 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~   28 (61)
                      ...|+|..||+++..|+.....-+.+.
T Consensus       145 s~~EIA~~lgis~~tVk~~l~rAl~~~  171 (178)
T PRK12529        145 KQKDIAQALDIALPTVKKYIHQAYVTC  171 (178)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHHHHHH
Confidence            467999999999999998766444443


No 124
>cd04766 HTH_HspR Helix-Turn-Helix DNA binding domain of the HspR transcription regulator. Helix-turn-helix (HTH) transcription regulator HspR, N-terminal domain. Heat shock protein regulators (HspR) have been shown to regulate expression of specific regulons in response to high temperature or high osmolarity in Streptomyces and Helicobacter, respectively. These proteins share the N-terminal DNA binding domain  with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements.  A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.
Probab=58.84  E-value=1.4  Score=23.86  Aligned_cols=22  Identities=0%  Similarity=0.015  Sum_probs=18.8

Q ss_pred             CchhhhhcCCCCCccceeeccc
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      +-+-++|..+|++..+|+-|-+
T Consensus         2 ~~i~e~A~~~gvs~~tLr~ye~   23 (91)
T cd04766           2 YVISVAAELSGMHPQTLRLYER   23 (91)
T ss_pred             cCHHHHHHHHCcCHHHHHHHHH
Confidence            3578999999999999999954


No 125
>PRK08301 sporulation sigma factor SigE; Reviewed
Probab=58.81  E-value=1.9  Score=26.80  Aligned_cols=29  Identities=10%  Similarity=-0.132  Sum_probs=21.3

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKK   30 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr   30 (61)
                      -..|+|..+|+++.+|+.+...=+.+-|+
T Consensus       200 s~~EIA~~lgis~~tVk~~~~rA~~~Lr~  228 (234)
T PRK08301        200 TQKEVADMLGISQSYISRLEKRIIKRLKK  228 (234)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHHHHHHHH
Confidence            46799999999999998775544444433


No 126
>PRK12533 RNA polymerase sigma factor; Provisional
Probab=58.54  E-value=3.6  Score=25.63  Aligned_cols=31  Identities=3%  Similarity=-0.156  Sum_probs=23.9

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHHh
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKEH   32 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~~   32 (61)
                      -..|+|..||+++..|++....-|.+-++.-
T Consensus       152 s~~EIAe~LgiS~~tVk~~L~RAr~~Lr~~l  182 (216)
T PRK12533        152 SYREIAAIADVPVGTVMSRLARARRRLAALL  182 (216)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHHHHHHHHHH
Confidence            4679999999999999988775555555543


No 127
>PRK09640 RNA polymerase sigma factor SigX; Reviewed
Probab=58.43  E-value=1.9  Score=25.78  Aligned_cols=29  Identities=7%  Similarity=-0.015  Sum_probs=22.0

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKK   30 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr   30 (61)
                      -..|+|..+|+++..|+++...-+.+-|.
T Consensus       152 s~~EIA~~lgis~~tV~~~l~Ra~~~Lr~  180 (188)
T PRK09640        152 EFQEIADIMHMGLSATKMRYKRALDKLRE  180 (188)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHHHHHHHH
Confidence            46799999999999999886644444443


No 128
>smart00530 HTH_XRE Helix-turn-helix XRE-family like proteins.
Probab=58.09  E-value=1.7  Score=19.50  Aligned_cols=23  Identities=4%  Similarity=-0.138  Sum_probs=19.4

Q ss_pred             hhhhhcCCCCCccceeeccccch
Q psy12003          3 LLRDKNPPRGTERQIKIWFQNRR   25 (61)
Q Consensus         3 ~~eLA~~l~Lte~~VqvWFqNrR   25 (61)
                      ..+||..+++++..|.-|..+++
T Consensus        13 ~~~la~~~~i~~~~i~~~~~~~~   35 (56)
T smart00530       13 QEELAEKLGVSRSTLSRIENGKR   35 (56)
T ss_pred             HHHHHHHhCCCHHHHHHHHCCCC
Confidence            56899999999999988877664


No 129
>PRK12513 RNA polymerase sigma factor; Provisional
Probab=57.95  E-value=2  Score=25.71  Aligned_cols=30  Identities=13%  Similarity=0.020  Sum_probs=22.2

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKE   31 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~   31 (61)
                      -..|+|..+|++...|+.....=|.+-|+.
T Consensus       157 s~~EIA~~lgis~~tV~~~l~ra~~~Lr~~  186 (194)
T PRK12513        157 ELEEIAELTGVPEETVKSRLRYALQKLREL  186 (194)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHHHHHHHHH
Confidence            367999999999999997665545444443


No 130
>smart00421 HTH_LUXR helix_turn_helix, Lux Regulon. lux regulon (activates the bioluminescence operon
Probab=57.39  E-value=1.2  Score=20.89  Aligned_cols=21  Identities=10%  Similarity=-0.018  Sum_probs=17.3

Q ss_pred             chhhhhcCCCCCccceeeccc
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      ...|+|..++++..+|..+.+
T Consensus        20 s~~eia~~l~is~~tv~~~~~   40 (58)
T smart00421       20 TNKEIAERLGISEKTVKTHLS   40 (58)
T ss_pred             CHHHHHHHHCCCHHHHHHHHH
Confidence            457899999999999987655


No 131
>cd08313 Death_TNFR1 Death domain of Tumor Necrosis Factor Receptor 1. Death Domain (DD) found in tumor necrosis factor receptor-1 (TNFR-1). TNFR-1 has many names including TNFRSF1A, CD120a, p55, p60, and TNFR60. It activates two major intracellular signaling pathways that lead to the activation of the transcription factor NF-kB and the induction of cell death. Upon binding of its ligand TNF, TNFR-1 trimerizes which leads to the recruitment of an adaptor protein named TNFR-associated death domain protein (TRADD) through a DD/DD interaction. Mutations in the TNFRSF1A gene causes TNFR-associated periodic syndrome (TRAPS), a rare disorder characterized recurrent fever, myalgia, abdominal pain, conjunctivitis and skin eruptions. DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation a
Probab=57.13  E-value=2.3  Score=23.05  Aligned_cols=15  Identities=7%  Similarity=-0.104  Sum_probs=13.3

Q ss_pred             hhhhcCCCCCcccee
Q psy12003          4 LRDKNPPRGTERQIK   18 (61)
Q Consensus         4 ~eLA~~l~Lte~~Vq   18 (61)
                      .++|++|||+|..|.
T Consensus        15 k~~~R~LGlse~~Id   29 (80)
T cd08313          15 KEFVRRLGLSDNEIE   29 (80)
T ss_pred             HHHHHHcCCCHHHHH
Confidence            578999999999887


No 132
>TIGR02044 CueR Cu(I)-responsive transcriptional regulator. This model represents the copper-, silver- and gold- (I) responsive transcriptional activator of the gamma proteobacterial copper efflux system. This protein is a member of the MerR family of transcriptional activators (pfam00376) and contains a distinctive pattern of cysteine residues in its metal binding loop, Cys-X7-Cys. This family also lacks a conserved cysteine at the N-terminal end of the dimerization helix which is required for the binding of divalent metals such as zinc; here it is replaced by a serine residue.
Probab=57.07  E-value=1.7  Score=25.00  Aligned_cols=22  Identities=14%  Similarity=0.141  Sum_probs=19.2

Q ss_pred             CchhhhhcCCCCCccceeeccc
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      |.|-|+|..+|+|..+++-|-+
T Consensus         1 m~I~e~a~~~gvs~~tlRyYe~   22 (127)
T TIGR02044         1 MNIGQVAKLTGLSSKMIRYYEE   22 (127)
T ss_pred             CCHHHHHHHHCcCHHHHHHHHH
Confidence            6788999999999999998744


No 133
>cd01105 HTH_GlnR-like Helix-Turn-Helix DNA binding domain of GlnR-like transcription regulators. Helix-turn-helix (HTH) transcription regulator GlnR and related proteins, N-terminal domain. The GlnR and TnrA (also known as ScgR) proteins have been shown to regulate expression of glutamine synthetase as well as several genes involved in nitrogen metabolism. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements.  A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.
Probab=56.83  E-value=1.6  Score=23.61  Aligned_cols=20  Identities=15%  Similarity=0.345  Sum_probs=17.7

Q ss_pred             CchhhhhcCCCCCccceeec
Q psy12003          1 MNLLRDKNPPRGTERQIKIW   20 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvW   20 (61)
                      +-+.|+|..+|++..+++-|
T Consensus         2 ~ti~evA~~~gvs~~tLR~y   21 (88)
T cd01105           2 IGIGEVSKLTGVSPRQLRYW   21 (88)
T ss_pred             cCHHHHHHHHCcCHHHHHHH
Confidence            35789999999999999988


No 134
>PRK12541 RNA polymerase sigma factor; Provisional
Probab=56.71  E-value=1.6  Score=25.29  Aligned_cols=28  Identities=14%  Similarity=0.009  Sum_probs=20.9

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWK   29 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~k   29 (61)
                      ...|+|..+|+++..|++....-|.+-+
T Consensus       130 s~~eIA~~lgis~~tv~~~l~Rar~~L~  157 (161)
T PRK12541        130 SYKEIAEMTGLSLAKVKIELHRGRKETK  157 (161)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHHHHHHH
Confidence            4578999999999999987654444433


No 135
>TIGR02859 spore_sigH RNA polymerase sigma-H factor. Members of this protein family are RNA polymerase sigma-H factor for sporulation in endospore-forming bacteria. This protein is also called Sigma-30 and SigH. Although rather close homologs are detected in Listeria, Listeria does not form spores and the role of the related sigma factor in that genus is in doubt.
Probab=56.55  E-value=2  Score=25.58  Aligned_cols=21  Identities=10%  Similarity=-0.100  Sum_probs=17.6

Q ss_pred             chhhhhcCCCCCccceeeccc
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      -+.|+|..+|+++.+|++.+.
T Consensus       167 s~~eIA~~l~~s~~tV~~~l~  187 (198)
T TIGR02859       167 SYQEIACDLNRHVKSIDNALQ  187 (198)
T ss_pred             CHHHHHHHHCCCHHHHHHHHH
Confidence            367899999999999987655


No 136
>PF06505 XylR_N:  Activator of aromatic catabolism;  InterPro: IPR010523 This domain is found at the N terminus of a subset of sigma54-dependent transcriptional activators in several proteobacteria, including activators of phenol degradation such as XylR. It is found adjacent to IPR004096 from INTERPRO.
Probab=56.53  E-value=3.4  Score=23.43  Aligned_cols=22  Identities=23%  Similarity=0.403  Sum_probs=18.0

Q ss_pred             hhhcCCCCCccceeeccccchh
Q psy12003          5 RDKNPPRGTERQIKIWFQNRRM   26 (61)
Q Consensus         5 eLA~~l~Lte~~VqvWFqNrRa   26 (61)
                      +|+..|..++..=+|||.++|+
T Consensus         1 DL~~~L~F~p~~G~Iwl~~~Rm   22 (103)
T PF06505_consen    1 DLRELLRFSPEDGRIWLNGQRM   22 (103)
T ss_pred             ChHHheeEeCCCCeEEECCEEE
Confidence            3666778888889999999986


No 137
>PRK03975 tfx putative transcriptional regulator; Provisional
Probab=56.46  E-value=2  Score=25.75  Aligned_cols=32  Identities=6%  Similarity=-0.044  Sum_probs=25.7

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHHhh
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKEHK   33 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~~~   33 (61)
                      -..|+|..||++...|..|-+.-+.|.++...
T Consensus        23 Tq~EIAe~LGiS~~tVs~ie~ra~kkLr~~~~   54 (141)
T PRK03975         23 TQQEIADILGTSRANVSSIEKRARENIEKARE   54 (141)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHH
Confidence            35789999999999999998877776666543


No 138
>PRK12523 RNA polymerase sigma factor; Reviewed
Probab=56.45  E-value=2  Score=25.32  Aligned_cols=28  Identities=0%  Similarity=-0.095  Sum_probs=21.6

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWK   29 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~k   29 (61)
                      ...|+|..+|+++..|++....-+.+.+
T Consensus       137 s~~EIA~~lgis~~tV~~~l~ra~~~~~  164 (172)
T PRK12523        137 GHAEIAERLGVSVSRVRQYLAQGLRQCY  164 (172)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHHHHHHH
Confidence            4579999999999999988764444443


No 139
>PRK06930 positive control sigma-like factor; Validated
Probab=56.31  E-value=2  Score=26.13  Aligned_cols=30  Identities=3%  Similarity=-0.027  Sum_probs=23.8

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKE   31 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~   31 (61)
                      -..|+|..+|+++.+|+.+...-+.|-++.
T Consensus       132 s~~EIA~~lgiS~~tVk~~l~Ra~~kLr~~  161 (170)
T PRK06930        132 SYSEIADYLNIKKSTVQSMIERAEKKIARQ  161 (170)
T ss_pred             CHHHHHHHHCcCHHHHHHHHHHHHHHHHHH
Confidence            457899999999999999877666655554


No 140
>PF05331 DUF742:  Protein of unknown function (DUF742);  InterPro: IPR007995 This family consists of several uncharacterised Streptomyces proteins as well as one from Mycobacterium tuberculosis. The function of these proteins is unknown.
Probab=56.28  E-value=4.2  Score=23.54  Aligned_cols=18  Identities=0%  Similarity=-0.165  Sum_probs=16.2

Q ss_pred             hhhhhcCCCCCccceeec
Q psy12003          3 LLRDKNPPRGTERQIKIW   20 (61)
Q Consensus         3 ~~eLA~~l~Lte~~VqvW   20 (61)
                      ++|+|..++|+-..|+|-
T Consensus        58 VAEiAA~L~lPlgVvrVL   75 (114)
T PF05331_consen   58 VAEIAARLGLPLGVVRVL   75 (114)
T ss_pred             HHHHHHhhCCCchhhhhh
Confidence            789999999999999874


No 141
>cd01279 HTH_HspR-like Helix-Turn-Helix DNA binding domain of HspR-like transcription regulators. Helix-turn-helix (HTH) transcription regulator HspR and related proteins, N-terminal domain. Heat shock protein regulators (HspR) have been shown to regulate expression of specific regulons in response to high temperature or high osmolarity in Streptomyces and Helicobacter, respectively. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.
Probab=56.04  E-value=1.6  Score=24.13  Aligned_cols=22  Identities=0%  Similarity=-0.026  Sum_probs=19.1

Q ss_pred             CchhhhhcCCCCCccceeeccc
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      +.|.|+|..+|++..+++-|-+
T Consensus         2 ~~i~eva~~~gVs~~tLR~ye~   23 (98)
T cd01279           2 YPISVAAELLGIHPQTLRVYDR   23 (98)
T ss_pred             cCHHHHHHHHCcCHHHHHHHHH
Confidence            4688999999999999998844


No 142
>PRK12522 RNA polymerase sigma factor; Provisional
Probab=55.73  E-value=2.6  Score=24.79  Aligned_cols=28  Identities=4%  Similarity=-0.072  Sum_probs=21.1

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWK   29 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~k   29 (61)
                      ...|+|..+|+++..|++....-|.+-+
T Consensus       137 s~~EIA~~lgis~~tV~~~l~Ra~~~Lr  164 (173)
T PRK12522        137 SYKEMSEILNIPIGTVKYRLNYAKKQMR  164 (173)
T ss_pred             CHHHHHHHhCCCHHHHHHHHHHHHHHHH
Confidence            4679999999999999987654444433


No 143
>cd04789 HTH_Cfa Helix-Turn-Helix DNA binding domain of the Cfa transcription regulator. Putative helix-turn-helix (HTH) MerR-like transcription regulator; the N-terminal domain of Cfa, a cyclopropane fatty acid synthase and other related methyltransferases. Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.
Probab=55.57  E-value=1.8  Score=24.04  Aligned_cols=22  Identities=0%  Similarity=-0.066  Sum_probs=18.6

Q ss_pred             CchhhhhcCCCCCccceeeccc
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      |-+-|+|+.+|++..+++-|-+
T Consensus         2 ~~i~eva~~~gvs~~tlR~ye~   23 (102)
T cd04789           2 YTISELAEKAGISRSTLLYYEK   23 (102)
T ss_pred             CCHHHHHHHHCcCHHHHHHHHH
Confidence            4578999999999999998744


No 144
>PRK08295 RNA polymerase factor sigma-70; Validated
Probab=55.18  E-value=2.3  Score=25.57  Aligned_cols=29  Identities=14%  Similarity=0.032  Sum_probs=21.4

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKK   30 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr   30 (61)
                      ...|+|..+|+++..|++-...-|.+-++
T Consensus       172 s~~EIA~~lgis~~tV~~~l~rar~~Lr~  200 (208)
T PRK08295        172 SYQEIAEELNRHVKSIDNALQRVKRKLEK  200 (208)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHHHHHHHH
Confidence            35789999999999998765544444444


No 145
>cd01282 HTH_MerR-like_sg3 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily. Putative helix-turn-helix (HTH) MerR-like transcription regulators (subgroup 3). Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.
Probab=55.09  E-value=1.9  Score=24.29  Aligned_cols=22  Identities=9%  Similarity=0.075  Sum_probs=19.3

Q ss_pred             CchhhhhcCCCCCccceeeccc
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      |-|-|+|..+|+|..+++-|-+
T Consensus         1 m~i~eva~~~gvs~~tlR~Ye~   22 (112)
T cd01282           1 MRIGELAARTGVSVRSLRYYEE   22 (112)
T ss_pred             CCHHHHHHHHCCCHHHHHHHHH
Confidence            5688999999999999998854


No 146
>PRK12539 RNA polymerase sigma factor; Provisional
Probab=54.98  E-value=2.4  Score=25.22  Aligned_cols=29  Identities=7%  Similarity=0.032  Sum_probs=21.7

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKK   30 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr   30 (61)
                      ...|+|..+|++...|+.....-+.+-|+
T Consensus       149 s~~eIA~~lgis~~tV~~~l~ra~~~Lr~  177 (184)
T PRK12539        149 SVAEAATRSGMSESAVKVSVHRGLKALAA  177 (184)
T ss_pred             cHHHHHHHHCcCHHHHHHHHHHHHHHHHH
Confidence            46799999999999999876544444433


No 147
>cd01109 HTH_YyaN Helix-Turn-Helix DNA binding domain of the MerR-like transcription regulators YyaN and YraB. Putative helix-turn-helix (HTH) MerR-like transcription regulators of Bacillus subtilis, YyaN and YraB, and related proteins; N-terminal domain. Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.
Probab=54.98  E-value=2  Score=24.13  Aligned_cols=21  Identities=0%  Similarity=-0.009  Sum_probs=18.3

Q ss_pred             CchhhhhcCCCCCccceeecc
Q psy12003          1 MNLLRDKNPPRGTERQIKIWF   21 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWF   21 (61)
                      |-|-|+|..+|++..+++-|-
T Consensus         1 ~~i~e~a~~~gvs~~tlr~ye   21 (113)
T cd01109           1 YTIKEVAEKTGLSADTLRYYE   21 (113)
T ss_pred             CCHHHHHHHHCcCHHHHHHHH
Confidence            457899999999999999883


No 148
>PRK09647 RNA polymerase sigma factor SigE; Reviewed
Probab=54.92  E-value=3.1  Score=25.58  Aligned_cols=30  Identities=3%  Similarity=-0.058  Sum_probs=23.1

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKE   31 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~   31 (61)
                      ...|+|..||+++..|+++..-=|.+-++.
T Consensus       156 s~~EIA~~Lgis~~tV~~~l~RArk~Lr~~  185 (203)
T PRK09647        156 SYEEIAATLGVKLGTVRSRIHRGRQQLRAA  185 (203)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHHHHHHHHH
Confidence            467999999999999998876555554443


No 149
>cd04786 HTH_MerR-like_sg7 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily. Putative helix-turn-helix (HTH) MerR-like transcription regulators (subgroup 7) with a conserved cysteine present in the C-terminal portion of the protein. Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic su
Probab=54.81  E-value=2  Score=25.10  Aligned_cols=20  Identities=10%  Similarity=0.152  Sum_probs=18.2

Q ss_pred             CchhhhhcCCCCCccceeec
Q psy12003          1 MNLLRDKNPPRGTERQIKIW   20 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvW   20 (61)
                      |-|-|+|..+|+|..+++-|
T Consensus         1 m~Ige~a~~~gvs~~tLRyY   20 (131)
T cd04786           1 MKIGELAKRSGMAASRIRFY   20 (131)
T ss_pred             CCHHHHHHHHCcCHHHHHHH
Confidence            67889999999999999887


No 150
>TIGR02943 Sig70_famx1 RNA polymerase sigma-70 factor, TIGR02943 family. This group of sigma factors are members of the sigma-70 family (TIGR02937). They and appear by homology, tree building, bidirectional best hits and one-to-a-genome distribution, to represent a conserved family.
Probab=54.55  E-value=2.5  Score=25.46  Aligned_cols=31  Identities=3%  Similarity=-0.062  Sum_probs=22.7

Q ss_pred             CchhhhhcCCCCCccceeeccccchhHHHHH
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQNRRMKWKKE   31 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFqNrRak~kr~   31 (61)
                      +...|+|..+|+++..|++...--|.+-|+.
T Consensus       148 ~s~~EIA~~lgis~~tvk~rl~Rar~~Lr~~  178 (188)
T TIGR02943       148 FESDEICQELEISTSNCHVLLYRARLSLRAC  178 (188)
T ss_pred             CCHHHHHHHhCCCHHHHHHHHHHHHHHHHHH
Confidence            3578999999999999987665444444443


No 151
>PRK12524 RNA polymerase sigma factor; Provisional
Probab=54.41  E-value=2.4  Score=25.58  Aligned_cols=30  Identities=0%  Similarity=-0.257  Sum_probs=23.2

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKE   31 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~   31 (61)
                      ...|+|..+|+++.+|+.+..--|.+-|+.
T Consensus       154 s~~eIA~~lgis~~tV~~~l~Ra~~~Lr~~  183 (196)
T PRK12524        154 SNPEIAEVMEIGVEAVESLTARGKRALAAL  183 (196)
T ss_pred             CHHHHHHHHCcCHHHHHHHHHHHHHHHHHH
Confidence            467999999999999998877555555444


No 152
>TIGR03001 Sig-70_gmx1 RNA polymerase sigma-70 factor, Myxococcales family 1. This group of sigma factors are members of the sigma-70 family (TIGR02937) and are found in multiple copies in the order Myxococcales. This model supercedes TIGR02233, which has now been retired.
Probab=54.39  E-value=2.9  Score=26.64  Aligned_cols=31  Identities=10%  Similarity=0.117  Sum_probs=25.1

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHHh
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKEH   32 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~~   32 (61)
                      -..|+|..+|+++..|+++...-|.+-|+.-
T Consensus       179 S~~EIA~~Lgis~~TVk~rl~RAr~~Lr~~l  209 (244)
T TIGR03001       179 SMDRIGAMYQVHRSTVSRWVAQARERLLERT  209 (244)
T ss_pred             CHHHHHHHHCcCHHHHHHHHHHHHHHHHHHH
Confidence            4679999999999999998886666665553


No 153
>PRK12545 RNA polymerase sigma factor; Provisional
Probab=54.37  E-value=3.9  Score=24.85  Aligned_cols=30  Identities=7%  Similarity=-0.028  Sum_probs=22.6

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKE   31 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~   31 (61)
                      -..|+|..+|+++..|++....-|.+-|+.
T Consensus       157 s~~EIA~~lgis~~tVk~~l~RAr~~Lr~~  186 (201)
T PRK12545        157 EIDDICTELTLTANHCSVLLYRARTRLRTC  186 (201)
T ss_pred             CHHHHHHHHCcCHHHHHHHHHHHHHHHHHH
Confidence            467999999999999998766444444443


No 154
>cd04779 HTH_MerR-like_sg4 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily. Putative helix-turn-helix (HTH) MerR-like transcription regulators (subgroup 4). Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.
Probab=54.28  E-value=1.9  Score=25.33  Aligned_cols=24  Identities=8%  Similarity=0.007  Sum_probs=20.4

Q ss_pred             CchhhhhcCCCCCccceeeccccc
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQNR   24 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFqNr   24 (61)
                      |-|-|+|..+|++..+|+-|.+..
T Consensus         1 y~I~e~a~~~gvs~~TLR~Ye~~G   24 (134)
T cd04779           1 YRIGQLAHLAGVSKRTIDYYTNLG   24 (134)
T ss_pred             CCHHHHHHHHCcCHHHHHHHHHCC
Confidence            457899999999999999997644


No 155
>PRK12546 RNA polymerase sigma factor; Provisional
Probab=53.97  E-value=2.6  Score=25.55  Aligned_cols=30  Identities=7%  Similarity=-0.090  Sum_probs=23.8

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKE   31 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~   31 (61)
                      ...|+|..+|+|+..|++..+-=|.+-|+.
T Consensus       131 s~~EIA~~LgiS~~tVk~~l~Rar~~Lr~~  160 (188)
T PRK12546        131 SYEEAAEMCGVAVGTVKSRANRARARLAEL  160 (188)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHHHHHHHHH
Confidence            457899999999999999887656555554


No 156
>PRK10227 DNA-binding transcriptional regulator CueR; Provisional
Probab=53.94  E-value=2.1  Score=25.14  Aligned_cols=20  Identities=20%  Similarity=0.253  Sum_probs=18.0

Q ss_pred             CchhhhhcCCCCCccceeec
Q psy12003          1 MNLLRDKNPPRGTERQIKIW   20 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvW   20 (61)
                      |-|-|+|..+|++..+|+-|
T Consensus         1 m~Ige~a~~~gvs~~tlRyY   20 (135)
T PRK10227          1 MNISDVAKITGLTSKAIRFY   20 (135)
T ss_pred             CCHHHHHHHHCcCHHHHHHH
Confidence            67889999999999999877


No 157
>PRK12511 RNA polymerase sigma factor; Provisional
Probab=53.69  E-value=2.8  Score=25.25  Aligned_cols=31  Identities=3%  Similarity=-0.134  Sum_probs=22.7

Q ss_pred             CchhhhhcCCCCCccceeeccccchhHHHHH
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQNRRMKWKKE   31 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFqNrRak~kr~   31 (61)
                      +...|+|..+|+++..|++...--|.+-++.
T Consensus       128 ~s~~EIA~~lgis~~tV~~~l~Rar~~Lr~~  158 (182)
T PRK12511        128 LSYQEAAAVLGIPIGTLMSRIGRARAALRAF  158 (182)
T ss_pred             CCHHHHHHHhCcCHHHHHHHHHHHHHHHHHH
Confidence            3567999999999999998765444444443


No 158
>PRK09649 RNA polymerase sigma factor SigC; Reviewed
Probab=53.50  E-value=2.3  Score=25.51  Aligned_cols=21  Identities=5%  Similarity=-0.141  Sum_probs=18.1

Q ss_pred             chhhhhcCCCCCccceeeccc
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      ...|+|..+|+++..|++...
T Consensus       148 s~~EIA~~lgis~~tVk~~l~  168 (185)
T PRK09649        148 SYADAAAVCGCPVGTIRSRVA  168 (185)
T ss_pred             CHHHHHHHHCCCHHHHHHHHH
Confidence            467999999999999998764


No 159
>PF07638 Sigma70_ECF:  ECF sigma factor
Probab=53.38  E-value=2.5  Score=25.59  Aligned_cols=24  Identities=13%  Similarity=0.111  Sum_probs=18.5

Q ss_pred             chhhhhcCCCCCccceeeccccch
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRR   25 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrR   25 (61)
                      ...|+|..+|+++.+|+-.++.=|
T Consensus       153 s~~EIA~~lgiS~~tV~r~l~~aR  176 (185)
T PF07638_consen  153 SVEEIAERLGISERTVRRRLRRAR  176 (185)
T ss_pred             CHHHHHHHHCcCHHHHHHHHHHHH
Confidence            467999999999999985444334


No 160
>PF04967 HTH_10:  HTH DNA binding domain;  InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif. This entry represents the HTH DNA binding domain found in Halobacterium salinarium (Halobacterium halobium) and described as a putative bacterio-opsin activator. 
Probab=53.31  E-value=2.7  Score=21.11  Aligned_cols=17  Identities=6%  Similarity=-0.076  Sum_probs=13.9

Q ss_pred             chhhhhcCCCCCcccee
Q psy12003          2 NLLRDKNPPRGTERQIK   18 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~Vq   18 (61)
                      .+.|||..||++...+-
T Consensus        25 tl~elA~~lgis~st~~   41 (53)
T PF04967_consen   25 TLEELAEELGISKSTVS   41 (53)
T ss_pred             CHHHHHHHhCCCHHHHH
Confidence            47899999999987663


No 161
>TIGR02054 MerD mercuric resistence transcriptional repressor protein MerD. This model represents a transcriptional repressor protein of the MerR family (pfam00376) whose expression is regulated by the mercury-sensitive transcriptional activator, MerR. MerD has been shown to repress the transcription of the mer operon.
Probab=52.72  E-value=2.2  Score=24.70  Aligned_cols=22  Identities=5%  Similarity=0.043  Sum_probs=18.7

Q ss_pred             CchhhhhcCCCCCccceeeccc
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      |-|-|||..+|++..+|+.|-+
T Consensus         4 ~tI~elA~~~gvs~~tlR~Ye~   25 (120)
T TIGR02054         4 YTISRLAEDAGVSVHVVRDYLL   25 (120)
T ss_pred             CcHHHHHHHHCcCHHHHHHHHH
Confidence            3678999999999999998843


No 162
>PF07022 Phage_CI_repr:  Bacteriophage CI repressor helix-turn-helix domain;  InterPro: IPR010744 This family consists of several phage CI repressor proteins and related bacterial sequences. The CI repressor is known to function as a transcriptional switch, determining whether transcription is lytic or lysogenic [].; GO: 0003677 DNA binding, 0045892 negative regulation of transcription, DNA-dependent; PDB: 2FJR_B.
Probab=52.52  E-value=2.5  Score=21.63  Aligned_cols=22  Identities=5%  Similarity=0.006  Sum_probs=16.6

Q ss_pred             hhhhcCCCCCcccee-eccccch
Q psy12003          4 LRDKNPPRGTERQIK-IWFQNRR   25 (61)
Q Consensus         4 ~eLA~~l~Lte~~Vq-vWFqNrR   25 (61)
                      .+||..+|++...|. .|.....
T Consensus        16 ~~lA~~lgis~st~s~~~~~r~~   38 (66)
T PF07022_consen   16 KELAERLGISKSTLSNNWKKRGS   38 (66)
T ss_dssp             HHHHCCTT--HHHHH-HHHHSSS
T ss_pred             HHHHHHhCcCHHHhhHHHHhCCC
Confidence            589999999999999 8876444


No 163
>PRK07037 extracytoplasmic-function sigma-70 factor; Validated
Probab=52.43  E-value=2.7  Score=24.31  Aligned_cols=21  Identities=0%  Similarity=-0.138  Sum_probs=17.7

Q ss_pred             chhhhhcCCCCCccceeeccc
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      -..|+|..+|+++.+|+....
T Consensus       127 s~~EIA~~lgis~~tV~~~l~  147 (163)
T PRK07037        127 TQKDIARELGVSPTLVNFMIR  147 (163)
T ss_pred             CHHHHHHHHCCCHHHHHHHHH
Confidence            467999999999999997644


No 164
>PRK12531 RNA polymerase sigma factor; Provisional
Probab=52.35  E-value=3  Score=25.11  Aligned_cols=26  Identities=8%  Similarity=-0.227  Sum_probs=19.5

Q ss_pred             chhhhhcCCCCCccceeeccccchhH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMK   27 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak   27 (61)
                      ...|+|..+|++...|++-...-|.+
T Consensus       159 s~~EIA~~lgis~~tVk~rl~ra~~~  184 (194)
T PRK12531        159 PHQQVAEMFDIPLGTVKSRLRLAVEK  184 (194)
T ss_pred             CHHHHHHHhCcCHHHHHHHHHHHHHH
Confidence            46799999999999998665433333


No 165
>TIGR03826 YvyF flagellar operon protein TIGR03826. This gene is found in flagellar operons of Bacillus-related organisms. Its function has not been determined and an official gene symbol has not been assigned, although the gene is designated yvyF in B. subtilus. A tentative assignment as a regulator is suggested in the NCBI record GI:16080597.
Probab=51.84  E-value=2.3  Score=25.39  Aligned_cols=25  Identities=12%  Similarity=0.146  Sum_probs=20.6

Q ss_pred             chhhhhcCCCCCccceeeccccchh
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRM   26 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRa   26 (61)
                      .+.|+|..||+++..|.-|....|-
T Consensus        48 ti~eV~e~tgVs~~~I~~~IreGRL   72 (137)
T TIGR03826        48 TVSEIVEETGVSEKLILKFIREGRL   72 (137)
T ss_pred             CHHHHHHHHCcCHHHHHHHHHcCCe
Confidence            5789999999999999988665443


No 166
>cd06170 LuxR_C_like C-terminal DNA-binding domain of LuxR-like proteins. This domain contains a helix-turn-helix motif and binds DNA. Proteins belonging to this group are response regulators; some act as transcriptional activators, others as transcriptional repressors. Many are active as homodimers. Many are two domain proteins in which the DNA binding property of the C-terminal DNA binding domain is modulated by modifications of the N-terminal domain.  For example in the case of Lux R which participates in the regulation of gene expression in response to fluctuations in cell-population density (quorum-sensing), a signaling molecule, the pheromone Acyl HSL (N-acyl derivatives of homoserine lactone), binds to the N-terminal domain and leads to LuxR dimerization.  For others phophorylation of the N-terminal domain leads to multimerization, for example Escherichia coli NarL and Sinorhizobium melilot FixJ. NarL controls gene expression of many respiratory-related operons when environmental
Probab=51.83  E-value=2.3  Score=20.06  Aligned_cols=21  Identities=10%  Similarity=-0.004  Sum_probs=17.4

Q ss_pred             chhhhhcCCCCCccceeeccc
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      ...++|..+++++.+|..|..
T Consensus        17 s~~eia~~l~~s~~tv~~~~~   37 (57)
T cd06170          17 TNKEIADILGISEKTVKTHLR   37 (57)
T ss_pred             CHHHHHHHHCCCHHHHHHHHH
Confidence            456889999999999987754


No 167
>cd04775 HTH_Cfa-like Helix-Turn-Helix DNA binding domain of Cfa-like transcription regulators. Putative helix-turn-helix (HTH) MerR-like transcription regulators; the HTH domain of Cfa, a cyclopropane fatty acid synthase, and other related methyltransferases, as well as, the N-terminal domain of a conserved, uncharacterized ~172 a.a. protein. Based on sequence similarity of the N-terminal domain, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimil
Probab=51.81  E-value=2.2  Score=23.61  Aligned_cols=21  Identities=0%  Similarity=-0.137  Sum_probs=17.9

Q ss_pred             chhhhhcCCCCCccceeeccc
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      -|-|+|..+|+|..+++-|-+
T Consensus         3 ~i~eva~~~gvs~~tLR~ye~   23 (102)
T cd04775           3 TIGQMSRKFGVSRSTLLYYES   23 (102)
T ss_pred             CHHHHHHHHCcCHHHHHHHHH
Confidence            578999999999999988743


No 168
>PRK13919 putative RNA polymerase sigma E protein; Provisional
Probab=51.79  E-value=3.1  Score=24.65  Aligned_cols=21  Identities=5%  Similarity=-0.217  Sum_probs=17.7

Q ss_pred             chhhhhcCCCCCccceeeccc
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      -..|+|..+|+++..|+.+..
T Consensus       153 s~~eIA~~lgis~~~V~~~l~  173 (186)
T PRK13919        153 THREAAQLLGLPLGTLKTRAR  173 (186)
T ss_pred             CHHHHHHHHCcCHHHHHHHHH
Confidence            457899999999999987655


No 169
>PRK06811 RNA polymerase factor sigma-70; Validated
Probab=51.79  E-value=2.6  Score=25.23  Aligned_cols=29  Identities=17%  Similarity=0.050  Sum_probs=21.1

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKK   30 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr   30 (61)
                      -..|+|..+|+++..|+...+--|.+-|+
T Consensus       149 s~~EIAe~lgis~~~V~~~l~Ra~~~Lr~  177 (189)
T PRK06811        149 KIEEIAKKLGLTRSAIDNRLSRGRKKLQK  177 (189)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHHHHHHHH
Confidence            46799999999999998765544444443


No 170
>smart00354 HTH_LACI helix_turn _helix lactose operon repressor.
Probab=51.76  E-value=2.4  Score=21.87  Aligned_cols=24  Identities=0%  Similarity=-0.076  Sum_probs=20.8

Q ss_pred             chhhhhcCCCCCccceeeccccch
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRR   25 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrR   25 (61)
                      .+.+||+.+|++..+|--.+.+++
T Consensus         2 t~~~iA~~~gvS~~TVSr~ln~~~   25 (70)
T smart00354        2 TIKDVARLAGVSKATVSRVLNGNG   25 (70)
T ss_pred             CHHHHHHHHCCCHHHHHHHHCCCC
Confidence            578999999999999988888764


No 171
>PRK09638 RNA polymerase sigma factor SigY; Reviewed
Probab=51.65  E-value=3.2  Score=24.28  Aligned_cols=21  Identities=10%  Similarity=-0.113  Sum_probs=17.7

Q ss_pred             chhhhhcCCCCCccceeeccc
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      ...|+|..+|+++..|+.+..
T Consensus       144 s~~eIA~~l~is~~~V~~~l~  164 (176)
T PRK09638        144 TYEEIAKMLNIPEGTVKSRVH  164 (176)
T ss_pred             CHHHHHHHHCCChhHHHHHHH
Confidence            467899999999999987654


No 172
>PF13551 HTH_29:  Winged helix-turn helix
Probab=51.46  E-value=1.6  Score=23.69  Aligned_cols=21  Identities=10%  Similarity=0.205  Sum_probs=18.4

Q ss_pred             chhhhhcCCCCCccceeeccc
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      .+.++|..+|++..+|.-|.+
T Consensus        14 ~~~~ia~~lg~s~~Tv~r~~~   34 (112)
T PF13551_consen   14 TIAEIARRLGISRRTVYRWLK   34 (112)
T ss_pred             cHHHHHHHHCcCHHHHHHHHH
Confidence            378999999999999998865


No 173
>TIGR02047 CadR-PbrR Cd(II)/Pb(II)-responsive transcriptional regulator. This model represents the cadmium(II) and/or lead(II) responsive transcriptional activator of the proteobacterial metal efflux system. This protein is a member of the MerR family of transcriptional activators (pfam00376) and contains a distinctive pattern of cysteine residues in its metal binding loop, Cys-X(6-9)-Cys, as well as a conserved and critical cysteine at the N-terminal end of the dimerization helix.
Probab=51.41  E-value=2.4  Score=24.47  Aligned_cols=22  Identities=9%  Similarity=0.075  Sum_probs=19.2

Q ss_pred             CchhhhhcCCCCCccceeeccc
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      |-|-|+|..+|+|..+|+-|-+
T Consensus         1 m~I~e~a~~~gvs~~tlR~Ye~   22 (127)
T TIGR02047         1 MKIGELAQKTGVSVETIRFYEK   22 (127)
T ss_pred             CcHHHHHHHHCcCHHHHHHHHH
Confidence            6688999999999999998854


No 174
>cd08306 Death_FADD Fas-associated Death Domain protein-protein interaction domain. Death domain (DD) found in FAS-associated via death domain (FADD). FADD is a component of the death-inducing signaling complex (DISC) and serves as an adaptor in the signaling pathway of death receptor proteins. It modulates apoptosis as well as non-apoptotic processes such as cell cycle progression, survival, innate immune signaling, and hematopoiesis. FADD contains an N-terminal DED and a C-terminal DD. Its DD interacts with the DD of the activated death receptor, FAS, and its DED recruits the initiator caspases, caspase-8 and -10, to the DISC complex via a homotypic interaction with the N-terminal DED of the caspase. DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain),
Probab=51.36  E-value=3.5  Score=22.34  Aligned_cols=18  Identities=11%  Similarity=-0.141  Sum_probs=14.8

Q ss_pred             hhhhcCCCCCccceeecc
Q psy12003          4 LRDKNPPRGTERQIKIWF   21 (61)
Q Consensus         4 ~eLA~~l~Lte~~VqvWF   21 (61)
                      -+||+.||+|+..|.---
T Consensus        17 k~laR~LGlse~~Id~i~   34 (86)
T cd08306          17 RKLARKLGLSETKIESIE   34 (86)
T ss_pred             HHHHHHcCCCHHHHHHHH
Confidence            579999999999988433


No 175
>cd01110 HTH_SoxR Helix-Turn-Helix DNA binding domain of the SoxR transcription regulator. Helix-turn-helix (HTH) transcriptional regulator SoxR. The global regulator, SoxR, up-regulates gene expression of another transcription activator, SoxS, which directly stimulates the oxidative stress regulon genes in E. coli. The soxRS response renders the bacterial cell resistant to superoxide-generating agents, macrophage-generated nitric oxide, organic solvents, and antibiotics. The SoxR proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the unusually long spacer between the -35 and -10 promoter elements. They also harbor a regulatory C-terminal domain containing an iron-sulfur center.
Probab=51.08  E-value=2.4  Score=24.92  Aligned_cols=22  Identities=5%  Similarity=-0.000  Sum_probs=18.7

Q ss_pred             CchhhhhcCCCCCccceeeccc
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      |-|-|+|+.+|++..+|+-|-+
T Consensus         2 ~~I~EvA~~~Gvs~~tLRyYE~   23 (139)
T cd01110           2 LSVGEVAKRSGVAVSALHFYEQ   23 (139)
T ss_pred             CCHHHHHHHHCcCHHHHHHHHH
Confidence            4678999999999999998844


No 176
>PF02796 HTH_7:  Helix-turn-helix domain of resolvase;  InterPro: IPR006120 Site-specific recombination plays an important role in DNA rearrangement in prokaryotic organisms. Two types of site-specific recombination are known to occur:  Recombination between inverted repeats resulting in the reversal of a DNA segment. Recombination between repeat sequences on two DNA molecules resulting in their cointegration, or between repeats on one DNA molecule resulting in the excision of a DNA fragment.  Site-specific recombination is characterised by a strand exchange mechanism that requires no DNA synthesis or high energy cofactor; the phosphodiester bond energy is conserved in a phospho-protein linkage during strand cleavage and re-ligation. Two unrelated families of recombinases are currently known []. The first, called the 'phage integrase' family, groups a number of bacterial phage and yeast plasmid enzymes. The second [], called the 'resolvase' family, groups enzymes which share the following structural characteristics: an N-terminal catalytic and dimerization domain that contains a conserved serine residue involved in the transient covalent attachment to DNA IPR006119 from INTERPRO, and a C-terminal helix-turn-helix DNA-binding domain. ; GO: 0000150 recombinase activity, 0003677 DNA binding, 0006310 DNA recombination; PDB: 1ZR2_A 2GM4_B 1RES_A 1ZR4_A 1RET_A 1GDT_B 2R0Q_C 1JKP_C 1IJW_C 1JJ6_C ....
Probab=50.25  E-value=2.9  Score=19.81  Aligned_cols=18  Identities=0%  Similarity=-0.154  Sum_probs=13.2

Q ss_pred             chhhhhcCCCCCccceee
Q psy12003          2 NLLRDKNPPRGTERQIKI   19 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~Vqv   19 (61)
                      -+.++|..+|++.++|.-
T Consensus        23 si~~IA~~~gvsr~TvyR   40 (45)
T PF02796_consen   23 SIAEIAKQFGVSRSTVYR   40 (45)
T ss_dssp             -HHHHHHHTTS-HHHHHH
T ss_pred             CHHHHHHHHCcCHHHHHH
Confidence            478899999999888753


No 177
>PF04552 Sigma54_DBD:  Sigma-54, DNA binding domain;  InterPro: IPR007634 This DNA-binding domain is based on peptide fragmentation data. This domain is proximal to DNA in the promoter/holoenzyme complex. Furthermore, this region contains a putative helix-turn-helix motif. At the C terminus, there is a highly conserved region known as the RpoN box and is the signature of the sigma-54 proteins [].; PDB: 2AHQ_A 2O9L_A 2O8K_A.
Probab=49.89  E-value=5.4  Score=24.22  Aligned_cols=18  Identities=6%  Similarity=-0.001  Sum_probs=0.0

Q ss_pred             CchhhhhcCCCCCcccee
Q psy12003          1 MNLLRDKNPPRGTERQIK   18 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~Vq   18 (61)
                      |-|.++|..|||.+.+|-
T Consensus        50 Lt~~~iA~~lgl~~STVS   67 (160)
T PF04552_consen   50 LTMKDIADELGLHESTVS   67 (160)
T ss_dssp             ------------------
T ss_pred             CCHHHHHHHhCCCHhHHH
Confidence            357899999999999995


No 178
>COG2197 CitB Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription]
Probab=49.85  E-value=3  Score=25.89  Aligned_cols=17  Identities=12%  Similarity=0.018  Sum_probs=14.8

Q ss_pred             hhhhcCCCCCccceeec
Q psy12003          4 LRDKNPPRGTERQIKIW   20 (61)
Q Consensus         4 ~eLA~~l~Lte~~VqvW   20 (61)
                      .|+|.+|+++|.+|++-
T Consensus       167 keIA~~L~iS~~TVk~h  183 (211)
T COG2197         167 KEIAEELNLSEKTVKTH  183 (211)
T ss_pred             HHHHHHHCCCHhHHHHH
Confidence            58899999999999853


No 179
>PF08220 HTH_DeoR:  DeoR-like helix-turn-helix domain;  InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism. This family of prokaryotic regulators is named after the Escherichia coli protein DeoR, a repressor of the deo operon, which encodes nucleotide and deoxyribonucleotide catabolic enzymes. DeoR also negatively regulates the expression of nupG and tsx, a nucleoside-specific transport protein and a channel-forming protein, respectively. DeoR-like transcription repressors occur in diverse bacteria as regulators of sugar and nucleoside metabolic systems. The effector molecules for deoR-like regulators are generally phosphorylated intermediates of the relevant metabolic pathway. The DNA-binding deoR-type HTH domain occurs usually in the N-terminal part. The C-terminal part can contain an effector-binding domain and/or an oligomerisation domain. DeoR occurs as an octamer, whilst glpR and agaR are tetramers. Several operators may be bound simultaneously, which could facilitate DNA looping [, ].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent, 0005622 intracellular
Probab=49.51  E-value=3  Score=20.76  Aligned_cols=17  Identities=12%  Similarity=-0.017  Sum_probs=14.5

Q ss_pred             chhhhhcCCCCCcccee
Q psy12003          2 NLLRDKNPPRGTERQIK   18 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~Vq   18 (61)
                      .+.|||..+++|+.+|+
T Consensus        16 s~~ela~~~~VS~~TiR   32 (57)
T PF08220_consen   16 SVKELAEEFGVSEMTIR   32 (57)
T ss_pred             EHHHHHHHHCcCHHHHH
Confidence            36789999999999885


No 180
>cd02413 40S_S3_KH K homology RNA-binding (KH) domain of the eukaryotic 40S small ribosomal subunit protein S3. S3  is part of the head region of the 40S ribosomal subunit and is believed to interact with mRNA as it threads its way from the latch into the channel.  The KH motif is a beta-alpha-alpha-beta-beta unit that folds into an alpha-beta structure with a three stranded beta-sheet interupted by two contiguous helices.  In general, KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA.
Probab=49.42  E-value=7.1  Score=21.04  Aligned_cols=18  Identities=6%  Similarity=0.023  Sum_probs=15.2

Q ss_pred             hhhcCCCCCccceeeccc
Q psy12003          5 RDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         5 eLA~~l~Lte~~VqvWFq   22 (61)
                      +|...++|.+-+|.||+.
T Consensus        58 ~L~k~~~~~~~~i~v~~~   75 (81)
T cd02413          58 LVQKRFNFPEGSVELYAE   75 (81)
T ss_pred             HHHHHhCCCCCeEEEEEE
Confidence            457778999999999986


No 181
>COG1595 RpoE DNA-directed RNA polymerase specialized sigma subunit, sigma24 homolog [Transcription]
Probab=48.86  E-value=3  Score=24.82  Aligned_cols=31  Identities=10%  Similarity=-0.008  Sum_probs=24.6

Q ss_pred             hhhhhcCCCCCccceeeccccchhHHHHHhh
Q psy12003          3 LLRDKNPPRGTERQIKIWFQNRRMKWKKEHK   33 (61)
Q Consensus         3 ~~eLA~~l~Lte~~VqvWFqNrRak~kr~~~   33 (61)
                      ..|+|..+|++..+|+.+..--|.+.++...
T Consensus       146 ~~EIA~~l~i~~~tVks~l~ra~~~l~~~l~  176 (182)
T COG1595         146 YEEIAEILGISVGTVKSRLHRARKKLREQLE  176 (182)
T ss_pred             HHHHHHHHCCCHHHHHHHHHHHHHHHHHHHh
Confidence            5789999999999999988766666665543


No 182
>PF13936 HTH_38:  Helix-turn-helix domain; PDB: 2W48_A.
Probab=48.63  E-value=2.9  Score=19.81  Aligned_cols=19  Identities=0%  Similarity=-0.146  Sum_probs=12.5

Q ss_pred             chhhhhcCCCCCccceeec
Q psy12003          2 NLLRDKNPPRGTERQIKIW   20 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvW   20 (61)
                      -+.++|..+|.+..+|--+
T Consensus        22 s~~~IA~~lg~s~sTV~re   40 (44)
T PF13936_consen   22 SIREIAKRLGRSRSTVSRE   40 (44)
T ss_dssp             -HHHHHHHTT--HHHHHHH
T ss_pred             CHHHHHHHHCcCcHHHHHH
Confidence            3678999999998887533


No 183
>PRK11922 RNA polymerase sigma factor; Provisional
Probab=48.58  E-value=3.4  Score=25.69  Aligned_cols=31  Identities=10%  Similarity=0.074  Sum_probs=23.7

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHHh
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKEH   32 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~~   32 (61)
                      ...|+|..+|+++.+|++-..--|.|.|+.-
T Consensus       167 s~~EIAe~lgis~~tVk~~l~Rar~kLr~~l  197 (231)
T PRK11922        167 SVEETAQALGLPEETVKTRLHRARRLLRESL  197 (231)
T ss_pred             CHHHHHHHHCcCHHHHHHHHHHHHHHHHHHH
Confidence            4679999999999999987665555555544


No 184
>PHA01976 helix-turn-helix protein
Probab=48.41  E-value=3.1  Score=20.78  Aligned_cols=23  Identities=9%  Similarity=-0.084  Sum_probs=19.4

Q ss_pred             hhhhhcCCCCCccceeeccccch
Q psy12003          3 LLRDKNPPRGTERQIKIWFQNRR   25 (61)
Q Consensus         3 ~~eLA~~l~Lte~~VqvWFqNrR   25 (61)
                      ..+||..+|++...|.-|-..++
T Consensus        18 ~~~lA~~~gvs~~~v~~~e~g~~   40 (67)
T PHA01976         18 APELSRRAGVRHSLIYDFEADKR   40 (67)
T ss_pred             HHHHHHHhCCCHHHHHHHHcCCC
Confidence            46899999999999998877654


No 185
>PRK12540 RNA polymerase sigma factor; Provisional
Probab=48.31  E-value=3.6  Score=24.71  Aligned_cols=29  Identities=14%  Similarity=-0.048  Sum_probs=21.1

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKK   30 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr   30 (61)
                      ...|+|..||+++..|++...-=|.+-++
T Consensus       129 s~~EIA~~Lgis~~tV~~~l~RAr~~Lr~  157 (182)
T PRK12540        129 SYEDAAAICGCAVGTIKSRVNRARSKLSA  157 (182)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHHHHHHHH
Confidence            46799999999999999765533333333


No 186
>PRK11511 DNA-binding transcriptional activator MarA; Provisional
Probab=48.07  E-value=2.2  Score=24.40  Aligned_cols=23  Identities=9%  Similarity=0.151  Sum_probs=19.1

Q ss_pred             chhhhhcCCCCCccceeeccccc
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNR   24 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNr   24 (61)
                      .|.+||..+|++++.+.-+|+.-
T Consensus        27 sl~~lA~~~g~S~~~l~r~Fk~~   49 (127)
T PRK11511         27 SLEKVSERSGYSKWHLQRMFKKE   49 (127)
T ss_pred             CHHHHHHHHCcCHHHHHHHHHHH
Confidence            47899999999999988777654


No 187
>PRK08583 RNA polymerase sigma factor SigB; Validated
Probab=47.97  E-value=3.6  Score=25.96  Aligned_cols=28  Identities=4%  Similarity=-0.093  Sum_probs=21.1

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWK   29 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~k   29 (61)
                      .+.|+|..+|+++.+|+.+...=+.|-|
T Consensus       223 s~~eIA~~l~is~~tV~~~~~ra~~kLr  250 (257)
T PRK08583        223 SQKETGERLGISQMHVSRLQRQAIKKLR  250 (257)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHHHHHHH
Confidence            4679999999999999887654444433


No 188
>PRK04217 hypothetical protein; Provisional
Probab=47.89  E-value=3.2  Score=23.84  Aligned_cols=30  Identities=7%  Similarity=-0.129  Sum_probs=22.7

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKE   31 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~   31 (61)
                      .+.|+|..+|++..+|...+..-+.+-+..
T Consensus        60 S~~EIAk~LGIS~sTV~r~L~RArkkLre~   89 (110)
T PRK04217         60 TQEEAGKRMGVSRGTVWRALTSARKKVAQM   89 (110)
T ss_pred             CHHHHHHHHCcCHHHHHHHHHHHHHHHHHH
Confidence            467999999999999997776555554443


No 189
>TIGR01950 SoxR redox-sensitive transcriptional activator SoxR. SoxR is a MerR-family homodimeric transcription factor with a 2Fe-2S cluster in each monomer. The motif CIGCGCxxxxxC is conserved. Oxidation of the iron-sulfur cluster activates SoxR. The physiological role in E. coli is response to oxidative stress. It is activated by superoxide, singlet oxygen, nitric oxide (NO), and hydrogen peroxide. In E. coli, SoxR increases expression of transcription factor SoxS; different downstream targets may exist in other species.
Probab=47.68  E-value=2.9  Score=24.73  Aligned_cols=22  Identities=0%  Similarity=-0.061  Sum_probs=19.1

Q ss_pred             CchhhhhcCCCCCccceeeccc
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      |.|-|+|..+|+|..+++-|-+
T Consensus         2 ~~IgevA~~~Gvs~~tLRyYE~   23 (142)
T TIGR01950         2 LTVGELAKRSGVAVSALHFYES   23 (142)
T ss_pred             CCHHHHHHHHCcCHHHHHHHHH
Confidence            5688999999999999998855


No 190
>PRK09641 RNA polymerase sigma factor SigW; Provisional
Probab=47.65  E-value=3.6  Score=24.23  Aligned_cols=29  Identities=14%  Similarity=0.015  Sum_probs=21.1

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKK   30 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr   30 (61)
                      ...|+|..+|++...|+.....=|.+-++
T Consensus       154 s~~eIA~~lgis~~~v~~~l~Rar~~Lr~  182 (187)
T PRK09641        154 SLKEISEILDLPVGTVKTRIHRGREALRK  182 (187)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHHHHHHHH
Confidence            35789999999999998765544444443


No 191
>cd01107 HTH_BmrR Helix-Turn-Helix DNA binding domain of the BmrR transcription regulator. Helix-turn-helix (HTH) multidrug-efflux transporter transcription regulator, BmrR and YdfL of Bacillus subtilis, and related proteins; N-terminal domain. Bmr is a membrane protein which causes the efflux of a variety of toxic substances and antibiotics. BmrR is comprised of two distinct domains that harbor a regulatory (effector-binding) site and an active (DNA-binding) site. The conserved N-terminal domain contains a winged HTH motif  that mediates DNA binding, while the C-terminal domain binds coactivating, toxic compounds. BmrR shares the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements.
Probab=47.64  E-value=3.1  Score=23.23  Aligned_cols=22  Identities=0%  Similarity=-0.028  Sum_probs=18.9

Q ss_pred             CchhhhhcCCCCCccceeeccc
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      |.+-|+|+.+|++..+++-|-.
T Consensus         1 ~~i~eva~~~gis~~tlR~ye~   22 (108)
T cd01107           1 FTIGEFAKLSNLSIKALRYYDK   22 (108)
T ss_pred             CCHHHHHHHHCcCHHHHHHHHH
Confidence            4578999999999999998844


No 192
>TIGR02980 SigBFG RNA polymerase sigma-70 factor, sigma-B/F/G subfamily. This group of similar sigma-70 factors includes clades found in Bacilli (including the sporulation factors SigF:TIGR02885 and SigG:TIGR02850 as well as SigB:TIGR02941), and the high GC gram positive bacteria (Actinobacteria) where a variable number of them are found depending on the lineage.
Probab=47.51  E-value=3.4  Score=25.49  Aligned_cols=22  Identities=0%  Similarity=-0.147  Sum_probs=18.7

Q ss_pred             CchhhhhcCCCCCccceeeccc
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      +.+.|+|..+|++...|+.+..
T Consensus       195 ~s~~eIA~~lgis~~~v~~~~~  216 (227)
T TIGR02980       195 KTQSEIAERLGISQMHVSRLLR  216 (227)
T ss_pred             CCHHHHHHHHCcCHHHHHHHHH
Confidence            3578999999999999988754


No 193
>PF13542 HTH_Tnp_ISL3:  Helix-turn-helix domain of transposase family ISL3
Probab=47.44  E-value=2.5  Score=20.19  Aligned_cols=19  Identities=5%  Similarity=-0.083  Sum_probs=15.6

Q ss_pred             hhhhhcCCCCCccceeecc
Q psy12003          3 LLRDKNPPRGTERQIKIWF   21 (61)
Q Consensus         3 ~~eLA~~l~Lte~~VqvWF   21 (61)
                      +.++|+.+|++..+|+-.|
T Consensus        30 ~~~vA~~~~vs~~TV~ri~   48 (52)
T PF13542_consen   30 FKDVARELGVSWSTVRRIF   48 (52)
T ss_pred             HHHHHHHHCCCHHHHHHHH
Confidence            5678999999999987655


No 194
>PRK12525 RNA polymerase sigma factor; Provisional
Probab=47.37  E-value=3.1  Score=24.42  Aligned_cols=22  Identities=5%  Similarity=-0.012  Sum_probs=18.1

Q ss_pred             chhhhhcCCCCCccceeecccc
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQN   23 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqN   23 (61)
                      ...|+|..||+++.+|+.+..+
T Consensus       136 s~~EIA~~l~is~~tV~~~l~r  157 (168)
T PRK12525        136 TYVEIGERLGVSLSRIHQYMVE  157 (168)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHH
Confidence            4679999999999999876543


No 195
>TIGR02835 spore_sigmaE RNA polymerase sigma-E factor. Members of this family comprise the Firmicutes lineage endospore formation-specific sigma factor SigE, also called SpoIIGB and sigma-29. As characterized in Bacillus subtilis, this protein is synthesized as a precursor, specifically in the mother cell compartment, and must cleaved by the SpoIIGA protein to be made active.
Probab=47.33  E-value=3.7  Score=25.65  Aligned_cols=21  Identities=5%  Similarity=-0.222  Sum_probs=17.8

Q ss_pred             chhhhhcCCCCCccceeeccc
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      ...|+|..+|+++.+|+.+.+
T Consensus       200 s~~EIA~~Lgis~~tV~~~l~  220 (234)
T TIGR02835       200 TQKEVADMLGISQSYISRLEK  220 (234)
T ss_pred             CHHHHHHHHCCCHHHHHHHHH
Confidence            467999999999999987654


No 196
>PRK09636 RNA polymerase sigma factor SigJ; Provisional
Probab=47.12  E-value=3.4  Score=26.59  Aligned_cols=30  Identities=3%  Similarity=-0.086  Sum_probs=22.7

Q ss_pred             CchhhhhcCCCCCccceeeccccchhHHHH
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQNRRMKWKK   30 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFqNrRak~kr   30 (61)
                      +...|+|..+|+++..|+...+.-|.+-+.
T Consensus       132 ~s~~EIA~~lg~s~~tVk~~l~RAr~~Lr~  161 (293)
T PRK09636        132 VPFDEIASTLGRSPAACRQLASRARKHVRA  161 (293)
T ss_pred             CCHHHHHHHHCCCHHHHHHHHHHHHHHHHh
Confidence            356899999999999999877644444444


No 197
>PF06322 Phage_NinH:  Phage NinH protein;  InterPro: IPR010454 This entry is represented by Bacteriophage 933W, NinH. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=46.76  E-value=3.8  Score=21.47  Aligned_cols=18  Identities=6%  Similarity=-0.069  Sum_probs=15.2

Q ss_pred             chhhhhcCCCCCccceee
Q psy12003          2 NLLRDKNPPRGTERQIKI   19 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~Vqv   19 (61)
                      |++|+|+.|++...+|+-
T Consensus        18 nqtEvaR~l~c~R~TVrK   35 (64)
T PF06322_consen   18 NQTEVARRLGCNRATVRK   35 (64)
T ss_pred             cHHHHHHHhcccHHHHHH
Confidence            678999999999888863


No 198
>PF01418 HTH_6:  Helix-turn-helix domain, rpiR family;  InterPro: IPR000281 This domain contains a helix-turn-helix motif []. Every member of this family is N-terminal to a SIS domain IPR001347 from INTERPRO. Members of this family are probably regulators of genes involved in phosphosugar metobolism.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent; PDB: 2O3F_B 3IWF_B.
Probab=46.48  E-value=3.9  Score=21.49  Aligned_cols=18  Identities=11%  Similarity=0.027  Sum_probs=12.7

Q ss_pred             CchhhhhcCCCCCcccee
Q psy12003          1 MNLLRDKNPPRGTERQIK   18 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~Vq   18 (61)
                      +.+.|||..+++++..|=
T Consensus        35 ~si~elA~~~~vS~sti~   52 (77)
T PF01418_consen   35 MSISELAEKAGVSPSTIV   52 (77)
T ss_dssp             --HHHHHHHCTS-HHHHH
T ss_pred             ccHHHHHHHcCCCHHHHH
Confidence            357899999999988773


No 199
>cd04765 HTH_MlrA-like_sg2 Helix-Turn-Helix DNA binding domain of putative MlrA-like transcription regulators. Putative helix-turn-helix (HTH) MlrA-like transcription regulators (subgroup 2), N-terminal domain. The MlrA protein, also known as YehV, has been shown to control cell-cell aggregation by co-regulating the expression of curli and extracellular matrix production in Escherichia coli and Salmonella typhimurium. These proteins belong to the MerR superfamily of transcription regulators that promote expression of several stress regulon genes by reconfiguring the spacer between the -35 and -10 promoter elements. Their conserved N-terminal domains contain predicted HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.
Probab=46.47  E-value=3  Score=23.13  Aligned_cols=21  Identities=5%  Similarity=0.015  Sum_probs=18.2

Q ss_pred             chhhhhcCCCCCccceeeccc
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      -+.|+|..+|+++.+++-|-+
T Consensus         2 ti~EvA~~~gVs~~tLR~ye~   22 (99)
T cd04765           2 SIGEVAEILGLPPHVLRYWET   22 (99)
T ss_pred             CHHHHHHHHCcCHHHHHHHHH
Confidence            478999999999999998854


No 200
>PF01710 HTH_Tnp_IS630:  Transposase;  InterPro: IPR002622 Transposase proteins are necessary for efficient DNA transposition. This entry includes insertion sequences from Synechocystis sp. (strain PCC 6803) three of which are characterised as homologous to bacterial IS5- and IS4- and to several members of the IS630-Tc1-mariner superfamily []. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=46.40  E-value=2.7  Score=23.92  Aligned_cols=21  Identities=5%  Similarity=0.184  Sum_probs=18.8

Q ss_pred             chhhhhcCCCCCccceeeccc
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      .+.+.|...+++..+|.-|++
T Consensus        20 s~~eaa~~F~VS~~Tv~~W~k   40 (119)
T PF01710_consen   20 SIREAAKRFGVSRNTVYRWLK   40 (119)
T ss_pred             hHHHHHHHhCcHHHHHHHHHH
Confidence            367899999999999999988


No 201
>cd04787 HTH_HMRTR_unk Helix-Turn-Helix DNA binding domain of putative Heavy Metal Resistance transcription regulators. Putative helix-turn-helix (HTH) heavy metal resistance transcription regulators (HMRTR), unknown subgroup. Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to heavy metal stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules, such as, metal ions, drugs, and organic substrates. This subgroup lacks one of the c
Probab=46.20  E-value=3.2  Score=24.00  Aligned_cols=20  Identities=15%  Similarity=0.227  Sum_probs=17.9

Q ss_pred             CchhhhhcCCCCCccceeec
Q psy12003          1 MNLLRDKNPPRGTERQIKIW   20 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvW   20 (61)
                      |-|-|+|..+|++..+|+-|
T Consensus         1 m~IgE~A~~~gvs~~TLRyY   20 (133)
T cd04787           1 MKVKELANAAGVTPDTVRFY   20 (133)
T ss_pred             CCHHHHHHHHCcCHHHHHHH
Confidence            67889999999999999877


No 202
>cd01108 HTH_CueR Helix-Turn-Helix DNA binding domain of CueR-like transcription regulators. Helix-turn-helix (HTH) transcription regulators CueR and ActP, copper efflux regulators. In Bacillus subtilis, copper induced CueR regulates the copZA operon, preventing copper toxicity. In Rhizobium leguminosarum, ActP controls copper homeostasis; it detects cytoplasmic copper stress and activates transcription in response to increasing copper concentrations. These proteins are comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain winged HTH motifs that mediate DNA binding, while the C-terminal domains have two conserved cysteines that define a monovalent copper ion binding site. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements
Probab=46.12  E-value=3.3  Score=23.78  Aligned_cols=22  Identities=14%  Similarity=0.161  Sum_probs=18.7

Q ss_pred             CchhhhhcCCCCCccceeeccc
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      |-|-|+|..+|++..+++-|-+
T Consensus         1 m~I~e~a~~~gvs~~tlRyYe~   22 (127)
T cd01108           1 MNIGEAAKLTGLSAKMIRYYEE   22 (127)
T ss_pred             CCHHHHHHHHCcCHHHHHHHHH
Confidence            5678999999999999988744


No 203
>PRK09413 IS2 repressor TnpA; Reviewed
Probab=45.97  E-value=3.3  Score=23.61  Aligned_cols=20  Identities=10%  Similarity=0.099  Sum_probs=17.5

Q ss_pred             chhhhhcCCCCCccceeecc
Q psy12003          2 NLLRDKNPPRGTERQIKIWF   21 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWF   21 (61)
                      .+.++|.++|+++.+|-.|.
T Consensus        31 sv~evA~e~gIs~~tl~~W~   50 (121)
T PRK09413         31 TVSLVARQHGVAASQLFLWR   50 (121)
T ss_pred             CHHHHHHHHCcCHHHHHHHH
Confidence            46789999999999999883


No 204
>PF07498 Rho_N:  Rho termination factor, N-terminal domain;  InterPro: IPR011112 The Rho termination factor disengages newly transcribed RNA from its DNA template at certain, specific transcripts. It is thought that two copies of Rho bind to RNA and that Rho functions as a hexamer of protomers []. This domain is found to the N terminus of the RNA binding domain (IPR011113 from INTERPRO).; GO: 0006353 transcription termination, DNA-dependent; PDB: 1A8V_B 1PVO_A 1PV4_D 3ICE_A 1XPU_C 1XPO_D 1XPR_F 2A8V_B 2HT1_B 1A63_A ....
Probab=45.90  E-value=9.5  Score=18.04  Aligned_cols=13  Identities=8%  Similarity=-0.240  Sum_probs=10.0

Q ss_pred             chhhhhcCCCCCc
Q psy12003          2 NLLRDKNPPRGTE   14 (61)
Q Consensus         2 ~~~eLA~~l~Lte   14 (61)
                      ||.++|..+|++.
T Consensus         9 eL~~iAk~lgI~~   21 (43)
T PF07498_consen    9 ELREIAKELGIEG   21 (43)
T ss_dssp             HHHHHHHCTT-TT
T ss_pred             HHHHHHHHcCCCC
Confidence            6888999999873


No 205
>PRK11179 DNA-binding transcriptional regulator AsnC; Provisional
Probab=45.79  E-value=3.7  Score=24.17  Aligned_cols=16  Identities=6%  Similarity=-0.166  Sum_probs=14.0

Q ss_pred             hhhhhcCCCCCcccee
Q psy12003          3 LLRDKNPPRGTERQIK   18 (61)
Q Consensus         3 ~~eLA~~l~Lte~~Vq   18 (61)
                      ..|||+++|+++.+|.
T Consensus        26 ~~eiA~~lglS~~tV~   41 (153)
T PRK11179         26 YAELAKQFGVSPGTIH   41 (153)
T ss_pred             HHHHHHHHCcCHHHHH
Confidence            4689999999999985


No 206
>PRK07670 RNA polymerase sigma factor SigD; Validated
Probab=45.42  E-value=4  Score=25.72  Aligned_cols=28  Identities=14%  Similarity=-0.001  Sum_probs=20.9

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWK   29 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~k   29 (61)
                      -+.|+|..+|+|+.+|+..+..-+.+-|
T Consensus       219 s~~EIA~~lgis~~tV~~~~~ra~~~Lr  246 (251)
T PRK07670        219 TLTEIGQVLNLSTSRISQIHSKALFKLK  246 (251)
T ss_pred             CHHHHHHHHCcCHHHHHHHHHHHHHHHH
Confidence            4679999999999999877654444333


No 207
>PRK06704 RNA polymerase factor sigma-70; Validated
Probab=45.35  E-value=4  Score=25.94  Aligned_cols=30  Identities=13%  Similarity=0.024  Sum_probs=22.6

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKE   31 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~   31 (61)
                      ...|+|..+|+++..|++...--|.+-|..
T Consensus       134 S~~EIAe~LgiS~~tVksrL~Rark~Lr~~  163 (228)
T PRK06704        134 SIADIAKVCSVSEGAVKASLFRSRNRLKTV  163 (228)
T ss_pred             CHHHHHHHHCcCHHHHHHHHHHHHHHHHHH
Confidence            468999999999999998766444444443


No 208
>PF00356 LacI:  Bacterial regulatory proteins, lacI family;  InterPro: IPR000843 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif. These proteins are very diverse, but for convenience may be grouped into subfamilies on the basis of sequence similarity. One such family groups together a range of proteins, including ascG, ccpA, cytR, ebgR, fruR, galR, galS, lacI, malI, opnR, purF, rafR, rbtR and scrR [, ]. Within this family, the HTH motif is situated towards the N terminus.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent, 0005622 intracellular; PDB: 3KJX_C 1ZAY_A 1VPW_A 2PUA_A 1QQA_A 1PNR_A 1JFT_A 1QP4_A 2PUD_A 1JH9_A ....
Probab=45.19  E-value=2.7  Score=20.38  Aligned_cols=22  Identities=0%  Similarity=-0.074  Sum_probs=18.0

Q ss_pred             hhhhhcCCCCCccceeeccccc
Q psy12003          3 LLRDKNPPRGTERQIKIWFQNR   24 (61)
Q Consensus         3 ~~eLA~~l~Lte~~VqvWFqNr   24 (61)
                      |.++|+.+|++..+|---|.++
T Consensus         2 i~dIA~~agvS~~TVSr~ln~~   23 (46)
T PF00356_consen    2 IKDIAREAGVSKSTVSRVLNGP   23 (46)
T ss_dssp             HHHHHHHHTSSHHHHHHHHTTC
T ss_pred             HHHHHHHHCcCHHHHHHHHhCC
Confidence            6789999999999987666664


No 209
>COG0789 SoxR Predicted transcriptional regulators [Transcription]
Probab=45.13  E-value=3.8  Score=22.87  Aligned_cols=20  Identities=5%  Similarity=0.086  Sum_probs=16.9

Q ss_pred             CchhhhhcCCCCCccceeec
Q psy12003          1 MNLLRDKNPPRGTERQIKIW   20 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvW   20 (61)
                      |-|-|+|..+|++..+++-|
T Consensus         1 ~~I~eva~~~gvs~~tLRyY   20 (124)
T COG0789           1 YTIGEVAKLTGVSVRTLRFY   20 (124)
T ss_pred             CcHHHHHHHhCCCHHHHHHH
Confidence            45778999999999999877


No 210
>PRK12544 RNA polymerase sigma factor; Provisional
Probab=44.92  E-value=4.2  Score=25.00  Aligned_cols=30  Identities=3%  Similarity=0.024  Sum_probs=23.0

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKE   31 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~   31 (61)
                      ...|+|..+|+++..|++..+-=|.+-|+.
T Consensus       166 s~~EIAe~lgis~~tV~~~l~RAr~~Lr~~  195 (206)
T PRK12544        166 ETNEICHAVDLSVSNLNVLLYRARLRLREC  195 (206)
T ss_pred             CHHHHHHHHCcCHHHHHHHHHHHHHHHHHH
Confidence            468999999999999998766555554444


No 211
>PF01527 HTH_Tnp_1:  Transposase;  InterPro: IPR002514 Transposase proteins are necessary for efficient DNA transposition. This family consists of various Escherichia coli insertion elements and other bacterial transposases some of which are members of the IS3 family. This region includes a helix-turn-helix motif (HTH) at the N terminus followed by a leucine zipper (LZ) motif. The LZ motif has been shown to mediate oligomerisation of the transposase components in IS911 []. More information about these proteins can be found at Protein of the Month: Transposase [].; GO: 0003677 DNA binding, 0004803 transposase activity, 0006313 transposition, DNA-mediated; PDB: 2JN6_A 2RN7_A.
Probab=44.87  E-value=1.9  Score=22.02  Aligned_cols=19  Identities=5%  Similarity=0.034  Sum_probs=15.6

Q ss_pred             chhhhhcCCCCCccceeec
Q psy12003          2 NLLRDKNPPRGTERQIKIW   20 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvW   20 (61)
                      .+.++|.+.|+++.++.-|
T Consensus        25 sv~~va~~~gi~~~~l~~W   43 (76)
T PF01527_consen   25 SVSEVAREYGISPSTLYNW   43 (76)
T ss_dssp             HHHHHHHHHTS-HHHHHHH
T ss_pred             ceEeeecccccccccccHH
Confidence            4678999999999999877


No 212
>cd04784 HTH_CadR-PbrR Helix-Turn-Helix DNA binding domain of the CadR and PbrR transcription regulators. Helix-turn-helix (HTH) CadR and PbrR transcription regulators including Pseudomonas aeruginosa CadR and Ralstonia metallidurans PbrR that regulate expression of the cadmium and lead resistance operons, respectively. These proteins are comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the C-terminal domains have three conserved cysteines which form a putative metal binding site. Some members in this group have a histidine-rich C-terminal extension. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements.
Probab=44.67  E-value=3.5  Score=23.58  Aligned_cols=21  Identities=10%  Similarity=0.050  Sum_probs=18.0

Q ss_pred             CchhhhhcCCCCCccceeecc
Q psy12003          1 MNLLRDKNPPRGTERQIKIWF   21 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWF   21 (61)
                      |-|-|+|..+|+|..+|+-|-
T Consensus         1 m~IgevA~~~gvs~~tLRyYe   21 (127)
T cd04784           1 MKIGELAKKTGCSVETIRYYE   21 (127)
T ss_pred             CCHHHHHHHHCcCHHHHHHHH
Confidence            568899999999999998773


No 213
>cd04768 HTH_BmrR-like Helix-Turn-Helix DNA binding domain of BmrR-like transcription regulators. Helix-turn-helix (HTH) BmrR-like transcription regulators (TipAL, Mta, SkgA, BmrR, and BltR), N-terminal domain. These proteins have been shown to regulate expression of specific regulons in response to various toxic substances, antibiotics, or oxygen radicals in Bacillus subtilis, Streptomyces, and Caulobacter crescentus. They are comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain  HTH motifs that mediate DNA binding, while the C-terminal domains are often unrelated and bind specific coactivator molecules. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements.
Probab=44.62  E-value=3.5  Score=22.55  Aligned_cols=22  Identities=5%  Similarity=-0.097  Sum_probs=18.9

Q ss_pred             chhhhhcCCCCCccceeecccc
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQN   23 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqN   23 (61)
                      -|-|+|..+|++..+++-|-+.
T Consensus         2 ti~eva~~~gvs~~tLRyye~~   23 (96)
T cd04768           2 TIGEFAKLAGVSIRTLRHYDDI   23 (96)
T ss_pred             CHHHHHHHHCcCHHHHHHHHHC
Confidence            4779999999999999998653


No 214
>PF07813 LTXXQ:  LTXXQ motif family protein;  InterPro: IPR012899 This five residue motif is found in a number of bacterial proteins bearing similarity to the protein CpxP (P32158 from SWISSPROT). This is a periplasmic protein that aids in combating extracytoplasmic protein-mediated toxicity, and may also be involved in the response to alkaline pH []. Another member of this family, Spy (P77754 from SWISSPROT) is also a periplasmic protein that may be involved in the response to stress []. The homology between CpxP and Spy may indicate that these two proteins are functionally related []. The motif is found repeated twice in many members of this entry. ; GO: 0042597 periplasmic space; PDB: 3ITF_B 3QZC_B 3OEO_D 3O39_A.
Probab=44.42  E-value=4  Score=21.71  Aligned_cols=18  Identities=28%  Similarity=0.272  Sum_probs=12.0

Q ss_pred             hhhhhcCCCCCccceeec
Q psy12003          3 LLRDKNPPRGTERQIKIW   20 (61)
Q Consensus         3 ~~eLA~~l~Lte~~VqvW   20 (61)
                      +..|...|+||+.|.+-|
T Consensus         6 ~~~l~~~L~LT~eQ~~~~   23 (100)
T PF07813_consen    6 IDRLKEELNLTDEQKAKW   23 (100)
T ss_dssp             --STTTTS--THHHHHHH
T ss_pred             HHHHHhhCCCCHHHHHHH
Confidence            567889999999988866


No 215
>PF08452 DNAP_B_exo_N:  DNA polymerase family B exonuclease domain, N-terminal;  InterPro: IPR013660 This domain is found in viral DNA polymerases to the N terminus of DNA polymerase family B exonuclease domains (IPR006133 from INTERPRO). ; GO: 0003887 DNA-directed DNA polymerase activity
Probab=43.64  E-value=7.6  Score=16.16  Aligned_cols=8  Identities=38%  Similarity=0.945  Sum_probs=6.4

Q ss_pred             eccccchh
Q psy12003         19 IWFQNRRM   26 (61)
Q Consensus        19 vWFqNrRa   26 (61)
                      .||.||+.
T Consensus         7 NWFE~~ge   14 (22)
T PF08452_consen    7 NWFESRGE   14 (22)
T ss_pred             ehhhhCCc
Confidence            69999874


No 216
>cd04769 HTH_MerR2 Helix-Turn-Helix DNA binding domain of MerR2-like transcription regulators. Helix-turn-helix (HTH) transcription regulator MerR2 and related proteins. MerR2 in Bacillus cereus RC607 regulates resistance to organomercurials. The MerR family transcription regulators have been shown to mediate responses to stress including exposure to heavy metals, drugs, or oxygen radicals in eubacterial and some archaeal species. They regulate transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.
Probab=43.38  E-value=3.7  Score=23.15  Aligned_cols=22  Identities=14%  Similarity=0.113  Sum_probs=18.9

Q ss_pred             CchhhhhcCCCCCccceeeccc
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      |-|-|+|..+|+|..+++-|-+
T Consensus         1 ~~ige~a~~~gvs~~tLryYe~   22 (116)
T cd04769           1 MYIGELAQQTGVTIKAIRLYEE   22 (116)
T ss_pred             CCHHHHHHHHCcCHHHHHHHHH
Confidence            5688999999999999988744


No 217
>cd08315 Death_TRAILR_DR4_DR5 Death domain of Tumor necrosis factor-Related Apoptosis-Inducing Ligand Receptors. Death Domain (DD) found in Tumor necrosis factor-Related Apoptosis-Inducing Ligand (TRAIL) Receptors. In mammals, this family includes TRAILR1 (also called DR4 or TNFRSF10A) and TRAILR2 (also called DR5, TNFRSF10B, or KILLER). They function as receptors for the cytokine TRAIL and are involved in apoptosis signaling pathways. TRAIL preferentially induces apoptosis in cancer cells while exhibiting little toxicity in normal cells. DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN. They serve as adaptors in signaling pathways and can recruit other proteins into signaling complexes.
Probab=43.13  E-value=5.3  Score=22.20  Aligned_cols=16  Identities=19%  Similarity=-0.006  Sum_probs=13.6

Q ss_pred             hhhhhcCCCCCcccee
Q psy12003          3 LLRDKNPPRGTERQIK   18 (61)
Q Consensus         3 ~~eLA~~l~Lte~~Vq   18 (61)
                      ..+||+.|||++..|.
T Consensus        22 Wk~laR~LGLse~~I~   37 (96)
T cd08315          22 WNRLMRQLGLSENEID   37 (96)
T ss_pred             HHHHHHHcCCCHHHHH
Confidence            3579999999999886


No 218
>TIGR02960 SigX5 RNA polymerase sigma-70 factor, TIGR02960 family. This group of sigma factors are members of the sigma-70 family (TIGR02937). They and appear by homology, tree building, bidirectional best hits and one-to-a-genome distribution, to represent a conserved family.
Probab=43.11  E-value=4.6  Score=26.09  Aligned_cols=28  Identities=7%  Similarity=0.001  Sum_probs=20.7

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWK   29 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~k   29 (61)
                      ...|+|..||+++..|+....-=|.+-|
T Consensus       160 s~~EIA~~lgis~~tV~~~l~Rar~~Lr  187 (324)
T TIGR02960       160 RAAETAELLGTSTASVNSALQRARATLD  187 (324)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHHHHHHH
Confidence            4679999999999999976553333333


No 219
>cd04781 HTH_MerR-like_sg6 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily. Putative helix-turn-helix (HTH) MerR-like transcription regulators (subgroup 6) with at least two conserved cysteines present in the C-terminal portion of the protein. Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, an
Probab=42.99  E-value=3.8  Score=23.26  Aligned_cols=22  Identities=0%  Similarity=0.084  Sum_probs=18.4

Q ss_pred             CchhhhhcCCCCCccceeeccc
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      |-|-|+|..+|+|..+|+-|-+
T Consensus         1 m~IgevA~~~gvs~~tlRyYe~   22 (120)
T cd04781           1 LDIAEVARQSGLPASTLRYYEE   22 (120)
T ss_pred             CCHHHHHHHHCcCHHHHHHHHH
Confidence            5678999999999999987733


No 220
>PF13223 DUF4031:  Protein of unknown function (DUF4031)
Probab=42.67  E-value=6.9  Score=21.52  Aligned_cols=18  Identities=22%  Similarity=0.218  Sum_probs=15.2

Q ss_pred             chhhhhcCCCCCccceeecccc
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQN   23 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqN   23 (61)
                      ||-+.|.++||..    -|||.
T Consensus        25 ELHafA~riGv~r----r~fq~   42 (83)
T PF13223_consen   25 ELHAFAARIGVPR----RWFQR   42 (83)
T ss_pred             HHHHHHHHcCCCH----HHHcC
Confidence            6778899999985    69997


No 221
>PF04936 DUF658:  Protein of unknown function (DUF658);  InterPro: IPR007020 This entry is represented by Bacteriophage r1t, Orf18. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. These are proteins of unknown function found in Lactococcus lactis and in their associated bacteriophage. 
Probab=42.62  E-value=2.5  Score=26.32  Aligned_cols=31  Identities=10%  Similarity=0.168  Sum_probs=26.6

Q ss_pred             hhhhhcCCCCCccceeeccccchhHHHHHhh
Q psy12003          3 LLRDKNPPRGTERQIKIWFQNRRMKWKKEHK   33 (61)
Q Consensus         3 ~~eLA~~l~Lte~~VqvWFqNrRak~kr~~~   33 (61)
                      +-|||.-++++.++|-+|..|.+...+...+
T Consensus        17 ~~e~~~~~~VS~~sv~~WiKNG~~~~~a~~~   47 (186)
T PF04936_consen   17 IDELADYFDVSRTSVSVWIKNGKDPKRAKPK   47 (186)
T ss_pred             HHHHHHHHccCHHHHHHHHHcCCCcccccch
Confidence            5689999999999999999999888776644


No 222
>TIGR02043 ZntR Zn(II)-responsive transcriptional regulator. This model represents the zinc and cadmium (II) responsive transcriptional activator of the gamma proteobacterial zinc efflux system. This protein is a member of the MerR family of transcriptional activators (pfam00376) and contains a distinctive pattern of cysteine residues in its metal binding loop, Cys-Cys-X(8-9)-Cys, as well as a conserved and critical cysteine at the N-terminal end of the dimerization helix.
Probab=42.54  E-value=3.9  Score=23.65  Aligned_cols=22  Identities=5%  Similarity=-0.022  Sum_probs=18.9

Q ss_pred             CchhhhhcCCCCCccceeeccc
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      |-|-|+|+.+|++..+++-|-+
T Consensus         2 ~~I~e~a~~~gvs~~tlR~Ye~   23 (131)
T TIGR02043         2 FQIGELAKLCGVTSDTLRFYEK   23 (131)
T ss_pred             CCHHHHHHHHCcCHHHHHHHHH
Confidence            4578999999999999998855


No 223
>PF06971 Put_DNA-bind_N:  Putative DNA-binding protein N-terminus;  InterPro: IPR009718 This entry represents the C terminus (approximately 30 residues) of a number of Rex proteins. These are redox-sensing repressors that appear to be widespread among Gram-positive bacteria []. They modulate transcription in response to changes in cellular NADH/NAD(+) redox state. Rex is predicted to include a pyridine nucleotide-binding domain (Rossmann fold), and residues that might play key structural and nucleotide binding roles are highly conserved.; GO: 0045892 negative regulation of transcription, DNA-dependent, 0051775 response to redox state, 0005737 cytoplasm; PDB: 3IL2_B 3IKT_A 3IKV_B 1XCB_F 2DT5_A 2VT3_A 2VT2_A 3KEO_B 3KET_A 3KEQ_A ....
Probab=42.42  E-value=2.2  Score=21.21  Aligned_cols=15  Identities=13%  Similarity=-0.048  Sum_probs=11.5

Q ss_pred             hhhhcCCCCCcccee
Q psy12003          4 LRDKNPPRGTERQIK   18 (61)
Q Consensus         4 ~eLA~~l~Lte~~Vq   18 (61)
                      .+||..+|++..||+
T Consensus        32 ~~La~~~gi~~~qVR   46 (50)
T PF06971_consen   32 QELAEALGITPAQVR   46 (50)
T ss_dssp             HHHHHHHTS-HHHHH
T ss_pred             HHHHHHHCCCHHHhc
Confidence            478889999998884


No 224
>PRK09651 RNA polymerase sigma factor FecI; Provisional
Probab=42.28  E-value=4.9  Score=23.68  Aligned_cols=21  Identities=5%  Similarity=-0.054  Sum_probs=17.8

Q ss_pred             chhhhhcCCCCCccceeeccc
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      ...|+|..+|+++..|++...
T Consensus       137 s~~EIA~~lgis~~tV~~~l~  157 (172)
T PRK09651        137 TYSEIAHKLGVSVSSVKKYVA  157 (172)
T ss_pred             CHHHHHHHhCCCHHHHHHHHH
Confidence            357999999999999997754


No 225
>PF09012 FeoC:  FeoC like transcriptional regulator;  InterPro: IPR015102 This entry contains several transcriptional regulators, including FeoC, which contain a HTH motif. FeoC acts as a [Fe-S] dependent transcriptional repressor []. ; PDB: 1XN7_A 2K02_A.
Probab=42.28  E-value=3.8  Score=21.01  Aligned_cols=17  Identities=6%  Similarity=-0.082  Sum_probs=13.1

Q ss_pred             chhhhhcCCCCCcccee
Q psy12003          2 NLLRDKNPPRGTERQIK   18 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~Vq   18 (61)
                      .+.+||..+++++..|.
T Consensus        16 S~~eLa~~~~~s~~~ve   32 (69)
T PF09012_consen   16 SLAELAREFGISPEAVE   32 (69)
T ss_dssp             EHHHHHHHTT--HHHHH
T ss_pred             CHHHHHHHHCcCHHHHH
Confidence            47899999999999887


No 226
>cd04770 HTH_HMRTR Helix-Turn-Helix DNA binding domain of Heavy Metal Resistance transcription regulators. Helix-turn-helix (HTH) heavy metal resistance transcription regulators (HMRTR): MerR1 (mercury), CueR (copper),  CadR (cadmium),  PbrR (lead), ZntR (zinc), and other related proteins. These transcription regulators mediate responses to heavy metal stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.
Probab=42.22  E-value=4  Score=23.07  Aligned_cols=21  Identities=10%  Similarity=0.058  Sum_probs=17.8

Q ss_pred             CchhhhhcCCCCCccceeecc
Q psy12003          1 MNLLRDKNPPRGTERQIKIWF   21 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWF   21 (61)
                      |-|-|+|..+|++..+++-|-
T Consensus         1 ~~I~eva~~~gvs~~tLRyYe   21 (123)
T cd04770           1 MKIGELAKAAGVSPDTIRYYE   21 (123)
T ss_pred             CCHHHHHHHHCcCHHHHHHHH
Confidence            567899999999999998773


No 227
>PRK12527 RNA polymerase sigma factor; Reviewed
Probab=42.04  E-value=5  Score=23.14  Aligned_cols=21  Identities=0%  Similarity=-0.192  Sum_probs=17.8

Q ss_pred             chhhhhcCCCCCccceeeccc
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      -..|+|..+|+++..|+.-..
T Consensus       123 s~~eIA~~lgis~~tv~~~l~  143 (159)
T PRK12527        123 SHQQIAEHLGISRSLVEKHIV  143 (159)
T ss_pred             CHHHHHHHhCCCHHHHHHHHH
Confidence            467999999999999987655


No 228
>PF11388 DotA:  Phagosome trafficking protein DotA;  InterPro: IPR021528  DotA is essential for intracellular growth in Legionella []. DotA is thought to play an important role in regulating initial phagosome trafficking decisions either upon or immediately after macrophage uptake []. 
Probab=41.96  E-value=39  Score=19.21  Aligned_cols=18  Identities=28%  Similarity=0.481  Sum_probs=12.4

Q ss_pred             ceeeccccchhHHHHHhh
Q psy12003         16 QIKIWFQNRRMKWKKEHK   33 (61)
Q Consensus        16 ~VqvWFqNrRak~kr~~~   33 (61)
                      -+=+||||.-.|--.-+.
T Consensus        31 ~LC~WF~~~s~~l~qiqs   48 (105)
T PF11388_consen   31 LLCTWFQNKSDKLVQIQS   48 (105)
T ss_pred             HHHHHHccCCchhhhhhH
Confidence            344899999887654443


No 229
>cd04777 HTH_MerR-like_sg1 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily. Putative helix-turn-helix (HTH) MerR-like transcription regulators (subgroup 1), N-terminal domain. Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.
Probab=41.90  E-value=4  Score=22.62  Aligned_cols=20  Identities=10%  Similarity=0.062  Sum_probs=17.1

Q ss_pred             CchhhhhcCCCCCccceeec
Q psy12003          1 MNLLRDKNPPRGTERQIKIW   20 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvW   20 (61)
                      |-|-|+|..+|+|..+|+-|
T Consensus         1 m~Ige~a~~~gvs~~tlRyY   20 (107)
T cd04777           1 MKIGKFAKKNNITIDTVRHY   20 (107)
T ss_pred             CCHHHHHHHHCcCHHHHHHH
Confidence            56889999999999988765


No 230
>PRK12534 RNA polymerase sigma factor; Provisional
Probab=41.38  E-value=6.7  Score=23.23  Aligned_cols=21  Identities=10%  Similarity=0.142  Sum_probs=17.0

Q ss_pred             chhhhhcCCCCCccceeeccc
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      ...|+|..||+++..|++-..
T Consensus       155 s~~eIA~~lgis~~~v~~~l~  175 (187)
T PRK12534        155 TYEELAARTDTPIGTVKSWIR  175 (187)
T ss_pred             CHHHHHHHhCCChhHHHHHHH
Confidence            467999999999999985433


No 231
>TIGR02957 SigX4 RNA polymerase sigma-70 factor, TIGR02957 family. This group of sigma factors are members of the sigma-70 family (TIGR02937). They and appear by homology, tree building and bidirectional best hits, to represent a conserved family. This family is found in a limited number of bacterial lineages. This family includes apparent paralogous expansion in Streptomyces coelicolor A3(2), and multiple copies in Mycobacterium smegmatis MC2, Streptomyces avermitilis MA-4680 and Nocardia farcinica IFM10152.
Probab=41.31  E-value=4.7  Score=25.94  Aligned_cols=29  Identities=7%  Similarity=-0.065  Sum_probs=22.5

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKK   30 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr   30 (61)
                      ...|+|..+|+++..|+..++-=|.+-+.
T Consensus       126 s~~EIA~~lg~s~~tVr~~l~RAr~~Lr~  154 (281)
T TIGR02957       126 PYEEIASIVGKSEANCRQLVSRARRHLDA  154 (281)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHHHHHHHh
Confidence            46799999999999999887654544443


No 232
>PRK07408 RNA polymerase sigma factor SigF; Reviewed
Probab=40.93  E-value=5  Score=25.52  Aligned_cols=29  Identities=3%  Similarity=-0.113  Sum_probs=21.3

Q ss_pred             CchhhhhcCCCCCccceeeccccchhHHH
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQNRRMKWK   29 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFqNrRak~k   29 (61)
                      +.+.|+|..+|+++.+|+.+..-=+.|.|
T Consensus       220 ~s~~eIA~~lgvs~~~V~~~~~ra~~kLr  248 (256)
T PRK07408        220 LTQKEAAERLGISPVTVSRRVKKGLDQLK  248 (256)
T ss_pred             CCHHHHHHHHCcCHHHHHHHHHHHHHHHH
Confidence            35789999999999999877553333333


No 233
>COG4189 Predicted transcriptional regulator [Transcription]
Probab=40.63  E-value=9.5  Score=25.31  Aligned_cols=18  Identities=6%  Similarity=-0.010  Sum_probs=15.4

Q ss_pred             CchhhhhcCCCCCcccee
Q psy12003          1 MNLLRDKNPPRGTERQIK   18 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~Vq   18 (61)
                      ||+.|+|..+||+...+-
T Consensus        38 lNvneiAe~lgLpqst~s   55 (308)
T COG4189          38 LNVNEIAEALGLPQSTMS   55 (308)
T ss_pred             CCHHHHHHHhCCchhhhh
Confidence            688999999999988664


No 234
>PRK12528 RNA polymerase sigma factor; Provisional
Probab=40.40  E-value=4.5  Score=23.39  Aligned_cols=21  Identities=5%  Similarity=-0.105  Sum_probs=17.6

Q ss_pred             chhhhhcCCCCCccceeeccc
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      ...|+|..+|++..+|++...
T Consensus       131 s~~EIA~~l~is~~tV~~~l~  151 (161)
T PRK12528        131 GYGEIATELGISLATVKRYLN  151 (161)
T ss_pred             CHHHHHHHHCCCHHHHHHHHH
Confidence            467999999999999987654


No 235
>PRK07122 RNA polymerase sigma factor SigF; Reviewed
Probab=40.29  E-value=5.3  Score=25.66  Aligned_cols=28  Identities=4%  Similarity=-0.042  Sum_probs=20.8

Q ss_pred             CchhhhhcCCCCCccceeeccccchhHH
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQNRRMKW   28 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFqNrRak~   28 (61)
                      +.+.|+|..+|++..+|+.+...-+.|.
T Consensus       232 ~t~~EIA~~lgis~~~V~~~~~ral~kL  259 (264)
T PRK07122        232 MTQTQIAERVGISQMHVSRLLAKTLARL  259 (264)
T ss_pred             CCHHHHHHHHCcCHHHHHHHHHHHHHHH
Confidence            4578999999999999987655433333


No 236
>cd04785 HTH_CadR-PbrR-like Helix-Turn-Helix DNA binding domain of the CadR- and PbrR-like transcription regulators. Helix-turn-helix (HTH) CadR- and PbrR-like transcription regulators. CadR and PbrR regulate expression of the cadmium and lead resistance operons, respectively. These proteins are comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the C-terminal domains have three conserved cysteines which comprise a putative metal binding site. Some members in this group have a histidine-rich C-terminal extension. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements.
Probab=40.26  E-value=4.4  Score=23.21  Aligned_cols=22  Identities=5%  Similarity=-0.017  Sum_probs=18.4

Q ss_pred             CchhhhhcCCCCCccceeeccc
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      |.|-|+|..+|++..+++-|-+
T Consensus         1 ~~I~e~a~~~gvs~~tlR~Ye~   22 (126)
T cd04785           1 LSIGELARRTGVNVETIRYYES   22 (126)
T ss_pred             CCHHHHHHHHCcCHHHHHHHHH
Confidence            5678999999999999987743


No 237
>cd08316 Death_FAS_TNFRSF6 Death domain of FAS or TNF receptor superfamily member 6. Death Domain (DD) found in the FS7-associated cell surface antigen (FAS). FAS, also known as TNFRSF6 (TNF receptor superfamily member 6), APT1, CD95, FAS1, or APO-1, together with FADD (Fas-associating via Death Domain) and caspase 8, is an integral part of the death inducing signalling complex (DISC), which plays an important role in the induction of apoptosis and is activated by binding of the ligand FasL to FAS. FAS also plays a critical role in self-tolerance by eliminating cell types (autoreactive T and B cells) that contribute to autoimmunity. DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN. They serve as adaptors in sign
Probab=39.88  E-value=6.8  Score=21.94  Aligned_cols=16  Identities=13%  Similarity=0.025  Sum_probs=13.7

Q ss_pred             hhhhhcCCCCCcccee
Q psy12003          3 LLRDKNPPRGTERQIK   18 (61)
Q Consensus         3 ~~eLA~~l~Lte~~Vq   18 (61)
                      .-++|+++||||..|.
T Consensus        23 wK~faR~lglse~~Id   38 (97)
T cd08316          23 VKKFVRKSGLSEPKID   38 (97)
T ss_pred             HHHHHHHcCCCHHHHH
Confidence            4578999999999886


No 238
>TIGR02394 rpoS_proteo RNA polymerase sigma factor RpoS. A sigma factor is a DNA-binding protein protein that binds to the DNA-directed RNA polymerase core to produce the holoenzyme capable of initiating transcription at specific sites. Different sigma factors act in vegetative growth, heat shock, extracytoplasmic functions (ECF), etc. This model represents the clade of sigma factors called RpoS (also called sigma-38, KatF, etc.), found only in Proteobacteria. This sigma factor is induced in stationary phase (in response to the stress of nutrient limitation) and becomes the second prinicipal sigma factor at that time. RpoS is a member of the larger Sigma-70 subfamily (TIGR02937) and most closely related to RpoD (TIGR02393).
Probab=39.79  E-value=5.6  Score=25.63  Aligned_cols=30  Identities=10%  Similarity=-0.047  Sum_probs=22.4

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKE   31 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~   31 (61)
                      -+.|+|..||+++.+|+.....-+.+-|+.
T Consensus       244 s~~EIA~~Lgis~~tVk~~l~rAlkkLr~~  273 (285)
T TIGR02394       244 TLEEVAAEVGLTRERVRQIQVEALKKLRRI  273 (285)
T ss_pred             cHHHHHHHHCCCHHHHHHHHHHHHHHHHHH
Confidence            467999999999999998765444444443


No 239
>TIGR02479 FliA_WhiG RNA polymerase sigma factor, FliA/WhiG family. Most members of this family are the flagellar operon sigma factor FliA, controlling transcription of bacterial flagellar genes by RNA polymerase. An exception is the sigma factor WhiG in the genus Streptomyces, involved in the production of sporulating aerial mycelium.
Probab=39.79  E-value=5.7  Score=24.49  Aligned_cols=22  Identities=18%  Similarity=0.007  Sum_probs=18.0

Q ss_pred             chhhhhcCCCCCccceeecccc
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQN   23 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqN   23 (61)
                      -+.|+|..+|++..+|+.+...
T Consensus       193 s~~eIA~~lgis~~tV~~~~~r  214 (224)
T TIGR02479       193 NLKEIGEVLGLTESRVSQIHSQ  214 (224)
T ss_pred             CHHHHHHHhCCCHHHHHHHHHH
Confidence            4679999999999999876543


No 240
>PRK09514 zntR zinc-responsive transcriptional regulator; Provisional
Probab=39.78  E-value=4.5  Score=23.72  Aligned_cols=22  Identities=5%  Similarity=0.007  Sum_probs=18.6

Q ss_pred             CchhhhhcCCCCCccceeeccc
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      |-|-|+|..+|++..+|+-|-+
T Consensus         2 ~~I~e~a~~~gvs~~tlR~Ye~   23 (140)
T PRK09514          2 YRIGELAKLAEVTPDTLRFYEK   23 (140)
T ss_pred             CcHHHHHHHHCcCHHHHHHHHH
Confidence            4578999999999999998854


No 241
>cd00569 HTH_Hin_like Helix-turn-helix domain of Hin and related proteins, a family of DNA-binding domains unique to bacteria and represented by the Hin protein of Salmonella. The basic HTH domain is a simple fold comprised of three core helices that form a right-handed helical bundle. The principal DNA-protein interface is formed by the third helix, the recognition helix, inserting itself into the major groove of the DNA. A diverse array of HTH domains participate in a variety of functions that depend on their DNA-binding properties. HTH_Hin represents one of the simplest versions of the HTH domains; the characterization of homologous relationships between various sequence-diverse HTH domain families remains difficult. The Hin recombinase induces the site-specific inversion of a chromosomal DNA segment containing a promoter, which controls the alternate expression of two genes by reversibly switching orientation. The Hin recombinase consists of a single polypeptide chain containing a D
Probab=39.62  E-value=4.5  Score=16.41  Aligned_cols=18  Identities=0%  Similarity=-0.114  Sum_probs=11.1

Q ss_pred             hhhhhcCCCCCccceeec
Q psy12003          3 LLRDKNPPRGTERQIKIW   20 (61)
Q Consensus         3 ~~eLA~~l~Lte~~VqvW   20 (61)
                      +.++|..++++...|.-|
T Consensus        24 ~~~ia~~~~is~~tv~~~   41 (42)
T cd00569          24 VAEIARRLGVSRSTLYRY   41 (42)
T ss_pred             HHHHHHHHCCCHHHHHHh
Confidence            346677777776665544


No 242
>PRK05657 RNA polymerase sigma factor RpoS; Validated
Probab=39.50  E-value=5.6  Score=26.42  Aligned_cols=31  Identities=6%  Similarity=-0.100  Sum_probs=24.0

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHHh
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKEH   32 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~~   32 (61)
                      -+.|+|..+|++..+|+.+...-+.|-|+.-
T Consensus       284 s~~EIA~~Lgis~~tV~~~~~rAl~kLr~~l  314 (325)
T PRK05657        284 TLEDVAREIGLTRERVRQIQVEALRRLREIL  314 (325)
T ss_pred             CHHHHHHHHCcCHHHHHHHHHHHHHHHHHHH
Confidence            4689999999999999988765555555543


No 243
>cd04782 HTH_BltR Helix-Turn-Helix DNA binding domain of the BltR transcription regulator. Helix-turn-helix (HTH) multidrug-efflux transporter transcription regulator, BltR (BmrR-like transporter) of Bacillus subtilis, and related proteins; N-terminal domain. Blt, like Bmr, is a membrane protein which causes the efflux of a variety of toxic substances and antibiotics. These regulators are comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the C-terminal domains are often unrelated and bind specific coactivator molecules. They share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements.
Probab=39.49  E-value=4.6  Score=22.15  Aligned_cols=21  Identities=0%  Similarity=-0.270  Sum_probs=18.1

Q ss_pred             chhhhhcCCCCCccceeeccc
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      -|-|+|..+|++..+++-|.+
T Consensus         2 ~i~eva~~~gvs~~tlR~ye~   22 (97)
T cd04782           2 TTGEFAKLCGISKQTLFHYDK   22 (97)
T ss_pred             CHHHHHHHHCcCHHHHHHHHH
Confidence            467999999999999998854


No 244
>PRK15411 rcsA colanic acid capsular biosynthesis activation protein A; Provisional
Probab=39.18  E-value=6.6  Score=24.16  Aligned_cols=18  Identities=0%  Similarity=-0.032  Sum_probs=15.4

Q ss_pred             hhhhhcCCCCCccceeec
Q psy12003          3 LLRDKNPPRGTERQIKIW   20 (61)
Q Consensus         3 ~~eLA~~l~Lte~~VqvW   20 (61)
                      -.|+|.+|++++++|+.-
T Consensus       155 nkeIA~~L~iS~~TVk~h  172 (207)
T PRK15411        155 TIQISDQMNIKAKTVSSH  172 (207)
T ss_pred             HHHHHHHcCCCHHHHHHH
Confidence            368999999999999853


No 245
>PRK09706 transcriptional repressor DicA; Reviewed
Probab=38.98  E-value=5.7  Score=22.84  Aligned_cols=25  Identities=8%  Similarity=0.058  Sum_probs=21.5

Q ss_pred             hhhhhcCCCCCccceeeccccchhH
Q psy12003          3 LLRDKNPPRGTERQIKIWFQNRRMK   27 (61)
Q Consensus         3 ~~eLA~~l~Lte~~VqvWFqNrRak   27 (61)
                      ..+||..+|++...|.-|..+++..
T Consensus        21 q~~lA~~~gvs~~~is~~E~g~~~p   45 (135)
T PRK09706         21 QRSLAKAVKVSHVSISQWERDETEP   45 (135)
T ss_pred             HHHHHHHhCCCHHHHHHHHcCCCCC
Confidence            4689999999999999999988643


No 246
>PRK13890 conjugal transfer protein TrbA; Provisional
Probab=38.63  E-value=5.4  Score=22.89  Aligned_cols=24  Identities=0%  Similarity=-0.224  Sum_probs=20.4

Q ss_pred             chhhhhcCCCCCccceeeccccch
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRR   25 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrR   25 (61)
                      ...|||..+|++...|--|.++++
T Consensus        20 sq~eLA~~~Gis~~~is~iE~g~~   43 (120)
T PRK13890         20 TKKELSERSGVSISFLSDLTTGKA   43 (120)
T ss_pred             CHHHHHHHHCcCHHHHHHHHcCCC
Confidence            356899999999999998988876


No 247
>PRK09415 RNA polymerase factor sigma C; Reviewed
Probab=38.38  E-value=5.7  Score=23.56  Aligned_cols=21  Identities=10%  Similarity=0.077  Sum_probs=17.7

Q ss_pred             chhhhhcCCCCCccceeeccc
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      -..|+|..+|+++..|+....
T Consensus       145 s~~EIA~~l~is~~tv~~~l~  165 (179)
T PRK09415        145 SIKEIAEVTGVNENTVKTRLK  165 (179)
T ss_pred             CHHHHHHHHCCCHHHHHHHHH
Confidence            357899999999999987655


No 248
>cd08318 Death_NMPP84 Death domain of Nuclear Matrix Protein P84. Death domain (DD) found in the Nuclear Matrix Protein P84 (also known as HPR1 or THOC1). HPR1/p84 resides in the nuclear matrix and is part of the THO complex, also called TREX (transcription/export) complex, which functions in mRNP biogenesis at the interface between transcription and export of mRNA from the nucleus. Mice lacking THOC1 have abnormal testis development and are sterile. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN. They serve as adaptors in signaling pathways and can recruit other proteins into signaling complexes.
Probab=38.33  E-value=6.3  Score=21.29  Aligned_cols=16  Identities=6%  Similarity=-0.018  Sum_probs=13.5

Q ss_pred             hhhhcCCCCCccceee
Q psy12003          4 LRDKNPPRGTERQIKI   19 (61)
Q Consensus         4 ~eLA~~l~Lte~~Vqv   19 (61)
                      -+||+.||+++..|.-
T Consensus        22 k~Lar~LGls~~dI~~   37 (86)
T cd08318          22 KTLAPHLEMKDKEIRA   37 (86)
T ss_pred             HHHHHHcCCCHHHHHH
Confidence            4789999999998863


No 249
>cd08779 Death_PIDD Death Domain of p53-induced protein with a death domain. Death domain (DD) found in PIDD (p53-induced protein with a death domain) and similar proteins. PIDD is a component of the PIDDosome complex, which is an oligomeric caspase-activating complex involved in caspase-2 activation and plays a role in mediating stress-induced apoptosis. The PIDDosome complex is composed of three components, PIDD, RAIDD and caspase-2, which interact through their DDs and DD-like domains. The DD of PIDD interacts with the DD of RAIDD, which also contains a Caspase Activation and Recruitment Domain (CARD) that interacts with the caspase-2 CARD. Autoproteolysis of PIDD determines the downstream signaling event, between pro-survival NF-kB or pro-death caspase-2 activation. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members 
Probab=38.07  E-value=7.9  Score=20.97  Aligned_cols=22  Identities=18%  Similarity=0.080  Sum_probs=15.8

Q ss_pred             hhhhcCCCCCcccee-eccccch
Q psy12003          4 LRDKNPPRGTERQIK-IWFQNRR   25 (61)
Q Consensus         4 ~eLA~~l~Lte~~Vq-vWFqNrR   25 (61)
                      -+||+.|||++..|. |=.+|++
T Consensus        17 k~lar~LGlse~~Id~Ie~~~~~   39 (86)
T cd08779          17 QAIGLHLGLSYRELQRIKYNNRD   39 (86)
T ss_pred             HHHHHHcCCCHHHHHHHHHHCcc
Confidence            368999999999887 3344443


No 250
>PRK09726 antitoxin HipB; Provisional
Probab=37.99  E-value=5.6  Score=21.32  Aligned_cols=23  Identities=9%  Similarity=-0.143  Sum_probs=20.0

Q ss_pred             hhhhhcCCCCCccceeeccccch
Q psy12003          3 LLRDKNPPRGTERQIKIWFQNRR   25 (61)
Q Consensus         3 ~~eLA~~l~Lte~~VqvWFqNrR   25 (61)
                      ..+||..+|++...|.-|..+++
T Consensus        28 q~elA~~~gvs~~tis~~e~g~~   50 (88)
T PRK09726         28 QSELAKKIGIKQATISNFENNPD   50 (88)
T ss_pred             HHHHHHHHCcCHHHHHHHHCCCC
Confidence            57899999999999999988764


No 251
>PF00196 GerE:  Bacterial regulatory proteins, luxR family;  InterPro: IPR000792 This domain is a DNA-binding, helix-turn-helix (HTH) domain of about 65 amino acids, present in transcription regulators of the LuxR/FixJ family of response regulators. The domain is named after Vibrio fischeri luxR, a transcriptional activator for quorum-sensing control of luminescence. LuxR-type HTH domain proteins occur in a variety of organisms. The DNA-binding HTH domain is usually located in the C-terminal region; the N-terminal region often containing an autoinducer-binding domain or a response regulatory domain. Most luxR-type regulators act as transcription activators, but some can be repressors or have a dual role for different sites. LuxR-type HTH regulators control a wide variety of activities in various biological processes. The luxR-type, DNA-binding HTH domain forms a four-helical bundle structure. The HTH motif comprises the second and third helices, known as the scaffold and recognition helix, respectively. The HTH binds DNA in the major groove, where the N-terminal part of the recognition helix makes most of the DNA contacts. The fourth helix is involved in dimerisation of gerE and traR. Signalling events by one of the four activation mechanisms described below lead to multimerisation of the regulator. The regulators bind DNA as multimers [, , ]. LuxR-type HTH proteins can be activated by one of four different mechanisms: 1) Regulators which belong to a two-component sensory transduction system where the protein is activated by its phosphorylation, generally on an aspartate residue, by a transmembrane kinase [, ]. Some proteins that belong to this category are:  Rhizobiaceae fixJ (global regulator inducing expression of nitrogen-fixation genes in microaerobiosis)  Escherichia coli and Salmonella typhimurium uhpA (activates hexose phosphate transport gene uhpT) E. coli narL and narP (activate nitrate reductase operon) Enterobacteria rcsB (regulation of exopolysaccharide biosynthesis in enteric and plant pathogenesis)  Bordetella pertussis bvgA (virulence factor)  Bacillus subtilis coma (involved in expression of late-expressing competence genes) 2) Regulators which are activated, or in very rare cases repressed, when bound to N-acyl homoserine lactones, which are used as quorum sensing molecules in a variety of Gram-negative bacteria []: V. fischeri luxR (activates bioluminescence operon)  Agrobacterium tumefaciens traR (regulation of Ti plasmid transfer)  Erwinia carotovora carR (control of carbapenem antibiotics biosynthesis) E. carotovora expR (virulence factor for soft rot disease; activates plant tissue macerating enzyme genes)  Pseudomonas aeruginosa lasR (activates elastase gene lasB)  Erwinia chrysanthemi echR and Erwinia stewartii esaR  Pseudomonas chlororaphis phzR (positive regulator of phenazine antibiotic production)  Pseudomonas aeruginosa rhlR (activates rhlAB operon and lasB gene) 3) Autonomous effector domain regulators, without a regulatory domain, represented by gerE []. B. subtilis gerE (transcription activator and repressor for the regulation of spore formation) 4) Multiple ligand-binding regulators, exemplified by malT []. E. coli malT (activates maltose operon; MalT binds ATP and maltotriose); GO: 0003700 sequence-specific DNA binding transcription factor activity, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent, 0005622 intracellular; PDB: 3SZT_A 3CLO_A 1H0M_A 1L3L_A 3C57_B 1ZLK_B 1ZLJ_H 3C3W_B 1RNL_A 1ZG1_A ....
Probab=37.80  E-value=1.6  Score=21.53  Aligned_cols=24  Identities=8%  Similarity=-0.128  Sum_probs=17.8

Q ss_pred             chhhhhcCCCCCccceeeccccch
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRR   25 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrR   25 (61)
                      ...|+|..+++++.+|.....+=+
T Consensus        20 ~~~eIA~~l~is~~tV~~~~~~i~   43 (58)
T PF00196_consen   20 SNKEIAEELGISEKTVKSHRRRIM   43 (58)
T ss_dssp             -HHHHHHHHTSHHHHHHHHHHHHH
T ss_pred             CcchhHHhcCcchhhHHHHHHHHH
Confidence            456889999999999987654433


No 252
>PF14493 HTH_40:  Helix-turn-helix domain
Probab=37.45  E-value=11  Score=20.28  Aligned_cols=18  Identities=11%  Similarity=-0.049  Sum_probs=14.9

Q ss_pred             CchhhhhcCCCCCcccee
Q psy12003          1 MNLLRDKNPPRGTERQIK   18 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~Vq   18 (61)
                      |.|.|+|..-+|++.+|.
T Consensus        14 ~si~eIA~~R~L~~sTI~   31 (91)
T PF14493_consen   14 LSIEEIAKIRGLKESTIY   31 (91)
T ss_pred             CCHHHHHHHcCCCHHHHH
Confidence            457889999999998885


No 253
>cd08784 Death_DRs Death Domain of Death Receptors. Death domain (DD) found in death receptor proteins. Death receptors are members of the tumor necrosis factor (TNF) receptor superfamily, characterized by having a cytoplasmic DD. Known members of the family are Fas (CD95/APO-1), TNF-receptor 1 (TNFR1/TNFRSF1A/p55/CD120a), TNF-related apoptosis-inducing ligand receptor 1 (TRAIL-R1 /DR4), and receptor 2 (TRAIL-R2/DR5/APO-2/KILLER), as well as Death Receptor 3 (DR3/APO-3/TRAMP/WSL-1/LARD). They are involved in apoptosis signaling pathways. DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN. They serve as adaptors in signaling pathways and can recruit other proteins into signaling complexes.
Probab=37.24  E-value=7.1  Score=20.76  Aligned_cols=22  Identities=18%  Similarity=0.098  Sum_probs=15.9

Q ss_pred             hhhhcCCCCCccceee-ccccch
Q psy12003          4 LRDKNPPRGTERQIKI-WFQNRR   25 (61)
Q Consensus         4 ~eLA~~l~Lte~~Vqv-WFqNrR   25 (61)
                      .+||+.|||++..|.. =-.|++
T Consensus        15 k~laR~LGls~~~I~~ie~~~~~   37 (79)
T cd08784          15 KRFFRKLGLSDNEIKVAELDNPQ   37 (79)
T ss_pred             HHHHHHcCCCHHHHHHHHHcCCc
Confidence            4789999999998873 334444


No 254
>cd04783 HTH_MerR1 Helix-Turn-Helix DNA binding domain of the MerR1 transcription regulator. Helix-turn-helix (HTH) transcription regulator MerR1. MerR1 transcription regulators, such as Tn21 MerR and Tn501 MerR, mediate response to mercury exposure in eubacteria. These proteins are comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain winged HTH motifs that mediate DNA binding, while the C-terminal domains have three conserved cysteines that define a mercury binding site. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements.
Probab=37.23  E-value=5.2  Score=22.83  Aligned_cols=20  Identities=5%  Similarity=0.067  Sum_probs=17.2

Q ss_pred             CchhhhhcCCCCCccceeec
Q psy12003          1 MNLLRDKNPPRGTERQIKIW   20 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvW   20 (61)
                      |-|-|+|..+|++..+|+-|
T Consensus         1 m~I~e~a~~~gvs~~tlR~Y   20 (126)
T cd04783           1 LTIGELAKAAGVNVETIRYY   20 (126)
T ss_pred             CCHHHHHHHHCcCHHHHHHH
Confidence            56789999999999999776


No 255
>KOG4580|consensus
Probab=37.20  E-value=13  Score=21.48  Aligned_cols=12  Identities=42%  Similarity=0.805  Sum_probs=9.5

Q ss_pred             eeeccccchhHH
Q psy12003         17 IKIWFQNRRMKW   28 (61)
Q Consensus        17 VqvWFqNrRak~   28 (61)
                      -||||-|.|.--
T Consensus        10 pKV~fANERTFl   21 (112)
T KOG4580|consen   10 PKVWFANERTFL   21 (112)
T ss_pred             ceeeeechHHHH
Confidence            479999999753


No 256
>PRK11169 leucine-responsive transcriptional regulator; Provisional
Probab=37.11  E-value=6.7  Score=23.36  Aligned_cols=16  Identities=0%  Similarity=-0.301  Sum_probs=13.9

Q ss_pred             hhhhhcCCCCCcccee
Q psy12003          3 LLRDKNPPRGTERQIK   18 (61)
Q Consensus         3 ~~eLA~~l~Lte~~Vq   18 (61)
                      ..|||+++||++..|.
T Consensus        31 ~~eiA~~lglS~~tv~   46 (164)
T PRK11169         31 NVELSKRVGLSPTPCL   46 (164)
T ss_pred             HHHHHHHHCcCHHHHH
Confidence            5789999999999884


No 257
>TIGR02941 Sigma_B RNA polymerase sigma-B factor. This sigma factor is restricted to certain lineages of the order Bacillales including Staphylococcus, Listeria and Bacillus.
Probab=36.95  E-value=6.3  Score=24.82  Aligned_cols=26  Identities=4%  Similarity=-0.126  Sum_probs=19.5

Q ss_pred             chhhhhcCCCCCccceeeccccchhH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMK   27 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak   27 (61)
                      -+.|+|..+|+++.+|+.+...=+.+
T Consensus       223 s~~eIA~~lgis~~~V~~~~~ra~~~  248 (255)
T TIGR02941       223 SQKETGERLGISQMHVSRLQRQAISK  248 (255)
T ss_pred             CHHHHHHHHCcCHHHHHHHHHHHHHH
Confidence            46799999999999998765433333


No 258
>COG2452 Predicted site-specific integrase-resolvase [DNA replication, recombination, and repair]
Probab=36.87  E-value=6  Score=24.99  Aligned_cols=27  Identities=4%  Similarity=0.101  Sum_probs=23.5

Q ss_pred             CchhhhhcCCCCCccceeeccccchhH
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQNRRMK   27 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFqNrRak   27 (61)
                      |++.|-|..+|++..+...||...+-+
T Consensus         2 m~~~e~~~~lgis~~Tl~rw~r~G~i~   28 (193)
T COG2452           2 LRPKEACQLLGISYSTLLRWIREGKIR   28 (193)
T ss_pred             CCHHHHHHHhCcCHHHHHHHHHcCccc
Confidence            788999999999999999999876544


No 259
>TIGR02984 Sig-70_plancto1 RNA polymerase sigma-70 factor, Planctomycetaceae-specific subfamily 1. This group of sigma factors are members of the sigma-70 family (TIGR02937) and are apparently found only in the Planctomycetaceae family including the genuses Gemmata and Pirellula (in which seven sequences are found).
Probab=36.40  E-value=6  Score=23.25  Aligned_cols=20  Identities=5%  Similarity=0.115  Sum_probs=16.4

Q ss_pred             CchhhhhcCCCCCccceeec
Q psy12003          1 MNLLRDKNPPRGTERQIKIW   20 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvW   20 (61)
                      +...|+|..+|+++..|+.=
T Consensus       157 ~s~~eIA~~lgis~~~v~~~  176 (189)
T TIGR02984       157 LSFAEVAERMDRSEGAVSML  176 (189)
T ss_pred             CCHHHHHHHHCcCHHHHHHH
Confidence            34679999999999999753


No 260
>PF09607 BrkDBD:  Brinker DNA-binding domain;  InterPro: IPR018586  This DNA-binding domain is the first approx. 100 residues of the N-terminal end of Brinker. The structure of this domain in complex with DNA consists of four alpha-helices that contain a helix-turn-helix DNA recognition motif specific for GC-rich DNA. The Brinker nuclear repressor is a major element of the Drosophila Decapentaplegic morphogen signalling pathway []. ; PDB: 2GLO_A.
Probab=36.05  E-value=3.5  Score=21.28  Aligned_cols=17  Identities=18%  Similarity=0.348  Sum_probs=13.2

Q ss_pred             hhcCCCCCccceeeccc
Q psy12003          6 DKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         6 LA~~l~Lte~~VqvWFq   22 (61)
                      -|++.|+++.+|+-|.+
T Consensus        31 aarkf~V~r~~Vr~W~k   47 (58)
T PF09607_consen   31 AARKFNVSRRQVRKWRK   47 (58)
T ss_dssp             HHHHTTS-HHHHHHHHT
T ss_pred             HHHHhCccHHHHHHHHH
Confidence            47888999999998854


No 261
>COG1309 AcrR Transcriptional regulator [Transcription]
Probab=36.05  E-value=10  Score=20.87  Aligned_cols=23  Identities=4%  Similarity=0.019  Sum_probs=20.4

Q ss_pred             hhhhhcCCCCCccceeeccccch
Q psy12003          3 LLRDKNPPRGTERQIKIWFQNRR   25 (61)
Q Consensus         3 ~~eLA~~l~Lte~~VqvWFqNrR   25 (61)
                      +.+||.++|++...+--.|.|+-
T Consensus        35 ~~~Ia~~agvs~~~~Y~~f~~K~   57 (201)
T COG1309          35 VDEIAKAAGVSKGTLYRHFPSKE   57 (201)
T ss_pred             HHHHHHHhCCCcchhHHHcCCHH
Confidence            57899999999999999999874


No 262
>COG5264 VTC1 Vacuolar transporter chaperone [Posttranslational modification, protein turnover, chaperones]
Probab=35.82  E-value=15  Score=21.80  Aligned_cols=12  Identities=42%  Similarity=0.805  Sum_probs=9.5

Q ss_pred             eeeccccchhHH
Q psy12003         17 IKIWFQNRRMKW   28 (61)
Q Consensus        17 VqvWFqNrRak~   28 (61)
                      -||||-|.|.--
T Consensus        25 pKv~fAnERTfl   36 (126)
T COG5264          25 PKVWFANERTFL   36 (126)
T ss_pred             ceeeeechHHHH
Confidence            469999999753


No 263
>PRK12517 RNA polymerase sigma factor; Provisional
Probab=35.56  E-value=7.5  Score=23.39  Aligned_cols=29  Identities=7%  Similarity=-0.118  Sum_probs=21.2

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKK   30 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr   30 (61)
                      ...|+|..||+++..|+++..--|.+-++
T Consensus       146 s~~EIA~~lgis~~tV~~~l~Rar~~Lr~  174 (188)
T PRK12517        146 SGEEIAEILDLNKNTVMTRLFRARNQLKE  174 (188)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHHHHHHHH
Confidence            35799999999999999875533433333


No 264
>PRK13749 transcriptional regulator MerD; Provisional
Probab=35.41  E-value=6  Score=22.98  Aligned_cols=20  Identities=5%  Similarity=-0.047  Sum_probs=17.0

Q ss_pred             CchhhhhcCCCCCccceeec
Q psy12003          1 MNLLRDKNPPRGTERQIKIW   20 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvW   20 (61)
                      |-|-|+|..+|+|..+|+-|
T Consensus         4 ~tIgelA~~~gvS~~tiR~Y   23 (121)
T PRK13749          4 YTVSRLALDAGVSVHIVRDY   23 (121)
T ss_pred             CcHHHHHHHHCCCHHHHHHH
Confidence            35789999999999999865


No 265
>COG3747 Phage terminase, small subunit [DNA replication, recombination, and repair]
Probab=35.38  E-value=9.5  Score=23.36  Aligned_cols=15  Identities=27%  Similarity=0.067  Sum_probs=12.8

Q ss_pred             CchhhhhcCCCCCcc
Q psy12003          1 MNLLRDKNPPRGTER   15 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~   15 (61)
                      ++|..||..|||++.
T Consensus       119 ~~l~klaSeLGltP~  133 (160)
T COG3747         119 RNLLKLASELGLTPS  133 (160)
T ss_pred             HHHHHHHHHhCCChH
Confidence            468999999999974


No 266
>PRK09643 RNA polymerase sigma factor SigM; Reviewed
Probab=35.17  E-value=7.6  Score=23.36  Aligned_cols=18  Identities=11%  Similarity=-0.007  Sum_probs=15.7

Q ss_pred             chhhhhcCCCCCccceee
Q psy12003          2 NLLRDKNPPRGTERQIKI   19 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~Vqv   19 (61)
                      ...|+|..+|+++.+|++
T Consensus       152 s~~EIA~~lg~s~~tV~~  169 (192)
T PRK09643        152 SVADAARMLGVAEGTVKS  169 (192)
T ss_pred             CHHHHHHHHCcCHHHHHH
Confidence            467999999999999975


No 267
>COG3655 Predicted transcriptional regulator [Transcription]
Probab=35.08  E-value=6.8  Score=21.06  Aligned_cols=19  Identities=11%  Similarity=0.010  Sum_probs=15.6

Q ss_pred             CchhhhhcCCCCCccceee
Q psy12003          1 MNLLRDKNPPRGTERQIKI   19 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~Vqv   19 (61)
                      ++..|||..+|+++..+.+
T Consensus        16 ~~~~eLa~~igis~~~ls~   34 (73)
T COG3655          16 ISLKELAEAIGISEANLSK   34 (73)
T ss_pred             hhHHHHHHHHcccHHHHHH
Confidence            3578999999999988763


No 268
>PRK06288 RNA polymerase sigma factor WhiG; Reviewed
Probab=34.56  E-value=7.8  Score=24.70  Aligned_cols=30  Identities=13%  Similarity=0.051  Sum_probs=21.9

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKE   31 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~   31 (61)
                      -+.|+|..+|+++.+|+.....-+.+-|+.
T Consensus       230 s~~eIA~~lgis~~tV~~~~~ra~~~Lr~~  259 (268)
T PRK06288        230 TLKEIGKVLGVTESRISQLHTKAVLQLRAK  259 (268)
T ss_pred             CHHHHHHHHCcCHHHHHHHHHHHHHHHHHH
Confidence            467999999999999986655444444443


No 269
>TIGR02051 MerR Hg(II)-responsive transcriptional regulator. This model represents the mercury (II) responsive transcriptional activator of the mer organomercurial resistance operon. This protein is a member of the MerR family of transcriptional activators (pfam00376) and contains a distinctive pattern of cysteine residues in its metal binding loop, Cys-X(8)-Cys-Pro, as well as a conserved and critical cysteine at the N-terminal end of the dimerization helix.
Probab=34.31  E-value=5.6  Score=22.76  Aligned_cols=18  Identities=6%  Similarity=0.014  Sum_probs=15.9

Q ss_pred             hhhhhcCCCCCccceeec
Q psy12003          3 LLRDKNPPRGTERQIKIW   20 (61)
Q Consensus         3 ~~eLA~~l~Lte~~VqvW   20 (61)
                      |-|+|..+|++..+|+-|
T Consensus         2 I~e~a~~~gvs~~tlR~Y   19 (124)
T TIGR02051         2 IGELAKAAGVNVETIRYY   19 (124)
T ss_pred             HHHHHHHHCcCHHHHHHH
Confidence            568999999999999887


No 270
>COG1522 Lrp Transcriptional regulators [Transcription]
Probab=34.15  E-value=10  Score=21.74  Aligned_cols=17  Identities=0%  Similarity=-0.246  Sum_probs=14.4

Q ss_pred             chhhhhcCCCCCcccee
Q psy12003          2 NLLRDKNPPRGTERQIK   18 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~Vq   18 (61)
                      -+.|||.++|+++..|.
T Consensus        24 ~~~eia~~lglS~~~v~   40 (154)
T COG1522          24 SNAELAERVGLSPSTVL   40 (154)
T ss_pred             CHHHHHHHHCCCHHHHH
Confidence            36799999999998884


No 271
>KOG4752|consensus
Probab=33.88  E-value=27  Score=14.82  Aligned_cols=7  Identities=57%  Similarity=1.355  Sum_probs=3.7

Q ss_pred             hhHHHHH
Q psy12003         25 RMKWKKE   31 (61)
Q Consensus        25 Rak~kr~   31 (61)
                      |+||++.
T Consensus         2 r~kwrkk    8 (26)
T KOG4752|consen    2 RAKWRKK    8 (26)
T ss_pred             chHHHHH
Confidence            4555554


No 272
>cd08804 Death_ank2 Death domain of Ankyrin-2. Death Domain (DD) of Ankyrin-2 (ANK-2) and related proteins. Ankyrins are modular proteins comprising three conserved domains, an N-terminal membrane-binding domain containing ANK repeats, a spectrin-binding domain and a C-terminal DD. ANK-2, also called ankyrin-B (for broadly expressed), is required for proper function of the Na/Ca ion exchanger-1 in cardiomyocytes, and is thought to function in linking integral membrane proteins to the underlying cytoskeleton. Human ANK-2 is associated with "Ankyrin-B syndrome", an atypical arrythmia disorder with risk of sudden cardiac death. It also plays key roles in the brain and striated muscle. Loss of ANK-2 is associated with significant nervous system defects and sarcomere disorganization. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other
Probab=33.87  E-value=8.4  Score=20.79  Aligned_cols=15  Identities=27%  Similarity=0.014  Sum_probs=13.0

Q ss_pred             hhhhcCCCCCcccee
Q psy12003          4 LRDKNPPRGTERQIK   18 (61)
Q Consensus         4 ~eLA~~l~Lte~~Vq   18 (61)
                      .+||+.||+++..|.
T Consensus        19 k~LAr~Lg~se~dI~   33 (84)
T cd08804          19 TELARELDFTEEQIH   33 (84)
T ss_pred             HHHHHHcCCCHHHHH
Confidence            578999999999876


No 273
>cd08317 Death_ank Death domain associated with Ankyrins. Death Domain (DD) associated with Ankyrins. Ankyrins are modular proteins comprising three conserved domains, an N-terminal membrane-binding domain containing ANK repeats, a spectrin-binding domain and a C-terminal DD. Ankyrins function as adaptor proteins and they interact, through ANK repeats, with structurally diverse membrane proteins, including ion channels/pumps, calcium release channels, and cell adhesion molecules. They play critical roles in the proper expression and membrane localization of these proteins. In mammals, this family includes ankyrin-R for restricted (or ANK1), ankyrin-B for broadly expressed (or ANK2) and ankyrin-G for general or giant (or ANK3). They are expressed in different combinations in many tissues and play non-overlapping functions. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-associati
Probab=33.86  E-value=8.3  Score=20.56  Aligned_cols=16  Identities=13%  Similarity=0.025  Sum_probs=13.5

Q ss_pred             hhhhcCCCCCccceee
Q psy12003          4 LRDKNPPRGTERQIKI   19 (61)
Q Consensus         4 ~eLA~~l~Lte~~Vqv   19 (61)
                      .+||+.||+++..|..
T Consensus        19 ~~LAr~Lg~~~~dI~~   34 (84)
T cd08317          19 PQLARELGVSETDIDL   34 (84)
T ss_pred             HHHHHHcCCCHHHHHH
Confidence            5799999999987774


No 274
>PRK08241 RNA polymerase factor sigma-70; Validated
Probab=33.82  E-value=7  Score=25.52  Aligned_cols=22  Identities=5%  Similarity=-0.126  Sum_probs=18.2

Q ss_pred             CchhhhhcCCCCCccceeeccc
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      |...|+|..||+++..|+.-..
T Consensus       170 ~s~~EIA~~lgis~~tVk~~l~  191 (339)
T PRK08241        170 WSAAEVAELLDTSVAAVNSALQ  191 (339)
T ss_pred             CCHHHHHHHhCCCHHHHHHHHH
Confidence            3467999999999999987654


No 275
>cd01111 HTH_MerD Helix-Turn-Helix DNA binding domain of the MerD transcription regulator. Helix-turn-helix (HTH) transcription regulator MerD. The putative secondary regulator of mercury resistance (mer) operons, MerD, has been shown to down-regulate the expression of this operon in gram-negative bacteria. It binds to the same operator DNA as MerR that activates transcription of the operon in the presence of mercury ions. The MerD protein shares the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily, which promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are conserved and contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules such as metal ions, drugs, 
Probab=33.58  E-value=6.6  Score=22.06  Aligned_cols=21  Identities=0%  Similarity=-0.064  Sum_probs=17.9

Q ss_pred             chhhhhcCCCCCccceeeccc
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      -|-|+|..+|++..+|+-|-+
T Consensus         2 ~Ige~A~~~gvs~~tlR~ye~   22 (107)
T cd01111           2 SISQLALDAGVSVHIVRDYLL   22 (107)
T ss_pred             CHHHHHHHHCcCHHHHHHHHH
Confidence            467899999999999998844


No 276
>PRK10100 DNA-binding transcriptional regulator CsgD; Provisional
Probab=33.51  E-value=5.4  Score=24.88  Aligned_cols=26  Identities=15%  Similarity=-0.127  Sum_probs=20.1

Q ss_pred             hhhhhcCCCCCccceeeccccchhHH
Q psy12003          3 LLRDKNPPRGTERQIKIWFQNRRMKW   28 (61)
Q Consensus         3 ~~eLA~~l~Lte~~VqvWFqNrRak~   28 (61)
                      -.|+|..|++++.+|+.+..+=..|.
T Consensus       173 ~~eIA~~L~iS~~TVk~~~~~i~~Kl  198 (216)
T PRK10100        173 NNEIARSLFISENTVKTHLYNLFKKI  198 (216)
T ss_pred             HHHHHHHhCCCHHHHHHHHHHHHHHh
Confidence            36889999999999998766554443


No 277
>COG2944 Predicted transcriptional regulator [Transcription]
Probab=32.82  E-value=5.7  Score=22.73  Aligned_cols=22  Identities=14%  Similarity=0.096  Sum_probs=18.9

Q ss_pred             hhhcCCCCCccceeeccccchh
Q psy12003          5 RDKNPPRGTERQIKIWFQNRRM   26 (61)
Q Consensus         5 eLA~~l~Lte~~VqvWFqNrRa   26 (61)
                      +.|+.||++..+|+-|=|+|+.
T Consensus        62 vFA~~L~vs~~Tv~~WEqGr~k   83 (104)
T COG2944          62 VFARYLGVSVSTVRKWEQGRKK   83 (104)
T ss_pred             HHHHHHCCCHHHHHHHHcCCcC
Confidence            5688899999999999888764


No 278
>smart00342 HTH_ARAC helix_turn_helix, arabinose operon control protein.
Probab=32.75  E-value=9  Score=19.03  Aligned_cols=20  Identities=15%  Similarity=0.110  Sum_probs=15.8

Q ss_pred             chhhhhcCCCCCccceeecc
Q psy12003          2 NLLRDKNPPRGTERQIKIWF   21 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWF   21 (61)
                      .|.+||..+|+++..+.--|
T Consensus         3 ~~~~la~~~~~s~~~l~~~f   22 (84)
T smart00342        3 TLEDLAEALGMSPRHLQRLF   22 (84)
T ss_pred             CHHHHHHHhCCCHHHHHHHH
Confidence            47889999999998876444


No 279
>PF00424 REV:  REV protein (anti-repression trans-activator protein);  InterPro: IPR000625 REV is a viral anti-repression trans-activator protein, which appears to act post-transcriptionally [] to relieve negative repression of GAG and ENV production. It is a phosphoprotein [, ] whose state of phosphorylation is mediated by a specific serine kinase activity present in the nucleus []. REV accumulates in the nucleoli [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent, 0042025 host cell nucleus; PDB: 1ETF_B 1ETG_B 1ULL_B 3LPH_B 2X7L_R.
Probab=32.64  E-value=24  Score=19.78  Aligned_cols=13  Identities=31%  Similarity=0.910  Sum_probs=10.0

Q ss_pred             ccchhHHHHHhhh
Q psy12003         22 QNRRMKWKKEHKM   34 (61)
Q Consensus        22 qNrRak~kr~~~~   34 (61)
                      .|||.+|++.+..
T Consensus        37 RnRRRRWR~rq~Q   49 (91)
T PF00424_consen   37 RNRRRRWRARQRQ   49 (91)
T ss_dssp             HHHHHHHHHHHHH
T ss_pred             cchhhhHHHHHHH
Confidence            5889999988653


No 280
>cd04776 HTH_GnyR Helix-Turn-Helix DNA binding domain of the regulatory protein GnyR. Putative helix-turn-helix (HTH) regulatory protein, GnyR, and other related proteins. GnyR belongs to the gnyRDBHAL cluster, which is involved in acyclic isoprenoid degradation in Pseudomonas aeruginosa. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.
Probab=32.07  E-value=7.2  Score=22.20  Aligned_cols=20  Identities=10%  Similarity=0.114  Sum_probs=17.0

Q ss_pred             CchhhhhcCCCCCccceeec
Q psy12003          1 MNLLRDKNPPRGTERQIKIW   20 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvW   20 (61)
                      +-|-|+|..+|+|..+++-|
T Consensus         1 ~~Igeva~~~gvs~~tlRyY   20 (118)
T cd04776           1 YTISELAREFDVTPRTLRFY   20 (118)
T ss_pred             CCHHHHHHHHCcCHHHHHHH
Confidence            35778999999999999877


No 281
>TIGR02393 RpoD_Cterm RNA polymerase sigma factor RpoD, C-terminal domain. This model represents the well-conserved C-terminal region of the major, essential sigma factor of most bacteria. Members of this clade show considerable variability in domain architecture and molecular weight, as well as in nomenclature: RpoD in E. coli and other Proteobacteria, SigA in Bacillus subtilis and many other Gram-positive bacteria, HrdB in Streptomyces, MysA in Mycobacterium smegmatis, etc.
Probab=31.84  E-value=8  Score=24.18  Aligned_cols=30  Identities=13%  Similarity=-0.027  Sum_probs=22.6

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKE   31 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~   31 (61)
                      .+.|+|..+|++..+|+-..+.=..|.|..
T Consensus       198 t~~EIA~~lgis~~~V~q~~~~al~kLr~~  227 (238)
T TIGR02393       198 TLEEVGKEFNVTRERIRQIESKALRKLRHP  227 (238)
T ss_pred             cHHHHHHHHCCCHHHHHHHHHHHHHHHhhh
Confidence            478999999999999987765555554443


No 282
>TIGR02846 spore_sigmaK RNA polymerase sigma-K factor. The sporulation-specific transcription factor sigma-K (also called sigma-27) is expressed in the mother cell compartment of endospore-forming bacteria such as Bacillus subtilis. Like its close homolog sigma-E (sigma-29) (see TIGR02835), also specific to the mother cell compartment, it must be activated by a proteolytic cleavage. Note that in Bacillus subtilis (and apparently also Clostridium tetani), but not in other endospore forming species such as Bacillus anthracis, the sigK gene is generated by a non-germline (mother cell only) chromosomal rearrangement that recombines coding regions for the N-terminal and C-terminal regions of sigma-K.
Probab=31.68  E-value=8.9  Score=23.79  Aligned_cols=20  Identities=0%  Similarity=-0.356  Sum_probs=16.7

Q ss_pred             chhhhhcCCCCCccceeecc
Q psy12003          2 NLLRDKNPPRGTERQIKIWF   21 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWF   21 (61)
                      .+.|+|..+|+++.+|+.+.
T Consensus       196 S~~EIAe~lgis~~tV~~~~  215 (227)
T TIGR02846       196 TQREIAKILGISRSYVSRIE  215 (227)
T ss_pred             CHHHHHHHHCCCHHHHHHHH
Confidence            46899999999999997653


No 283
>cd08319 Death_RAIDD Death domain of RIP-associated ICH-1 homologous protein with a death domain. Death domain (DD) of RAIDD (RIP-associated ICH-1 homologous protein with a death domain), also known as CRADD (Caspase and RIP adaptor). RAIDD is an adaptor protein that together with the p53-inducible protein PIDD and caspase-2, forms the PIDDosome complex, which is required for caspase-2 activation and plays a role in mediating stress-induced apoptosis. RAIDD contains an N-terminal Caspase Activation and Recruitment Domain (CARD), which interacts with the caspase-2 CARD, and a C-terminal DD, which interacts with the DD of PIDD. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD, DED (Death Effector Domain), and PYRIN. They serve as adaptors in signaling pathways and can recruit other pr
Probab=31.60  E-value=9.4  Score=20.75  Aligned_cols=20  Identities=10%  Similarity=-0.215  Sum_probs=15.9

Q ss_pred             hhhhcCCCCCccceeecccc
Q psy12003          4 LRDKNPPRGTERQIKIWFQN   23 (61)
Q Consensus         4 ~eLA~~l~Lte~~VqvWFqN   23 (61)
                      ..||+.||||+..|...-.+
T Consensus        17 ~~Lar~Lgls~~~I~~i~~~   36 (83)
T cd08319          17 EQVLLDLGLSQTDIYRCKEN   36 (83)
T ss_pred             HHHHHHcCCCHHHHHHHHHh
Confidence            36899999999988866555


No 284
>TIGR03541 reg_near_HchA LuxR family transcriptional regulatory, chaperone HchA-associated. Members of this protein family belong to the LuxR transcriptional regulator family, and contain both autoinducer binding (pfam03472) and transcriptional regulator (pfam00196) domains. Members, however, occur only in a few members of the Gammaproteobacteria that have the chaperone/aminopeptidase HchA, and are always encoded by the adjacent gene.
Probab=31.56  E-value=5.4  Score=25.00  Aligned_cols=27  Identities=15%  Similarity=0.011  Sum_probs=21.4

Q ss_pred             hhhhhcCCCCCccceeeccccchhHHH
Q psy12003          3 LLRDKNPPRGTERQIKIWFQNRRMKWK   29 (61)
Q Consensus         3 ~~eLA~~l~Lte~~VqvWFqNrRak~k   29 (61)
                      ..|+|..|++++.+|+....|=+.|-+
T Consensus       189 ~~eIa~~l~is~~Tv~~~l~~~~~kl~  215 (232)
T TIGR03541       189 QADIAAILGISERTVENHLRSARRKLG  215 (232)
T ss_pred             HHHHHHHHCcCHHHHHHHHHHHHHHHC
Confidence            468899999999999988776655544


No 285
>cd08777 Death_RIP1 Death Domain of Receptor-Interacting Protein 1. Death domain (DD) found in Receptor-Interacting Protein 1 (RIP1) and related proteins. RIP kinases serve as essential sensors of cellular stress. Vertebrates contain several types containing a homologous N-terminal kinase domain and varying C-terminal domains. RIP1 harbors a C-terminal DD, which binds death receptors (DRs) including TNF receptor 1, Fas, TNF-related apoptosis-inducing ligand receptor 1 (TRAILR1), and TRAILR2. It also interacts with other DD-containing adaptor proteins such as TRADD and FADD. RIP1 plays a crucial role in determining a cell's fate, between survival or death, following exposure to stress signals. It is important in the signaling of NF-kappaB and MAPKs, and it links DR-associated signaling to reactive oxygen species (ROS) production. Abnormal RIP1 function may result in ROS accumulation affecting inflammatory responses, innate immunity, stress responses, and cell survival. In general, DDs ar
Probab=31.17  E-value=9.6  Score=20.71  Aligned_cols=16  Identities=25%  Similarity=0.009  Sum_probs=13.9

Q ss_pred             hhhhcCCCCCccceee
Q psy12003          4 LRDKNPPRGTERQIKI   19 (61)
Q Consensus         4 ~eLA~~l~Lte~~Vqv   19 (61)
                      .+||+.||+++..|..
T Consensus        17 k~lar~LG~s~~eI~~   32 (86)
T cd08777          17 KRCARKLGFTESEIEE   32 (86)
T ss_pred             HHHHHHcCCCHHHHHH
Confidence            4789999999999885


No 286
>PF13560 HTH_31:  Helix-turn-helix domain; PDB: 3F51_C 3F52_A 3PXP_A 2OFY_A.
Probab=31.14  E-value=4.6  Score=20.15  Aligned_cols=24  Identities=8%  Similarity=-0.053  Sum_probs=19.5

Q ss_pred             hhhhhcCCCCCccceeeccccchh
Q psy12003          3 LLRDKNPPRGTERQIKIWFQNRRM   26 (61)
Q Consensus         3 ~~eLA~~l~Lte~~VqvWFqNrRa   26 (61)
                      ..++|..+|++...|.-|-.+++.
T Consensus        17 ~~~lA~~~g~s~s~v~~iE~G~~~   40 (64)
T PF13560_consen   17 QAQLADRLGVSQSTVSRIERGRRP   40 (64)
T ss_dssp             HHHHHHHHTS-HHHHHHHHTTSSS
T ss_pred             HHHHHHHHCcCHHHHHHHHCCCCC
Confidence            468899999999999988888874


No 287
>PRK15002 redox-sensitivie transcriptional activator SoxR; Provisional
Probab=30.98  E-value=7.8  Score=23.30  Aligned_cols=22  Identities=0%  Similarity=-0.106  Sum_probs=18.1

Q ss_pred             CchhhhhcCCCCCccceeeccc
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      |-|-|+|..+|++..+|+-|-+
T Consensus        12 ~~IgevAk~~gvs~~TlRyYE~   33 (154)
T PRK15002         12 LTPGEVAKRSGVAVSALHFYES   33 (154)
T ss_pred             ccHHHHHHHHCcCHHHHHHHHH
Confidence            4577899999999999987754


No 288
>cd04772 HTH_TioE_rpt1 First Helix-Turn-Helix DNA binding domain of the regulatory protein TioE. Putative helix-turn-helix (HTH) regulatory protein, TioE, and related proteins. TioE is part of the thiocoraline gene cluster, which is involved in the biosynthesis of the antitumor thiocoraline from the marine actinomycete, Micromonospora. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. Proteins in this family are unique within the MerR superfamily in that they are composed of just two adjacent MerR-like N-terminal domains; this CD contains the N-terminal or first repeat (rpt1) of these tandem MerR-like domain proteins.
Probab=30.90  E-value=6.9  Score=21.56  Aligned_cols=20  Identities=0%  Similarity=-0.091  Sum_probs=17.1

Q ss_pred             chhhhhcCCCCCccceeecc
Q psy12003          2 NLLRDKNPPRGTERQIKIWF   21 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWF   21 (61)
                      .+.|+|..+|++..+++-|-
T Consensus         2 ~i~e~A~~~gvs~~tlR~Ye   21 (99)
T cd04772           2 RTVDLARAIGLSPQTVRNYE   21 (99)
T ss_pred             CHHHHHHHHCcCHHHHHHHH
Confidence            36789999999999998873


No 289
>PRK13752 putative transcriptional regulator MerR; Provisional
Probab=30.79  E-value=7.6  Score=22.99  Aligned_cols=20  Identities=5%  Similarity=0.047  Sum_probs=16.7

Q ss_pred             CchhhhhcCCCCCccceeec
Q psy12003          1 MNLLRDKNPPRGTERQIKIW   20 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvW   20 (61)
                      |.|-|+|..+|+|..+++-|
T Consensus         8 ~~IgevAk~~Gvs~~TLRyY   27 (144)
T PRK13752          8 LTIGVFAKAAGVNVETIRFY   27 (144)
T ss_pred             ccHHHHHHHHCcCHHHHHHH
Confidence            35778999999999998876


No 290
>PF06032 DUF917:  Protein of unknown function (DUF917);  InterPro: IPR010318 This family consists of hypothetical bacterial and archaeal proteins of unknown function.; PDB: 2O3I_B.
Probab=30.71  E-value=23  Score=24.03  Aligned_cols=12  Identities=42%  Similarity=0.642  Sum_probs=10.1

Q ss_pred             Cccceeeccccc
Q psy12003         13 TERQIKIWFQNR   24 (61)
Q Consensus        13 te~~VqvWFqNr   24 (61)
                      .++.++|||||.
T Consensus       267 ~~~~~~i~fqNE  278 (353)
T PF06032_consen  267 KGRTLRIEFQNE  278 (353)
T ss_dssp             TTEEEEEEESSS
T ss_pred             CCCEEEEEEEcC
Confidence            567899999996


No 291
>PRK10046 dpiA two-component response regulator DpiA; Provisional
Probab=30.68  E-value=9.5  Score=23.26  Aligned_cols=16  Identities=0%  Similarity=-0.203  Sum_probs=14.1

Q ss_pred             hhhhhcCCCCCcccee
Q psy12003          3 LLRDKNPPRGTERQIK   18 (61)
Q Consensus         3 ~~eLA~~l~Lte~~Vq   18 (61)
                      ..|+|.+|++++.+|+
T Consensus       180 ~~eIa~~l~iS~~Tv~  195 (225)
T PRK10046        180 AETVAQALTISRTTAR  195 (225)
T ss_pred             HHHHHHHhCccHHHHH
Confidence            3579999999999997


No 292
>COG5566 Uncharacterized conserved protein [Function unknown]
Probab=30.65  E-value=11  Score=22.46  Aligned_cols=19  Identities=21%  Similarity=0.067  Sum_probs=16.5

Q ss_pred             CchhhhhcCCCCCccceee
Q psy12003          1 MNLLRDKNPPRGTERQIKI   19 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~Vqv   19 (61)
                      |++.|||.+-.||+..|-.
T Consensus       103 ~n~~eLaKkYrlS~~~Iy~  121 (137)
T COG5566         103 SNYVELAKKYRLSENHIYR  121 (137)
T ss_pred             ccHHHHHHHhcccHHHHHH
Confidence            5889999999999988753


No 293
>TIGR02885 spore_sigF RNA polymerase sigma-F factor. Members of this protein family are the RNA polymerase sigma factor F. Sigma-F is specifically and universally a component of the Firmicutes lineage endospore formation program, and is expressed in the forespore to turn on expression of dozens of genes. It is closely homologous to sigma-G, which is also expressed in the forespore.
Probab=30.60  E-value=8.7  Score=23.74  Aligned_cols=20  Identities=10%  Similarity=-0.149  Sum_probs=16.8

Q ss_pred             CchhhhhcCCCCCccceeec
Q psy12003          1 MNLLRDKNPPRGTERQIKIW   20 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvW   20 (61)
                      +.+.|+|..+|++..+|..+
T Consensus       200 ~t~~eIA~~lgis~~~V~~~  219 (231)
T TIGR02885       200 KTQTEVANMLGISQVQVSRL  219 (231)
T ss_pred             CCHHHHHHHHCcCHHHHHHH
Confidence            45789999999999998754


No 294
>PRK05803 sporulation sigma factor SigK; Reviewed
Probab=30.54  E-value=9.3  Score=23.76  Aligned_cols=20  Identities=0%  Similarity=-0.308  Sum_probs=16.6

Q ss_pred             chhhhhcCCCCCccceeecc
Q psy12003          2 NLLRDKNPPRGTERQIKIWF   21 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWF   21 (61)
                      .+.|+|..+|+|+.+|+.+-
T Consensus       197 S~~EIA~~lgis~~tV~~~~  216 (233)
T PRK05803        197 TQREIAKALGISRSYVSRIE  216 (233)
T ss_pred             CHHHHHHHHCcCHHHHHHHH
Confidence            36789999999999997653


No 295
>PRK10651 transcriptional regulator NarL; Provisional
Probab=30.44  E-value=6.9  Score=22.65  Aligned_cols=25  Identities=16%  Similarity=-0.044  Sum_probs=19.1

Q ss_pred             hhhhhcCCCCCccceeeccccchhH
Q psy12003          3 LLRDKNPPRGTERQIKIWFQNRRMK   27 (61)
Q Consensus         3 ~~eLA~~l~Lte~~VqvWFqNrRak   27 (61)
                      ..++|+.+++++.+|++..++=+.|
T Consensus       173 ~~~ia~~l~is~~tV~~~~~~l~~K  197 (216)
T PRK10651        173 NKMIARRLDITESTVKVHVKHMLKK  197 (216)
T ss_pred             HHHHHHHcCCCHHHHHHHHHHHHHH
Confidence            3578899999999998776655544


No 296
>PF04391 DUF533:  Protein of unknown function (DUF533);  InterPro: IPR007486 Some family members may be secreted or integral membrane proteins.
Probab=30.39  E-value=11  Score=23.53  Aligned_cols=16  Identities=6%  Similarity=-0.213  Sum_probs=13.3

Q ss_pred             hhhhhcCCCCCcccee
Q psy12003          3 LLRDKNPPRGTERQIK   18 (61)
Q Consensus         3 ~~eLA~~l~Lte~~Vq   18 (61)
                      |.+||..|+|++..|.
T Consensus       166 L~~LA~aL~L~~~lv~  181 (188)
T PF04391_consen  166 LDELAQALGLDPDLVA  181 (188)
T ss_pred             HHHHHHHhCcCHHHHH
Confidence            6789999999987663


No 297
>PF09339 HTH_IclR:  IclR helix-turn-helix domain;  InterPro: IPR005471 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities. One of these subfamilies, called 'iclR', groups several proteins including:  gylR, a possible activator protein for the gylABX glycerol operon in Streptomyces.   iclR, the repressor of the acetate operon (also known as glyoxylate bypass operon) in Escherichia coli and Salmonella typhimurium.    These proteins have a Helix-Turn-Helix motif at the N terminus that is similar to that of other DNA-binding proteins [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1MKM_A 3MQ0_A 3R4K_A 2G7U_C 2O0Y_C 2XRO_F 2XRN_B 2IA2_D.
Probab=30.34  E-value=4.8  Score=19.42  Aligned_cols=17  Identities=6%  Similarity=-0.070  Sum_probs=12.2

Q ss_pred             chhhhhcCCCCCcccee
Q psy12003          2 NLLRDKNPPRGTERQIK   18 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~Vq   18 (61)
                      -+.|||+.+|++...|.
T Consensus        20 t~~eia~~~gl~~stv~   36 (52)
T PF09339_consen   20 TLSEIARALGLPKSTVH   36 (52)
T ss_dssp             EHHHHHHHHTS-HHHHH
T ss_pred             CHHHHHHHHCcCHHHHH
Confidence            36789999998877653


No 298
>TIGR03020 EpsA transcriptional regulator EpsA. Proteins in this family include a C-terminal LuxR transcriptional regulator domain (pfam00196). These proteins are positioned proximal to either EpsH-containing exopolysaccharide biosynthesis operons of the Methylobacillus type, or the associated PEP-CTERM-containing genes.
Probab=30.29  E-value=6  Score=25.53  Aligned_cols=26  Identities=12%  Similarity=-0.211  Sum_probs=20.4

Q ss_pred             hhhhhcCCCCCccceeeccccchhHH
Q psy12003          3 LLRDKNPPRGTERQIKIWFQNRRMKW   28 (61)
Q Consensus         3 ~~eLA~~l~Lte~~VqvWFqNrRak~   28 (61)
                      -.|+|..|++++.+|+...+|=+.|-
T Consensus       208 ~~eIA~~L~IS~~TVk~hl~~i~~KL  233 (247)
T TIGR03020       208 NEEIAAILGISSLTVKNHLQHIFKKL  233 (247)
T ss_pred             HHHHHHHHCcCHHHHHHHHHHHHHHh
Confidence            35889999999999998776655443


No 299
>PF11516 DUF3220:  Protein of unknown function (DUF3120);  InterPro: IPR021597  This family of proteins with unknown function appears to be restricted to Bordetella. ; PDB: 2JPF_A.
Probab=30.26  E-value=7.4  Score=21.59  Aligned_cols=12  Identities=33%  Similarity=0.875  Sum_probs=8.8

Q ss_pred             ccceeeccccch
Q psy12003         14 ERQIKIWFQNRR   25 (61)
Q Consensus        14 e~~VqvWFqNrR   25 (61)
                      ...|+||.||--
T Consensus        30 qgdvkvwmqnle   41 (106)
T PF11516_consen   30 QGDVKVWMQNLE   41 (106)
T ss_dssp             -HHHHHHHHHHH
T ss_pred             cccHHHHHHHHH
Confidence            346899999953


No 300
>PF05344 DUF746:  Domain of Unknown Function (DUF746);  InterPro: IPR008008 This is a short conserved region found in some transposons.
Probab=29.78  E-value=7.7  Score=20.45  Aligned_cols=20  Identities=5%  Similarity=0.268  Sum_probs=17.2

Q ss_pred             hhhhhcCCCCCccceeeccc
Q psy12003          3 LLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         3 ~~eLA~~l~Lte~~VqvWFq   22 (61)
                      +++.|..+|+++..|.-|-.
T Consensus        16 ~~~Aa~~lG~~~~~v~~wv~   35 (65)
T PF05344_consen   16 VAQAADRLGTDPGTVRRWVR   35 (65)
T ss_pred             HHHHHHHHCcCHHHHHHHHH
Confidence            67889999999999998854


No 301
>PRK05911 RNA polymerase sigma factor sigma-28; Reviewed
Probab=29.66  E-value=10  Score=24.20  Aligned_cols=21  Identities=10%  Similarity=-0.111  Sum_probs=17.5

Q ss_pred             chhhhhcCCCCCccceeeccc
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      .+.|+|..+|+++.+|+....
T Consensus       223 t~~EIA~~lgis~~~V~~~~~  243 (257)
T PRK05911        223 VLKEIGKILGVSESRVSQIHS  243 (257)
T ss_pred             CHHHHHHHHCcCHHHHHHHHH
Confidence            478999999999999986543


No 302
>cd01763 Sumo Small ubiquitin-related modifier (SUMO). Small ubiquitin-related modifier (SUMO) proteins are conjugated to numerous intracellular targets and serve to modulate protein interaction, localization, activity or stability.  SUMO (also known as "Smt3" and "sentrin" in other organisms) is linked to several different pathways, including nucleocytoplasmic transport. Attachment of SUMO to targets proteins is stimulated by PIAS (Protein inhibitor of activated STATs) proteins which serve as E3-like ligases.
Probab=29.39  E-value=27  Score=18.63  Aligned_cols=24  Identities=8%  Similarity=0.122  Sum_probs=19.3

Q ss_pred             hhhcCCCCCccceeeccccchhHH
Q psy12003          5 RDKNPPRGTERQIKIWFQNRRMKW   28 (61)
Q Consensus         5 eLA~~l~Lte~~VqvWFqNrRak~   28 (61)
                      ..+.+-|++..+++.+|..++-..
T Consensus        40 ~y~~~~gi~~~~~rf~f~G~~L~~   63 (87)
T cd01763          40 AYCQRQGLSMNSVRFLFDGQRIRD   63 (87)
T ss_pred             HHHHHhCCCccceEEEECCeECCC
Confidence            456777999999999999887653


No 303
>PHA02535 P terminase ATPase subunit; Provisional
Probab=29.34  E-value=9.9  Score=27.69  Aligned_cols=27  Identities=19%  Similarity=0.313  Sum_probs=22.3

Q ss_pred             hhhhhcCCCCCccceeeccccchhHHHHH
Q psy12003          3 LLRDKNPPRGTERQIKIWFQNRRMKWKKE   31 (61)
Q Consensus         3 ~~eLA~~l~Lte~~VqvWFqNrRak~kr~   31 (61)
                      +.|+|..||+++++|.-|  -+|.+|...
T Consensus        21 v~eIA~~LGv~~~Tl~~W--~kr~~w~~~   47 (581)
T PHA02535         21 VAEIAEELGLKSRTIYSW--KERDGWRDL   47 (581)
T ss_pred             HHHHHHHhCCChhHHHHH--hcccccccc
Confidence            678999999999999999  556666654


No 304
>cd01793 Fubi Fubi ubiquitin-like protein. Fubi is a ubiquitin-like protein encoded by the fau gene which has an  N-terminal ubiquitin-like domain (also referred to as FUBI) fused to the ribosomal protein S30.  Fubi is thought to be a tumor suppressor protein and the FUBI domain may act as a substitute or an inhibitor of ubiquitin or one of ubiquitin's close relatives UCRP, FAT10, and Nedd8.
Probab=29.34  E-value=25  Score=17.97  Aligned_cols=23  Identities=0%  Similarity=-0.133  Sum_probs=18.5

Q ss_pred             hhhcCCCCCccceeeccccchhH
Q psy12003          5 RDKNPPRGTERQIKIWFQNRRMK   27 (61)
Q Consensus         5 eLA~~l~Lte~~VqvWFqNrRak   27 (61)
                      .++...|++..+.+++|.++..+
T Consensus        27 ~i~~~~gip~~~q~Li~~Gk~L~   49 (74)
T cd01793          27 HVAGLEGIDVEDQVLLLAGVPLE   49 (74)
T ss_pred             HHHhhhCCCHHHEEEEECCeECC
Confidence            45777889999999999987654


No 305
>PRK15369 two component system sensor kinase SsrB; Provisional
Probab=29.23  E-value=7.6  Score=22.16  Aligned_cols=24  Identities=4%  Similarity=-0.242  Sum_probs=18.4

Q ss_pred             hhhhhcCCCCCccceeeccccchh
Q psy12003          3 LLRDKNPPRGTERQIKIWFQNRRM   26 (61)
Q Consensus         3 ~~eLA~~l~Lte~~VqvWFqNrRa   26 (61)
                      ..++|..+++++.+|+.+.++=+.
T Consensus       167 ~~~Ia~~l~~s~~tv~~~~~~~~~  190 (211)
T PRK15369        167 NRDIAEQLSISIKTVETHRLNMMR  190 (211)
T ss_pred             HHHHHHHhCCCHHHHHHHHHHHHH
Confidence            457888999999999987665333


No 306
>cd01670 Death Death Domain: a protein-protein interaction domain. Death Domains (DDs) are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN. Structural analysis of DD-DD complexes show that the domains interact with each other in many different ways. DD-containing proteins serve as adaptors in signaling pathways and they can recruit other proteins into signaling complexes. In mammals, they are prominent components of the programmed cell death (apoptosis) pathway and are found in a number of other signaling pathways. In invertebrates, they are involved in transcriptional regulation of zygotic patterning genes in insect embryogenesis, and are components of the ToII/NF-kappaB pathway, a conserved innate immune pathway in a
Probab=28.97  E-value=9.4  Score=19.50  Aligned_cols=21  Identities=5%  Similarity=-0.089  Sum_probs=15.9

Q ss_pred             hhhhcCCCCCccceeeccccc
Q psy12003          4 LRDKNPPRGTERQIKIWFQNR   24 (61)
Q Consensus         4 ~eLA~~l~Lte~~VqvWFqNr   24 (61)
                      .+||..||+++..|...=.+.
T Consensus        14 ~~la~~Lgl~~~~I~~i~~~~   34 (79)
T cd01670          14 KKLARKLGLSDGEIDQIEEDN   34 (79)
T ss_pred             HHHHHHhCCCHHHHHHHHHhC
Confidence            468999999999888654444


No 307
>PHA03236 DNA packaging protein UL33; Provisional
Probab=28.90  E-value=30  Score=20.50  Aligned_cols=23  Identities=22%  Similarity=0.309  Sum_probs=14.7

Q ss_pred             chhhhhcCC-CCCccceeeccccc
Q psy12003          2 NLLRDKNPP-RGTERQIKIWFQNR   24 (61)
Q Consensus         2 ~~~eLA~~l-~Lte~~VqvWFqNr   24 (61)
                      .|-+|..+. .-++....|||.+=
T Consensus        23 ~ld~L~~~Y~~~~~~~~~iwFE~l   46 (127)
T PHA03236         23 DLDALEEKYLIDDDFQYRIWFEYL   46 (127)
T ss_pred             CHHHHHHHhccCCccceeeeeccc
Confidence            344555554 33667889999864


No 308
>PRK10840 transcriptional regulator RcsB; Provisional
Probab=28.89  E-value=10  Score=22.80  Aligned_cols=16  Identities=6%  Similarity=-0.083  Sum_probs=14.3

Q ss_pred             hhhhcCCCCCccceee
Q psy12003          4 LRDKNPPRGTERQIKI   19 (61)
Q Consensus         4 ~eLA~~l~Lte~~Vqv   19 (61)
                      .|+|.+|++++++|+.
T Consensus       169 ~eIA~~l~iS~~TV~~  184 (216)
T PRK10840        169 TEIAKKLNRSIKTISS  184 (216)
T ss_pred             HHHHHHHCCCHHHHHH
Confidence            5889999999999984


No 309
>PRK15482 transcriptional regulator MurR; Provisional
Probab=28.69  E-value=17  Score=23.21  Aligned_cols=18  Identities=6%  Similarity=-0.075  Sum_probs=15.0

Q ss_pred             CchhhhhcCCCCCcccee
Q psy12003          1 MNLLRDKNPPRGTERQIK   18 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~Vq   18 (61)
                      |-+.|||.++++++.+|-
T Consensus        35 ~si~elA~~~~vS~aTv~   52 (285)
T PRK15482         35 VSSRKMAKQLGISQSSIV   52 (285)
T ss_pred             cCHHHHHHHhCCCHHHHH
Confidence            457899999999999874


No 310
>PF12844 HTH_19:  Helix-turn-helix domain; PDB: 3LIS_B 3LFP_A 2XIU_B 2GZU_B 2XJ3_A 1UTX_A 2XI8_B 3F6W_C 3EUS_B.
Probab=28.68  E-value=5.1  Score=19.78  Aligned_cols=24  Identities=8%  Similarity=-0.121  Sum_probs=18.0

Q ss_pred             chhhhhcCCCCCccceeeccccch
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRR   25 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrR   25 (61)
                      .+.++|..++++..+|.-|-.+++
T Consensus        14 t~~~~a~~~~i~~~~i~~~e~g~~   37 (64)
T PF12844_consen   14 TQKDLAEKLGISRSTISKIENGKR   37 (64)
T ss_dssp             -HHHHHHHHTS-HHHHHHHHTTSS
T ss_pred             CHHHHHHHHCcCHHHHHHHHCCCc
Confidence            456788899999888888887766


No 311
>PF14354 Lar_restr_allev:  Restriction alleviation protein Lar
Probab=28.64  E-value=12  Score=18.47  Aligned_cols=8  Identities=63%  Similarity=1.294  Sum_probs=3.8

Q ss_pred             eeeccccchh
Q psy12003         17 IKIWFQNRRM   26 (61)
Q Consensus        17 VqvWFqNrRa   26 (61)
                      |..|  |||+
T Consensus        54 i~~W--N~Ra   61 (61)
T PF14354_consen   54 IEAW--NRRA   61 (61)
T ss_pred             HHHH--cCCC
Confidence            3345  5553


No 312
>PRK10403 transcriptional regulator NarP; Provisional
Probab=28.44  E-value=7.6  Score=22.41  Aligned_cols=24  Identities=17%  Similarity=0.091  Sum_probs=18.1

Q ss_pred             hhhhcCCCCCccceeeccccchhH
Q psy12003          4 LRDKNPPRGTERQIKIWFQNRRMK   27 (61)
Q Consensus         4 ~eLA~~l~Lte~~VqvWFqNrRak   27 (61)
                      .++|..+++++++|++...|=+.|
T Consensus       172 ~~ia~~l~~s~~tv~~~~~~i~~k  195 (215)
T PRK10403        172 KQIASVLNISEQTVKVHIRNLLRK  195 (215)
T ss_pred             HHHHHHcCCCHHHHHHHHHHHHHH
Confidence            468889999999998776654444


No 313
>PF09292 Neil1-DNA_bind:  Endonuclease VIII-like 1, DNA bind;  InterPro: IPR015371 This domain is predominantly found in Endonuclease VIII-like 1 proteins and adopts a glucocorticoid receptor-like fold. Structural analysis reveals a zincless finger motif that is required for glycosylase activity []. ; PDB: 1TDH_A.
Probab=28.30  E-value=22  Score=16.80  Aligned_cols=6  Identities=67%  Similarity=1.575  Sum_probs=4.5

Q ss_pred             eecccc
Q psy12003         18 KIWFQN   23 (61)
Q Consensus        18 qvWFqN   23 (61)
                      .||||.
T Consensus        27 TiWFqG   32 (39)
T PF09292_consen   27 TIWFQG   32 (39)
T ss_dssp             EEEESS
T ss_pred             EEEeeC
Confidence            389984


No 314
>PF01978 TrmB:  Sugar-specific transcriptional regulator TrmB;  InterPro: IPR002831 TrmB, is a protein of 38,800 apparent molecular weight, that is involved in the maltose-specific regulation of the trehalose/maltose ABC transport operon in Thermococcus litoralis. TrmB has been shown to be a maltose-specific repressor, and this inhibition is counteracted by maltose and trehalose. TrmB binds maltose and trehalose half-maximally at 20 uM and 0.5 mM sugar concentration, respectively []. Other members of this family are annotated as either transcriptional regulators or hypothetical proteins. ; PDB: 2D1H_A 3QPH_A 1SFX_A.
Probab=28.26  E-value=6.2  Score=19.89  Aligned_cols=17  Identities=0%  Similarity=-0.232  Sum_probs=13.7

Q ss_pred             chhhhhcCCCCCcccee
Q psy12003          2 NLLRDKNPPRGTERQIK   18 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~Vq   18 (61)
                      ...|||..+|++..+|.
T Consensus        24 t~~eIa~~l~i~~~~v~   40 (68)
T PF01978_consen   24 TAEEIAEELGISRSTVY   40 (68)
T ss_dssp             EHHHHHHHHTSSHHHHH
T ss_pred             CHHHHHHHHCcCHHHHH
Confidence            35789999999988875


No 315
>TIGR02395 rpoN_sigma RNA polymerase sigma-54 factor. A sigma factor is a DNA-binding protein protein that binds to the DNA-directed RNA polymerase core to produce the holoenzyme capable of initiating transcription at specific sites. Different sigma factors act in vegetative growth, heat shock, extracytoplasmic functions (ECF), etc. This model represents the clade of sigma factors called sigma-54, or RpoN (unrelated to sigma 70-type factors such as RpoD/SigA). RpoN is responsible for enhancer-dependent transcription, and its presence characteristically is associated with varied panels of activators, most of which are enhancer-binding proteins (but see Brahmachary, et al., PubMed:15231786). RpoN may be responsible for transcription of nitrogen fixation genes, flagellins, pilins, etc., and synonyms for the gene symbol rpoN, such as ntrA, reflect these observations
Probab=28.04  E-value=25  Score=24.45  Aligned_cols=18  Identities=17%  Similarity=0.041  Sum_probs=16.0

Q ss_pred             CchhhhhcCCCCCcccee
Q psy12003          1 MNLLRDKNPPRGTERQIK   18 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~Vq   18 (61)
                      |.|.++|..+||.|.+|-
T Consensus       319 LtlkdiA~~lglheSTVS  336 (429)
T TIGR02395       319 LTLREVAEELGLHESTIS  336 (429)
T ss_pred             CcHHHHHHHhCCCccchh
Confidence            568899999999999994


No 316
>PRK10430 DNA-binding transcriptional activator DcuR; Provisional
Probab=27.66  E-value=14  Score=22.65  Aligned_cols=20  Identities=5%  Similarity=-0.120  Sum_probs=16.1

Q ss_pred             hhhhhcCCCCCccceeeccc
Q psy12003          3 LLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         3 ~~eLA~~l~Lte~~VqvWFq   22 (61)
                      ..|+|.++++++.+|+.-+.
T Consensus       181 ~~eIA~~l~iS~~Tv~~~~~  200 (239)
T PRK10430        181 TDELANAVNISRVSCRKYLI  200 (239)
T ss_pred             HHHHHHHhCchHHHHHHHHH
Confidence            45799999999999986543


No 317
>cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein. parkin_N  parkin protein is a RING-type E3 ubiquitin ligase with an amino-terminal ubiquitin-like (Ubl) domain and an RBR signature consisting of two RING finger domains separated by an IBR/DRIL domain.  Naturally occurring mutations in parkin are thought to cause the disease AR_JP (autosomal-recessive juvenile parkinsonism). Parkin binds the Rpn10 subunit of  26S proteasomes through its Ubl domain.
Probab=27.64  E-value=22  Score=17.92  Aligned_cols=22  Identities=9%  Similarity=0.184  Sum_probs=17.9

Q ss_pred             hhhcCCCCCccceeeccccchh
Q psy12003          5 RDKNPPRGTERQIKIWFQNRRM   26 (61)
Q Consensus         5 eLA~~l~Lte~~VqvWFqNrRa   26 (61)
                      .|+...|++..+.+++|.++..
T Consensus        27 ~i~~~~gi~~~~q~Li~~G~~L   48 (70)
T cd01798          27 VVAKRQGVPPDQLRVIFAGKEL   48 (70)
T ss_pred             HHHHHHCCCHHHeEEEECCeEC
Confidence            4577888999999999987764


No 318
>PRK15043 transcriptional regulator MirA; Provisional
Probab=27.41  E-value=10  Score=24.61  Aligned_cols=21  Identities=5%  Similarity=-0.047  Sum_probs=18.5

Q ss_pred             CchhhhhcCCCCCccceeecc
Q psy12003          1 MNLLRDKNPPRGTERQIKIWF   21 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWF   21 (61)
                      |.|.|+|+.+|++..+++.|-
T Consensus         4 ytIgeVA~~~GVs~~TLR~wE   24 (243)
T PRK15043          4 YTIGEVALLCDINPVTLRAWQ   24 (243)
T ss_pred             CCHHHHHHHHCcCHHHHHHHH
Confidence            468899999999999999984


No 319
>PRK11475 DNA-binding transcriptional activator BglJ; Provisional
Probab=27.35  E-value=9.4  Score=23.69  Aligned_cols=17  Identities=6%  Similarity=0.042  Sum_probs=14.7

Q ss_pred             hhhhhcCCCCCccceee
Q psy12003          3 LLRDKNPPRGTERQIKI   19 (61)
Q Consensus         3 ~~eLA~~l~Lte~~Vqv   19 (61)
                      -.|+|.+|++++.+|+.
T Consensus       152 nkeIA~~L~iS~~TV~~  168 (207)
T PRK11475        152 MPQIAEQLERNIKTIRA  168 (207)
T ss_pred             HHHHHHHHCCCHHHHHH
Confidence            35889999999999985


No 320
>PF13412 HTH_24:  Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A ....
Probab=27.18  E-value=7.3  Score=18.24  Aligned_cols=16  Identities=0%  Similarity=-0.197  Sum_probs=12.0

Q ss_pred             hhhhhcCCCCCcccee
Q psy12003          3 LLRDKNPPRGTERQIK   18 (61)
Q Consensus         3 ~~eLA~~l~Lte~~Vq   18 (61)
                      ..|||..+|++...|.
T Consensus        20 ~~ela~~~~is~~tv~   35 (48)
T PF13412_consen   20 QKELAEKLGISRSTVN   35 (48)
T ss_dssp             HHHHHHHHTS-HHHHH
T ss_pred             HHHHHHHhCCCHHHHH
Confidence            4688999999988774


No 321
>cd04778 HTH_MerR-like_sg2 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily. Putative helix-turn-helix (HTH) MerR-like transcription regulators (subgroup 2). Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.
Probab=26.89  E-value=11  Score=23.98  Aligned_cols=20  Identities=10%  Similarity=0.137  Sum_probs=17.1

Q ss_pred             CchhhhhcCCCCCccceeec
Q psy12003          1 MNLLRDKNPPRGTERQIKIW   20 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvW   20 (61)
                      +-|-|||+.+|+|..+|+.|
T Consensus         2 y~i~elA~~~Gvs~~tIR~Y   21 (219)
T cd04778           2 YRIDDLARAAGTTVRNVRAY   21 (219)
T ss_pred             CCHHHHHHHHCcCHHHHHHH
Confidence            35789999999999999877


No 322
>PRK11557 putative DNA-binding transcriptional regulator; Provisional
Probab=26.73  E-value=20  Score=22.73  Aligned_cols=18  Identities=6%  Similarity=0.021  Sum_probs=14.9

Q ss_pred             CchhhhhcCCCCCcccee
Q psy12003          1 MNLLRDKNPPRGTERQIK   18 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~Vq   18 (61)
                      |-+.|||.++++++.+|=
T Consensus        31 ~si~elA~~~~vS~aTv~   48 (278)
T PRK11557         31 LSSQQLANEAGVSQSSVV   48 (278)
T ss_pred             cCHHHHHHHhCCCHHHHH
Confidence            457899999999999874


No 323
>PF00440 TetR_N:  Bacterial regulatory proteins, tetR family;  InterPro: IPR001647 This entry represents a DNA-binding domain with a helix-turn-helix (HTH) structure that is found in several bacterial and archaeal transcriptional regulators, such as TetR, the tetracycline resistance repressor. Numerous other transcriptional regulatory proteins also contain HTH-type DNA-binding domains, and can be grouped into subfamiles based on sequence similarity. The domain represented by this entry is found in a subfamily of proteins that includes the transcriptional regulators TetR, TetC, AcrR, BetI, Bm3R1, EnvR, QacR, MtrR, TcmR, Ttk, YbiH, and YhgD [, , ]. Many of these proteins function as repressors that control the level of susceptibility to hydrophobic antibiotics and detergents. They all have similar molecular weights, ranging from 21 to 25 kDa. The helix-turn-helix motif is located in the initial third of the protein. The 3D structure of the homodimeric TetR protein complexed with 7-chloro-tetracycline-magnesium has been determined to 2.1 A resolution []. TetR folds into ten alpha-helices with connecting turns and loops. The three N-terminal alpha-helices of the repressor form the DNA-binding domain: this structural motif encompasses an HTH fold with an inverse orientation compared with that of other DNA-binding proteins.; GO: 0003677 DNA binding; PDB: 3NPI_B 3IUV_A 3CCY_A 2JK3_A 2FX0_A 2JJ7_A 2WV1_B 3BTI_D 3BR6_E 3BR5_A ....
Probab=26.70  E-value=5.8  Score=18.69  Aligned_cols=23  Identities=4%  Similarity=0.079  Sum_probs=17.4

Q ss_pred             chhhhhcCCCCCccceeeccccc
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNR   24 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNr   24 (61)
                      -+.+||+++|++...+---|.|+
T Consensus        18 s~~~Ia~~~gvs~~~~y~~f~~k   40 (47)
T PF00440_consen   18 SIRDIARRAGVSKGSFYRYFPSK   40 (47)
T ss_dssp             SHHHHHHHHTSCHHHHHHHCSSH
T ss_pred             CHHHHHHHHccchhhHHHHcCCH
Confidence            36788888888888777666664


No 324
>TIGR00122 birA_repr_reg BirA biotin operon repressor domain. This model may recognize some other putative repressor proteins, such as DnrO of Streptomyces peucetius with scores below the noise cutoff but with significance shown by low E-value.
Probab=26.65  E-value=11  Score=19.00  Aligned_cols=16  Identities=0%  Similarity=-0.201  Sum_probs=13.5

Q ss_pred             hhhhhcCCCCCcccee
Q psy12003          3 LLRDKNPPRGTERQIK   18 (61)
Q Consensus         3 ~~eLA~~l~Lte~~Vq   18 (61)
                      ..|||..++++...|.
T Consensus        16 ~~eLa~~l~vS~~tv~   31 (69)
T TIGR00122        16 GEKLGEALGMSRTAVN   31 (69)
T ss_pred             HHHHHHHHCCCHHHHH
Confidence            5689999999998875


No 325
>PF04760 IF2_N:  Translation initiation factor IF-2, N-terminal region;  InterPro: IPR006847 This region is found in the N-terminal half of translation initiation factor IF-2. It is found in two copies in IF-2 alpha isoforms, and in only one copy in the N-terminally truncated beta and gamma isoforms []. Its function is unknown.; GO: 0003743 translation initiation factor activity, 0006413 translational initiation; PDB: 1ND9_A.
Probab=26.62  E-value=7.3  Score=18.97  Aligned_cols=15  Identities=7%  Similarity=-0.040  Sum_probs=11.6

Q ss_pred             hhhhhcCCCCCccce
Q psy12003          3 LLRDKNPPRGTERQI   17 (61)
Q Consensus         3 ~~eLA~~l~Lte~~V   17 (61)
                      +-|||..+|++...|
T Consensus         6 V~elAk~l~v~~~~i   20 (54)
T PF04760_consen    6 VSELAKELGVPSKEI   20 (54)
T ss_dssp             TTHHHHHHSSSHHHH
T ss_pred             HHHHHHHHCcCHHHH
Confidence            568888888887655


No 326
>PRK11337 DNA-binding transcriptional repressor RpiR; Provisional
Probab=26.46  E-value=21  Score=22.86  Aligned_cols=18  Identities=17%  Similarity=-0.047  Sum_probs=15.0

Q ss_pred             CchhhhhcCCCCCcccee
Q psy12003          1 MNLLRDKNPPRGTERQIK   18 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~Vq   18 (61)
                      |-+.+||.++++++.+|-
T Consensus        47 ~si~~lA~~~~vS~aTi~   64 (292)
T PRK11337         47 TALKDIAEALAVSEAMIV   64 (292)
T ss_pred             cCHHHHHHHhCCChHHHH
Confidence            457899999999999874


No 327
>PRK11302 DNA-binding transcriptional regulator HexR; Provisional
Probab=26.26  E-value=19  Score=22.71  Aligned_cols=18  Identities=6%  Similarity=0.008  Sum_probs=14.8

Q ss_pred             CchhhhhcCCCCCcccee
Q psy12003          1 MNLLRDKNPPRGTERQIK   18 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~Vq   18 (61)
                      |-+.+||.++++++.+|-
T Consensus        35 ~si~~lA~~~~vS~aTv~   52 (284)
T PRK11302         35 SSIATLAKMANVSEPTVN   52 (284)
T ss_pred             cCHHHHHHHhCCCHHHHH
Confidence            457889999999998874


No 328
>PRK05572 sporulation sigma factor SigF; Validated
Probab=26.03  E-value=13  Score=23.50  Aligned_cols=20  Identities=5%  Similarity=-0.187  Sum_probs=16.9

Q ss_pred             CchhhhhcCCCCCccceeec
Q psy12003          1 MNLLRDKNPPRGTERQIKIW   20 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvW   20 (61)
                      |.+.|+|..+|++..+|..+
T Consensus       219 ~s~~eIA~~lgis~~~V~~~  238 (252)
T PRK05572        219 KTQSEVAKRLGISQVQVSRL  238 (252)
T ss_pred             CCHHHHHHHHCcCHHHHHHH
Confidence            35789999999999999765


No 329
>PF04293 SpoVR:  SpoVR like protein;  InterPro: IPR007390 One of the family members P37875 from SWISSPROT is Bacillus subtilis stage V sporulation protein R, which is involved in spore cortex formation []. Little is known about cortex biosynthesis, except that it depends on several sigma E controlled genes, including spoVR [].
Probab=25.84  E-value=31  Score=24.32  Aligned_cols=21  Identities=0%  Similarity=-0.249  Sum_probs=18.1

Q ss_pred             chhhhhcCCCCCccceeeccc
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      +|.++|+.+||+.-.++.|.-
T Consensus        14 ~i~~~A~~~GLd~yp~~fEiv   34 (426)
T PF04293_consen   14 EIEEIARELGLDFYPVQFEIV   34 (426)
T ss_pred             HHHHHHHHcCCCCCCceEEEe
Confidence            688999999999999987754


No 330
>cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain. DDI1_N   DDI1 (DNA damage inducible protein 1) has an amino-terminal ubiquitin-like domain, an retroviral protease-like (RVP-like) domain, and a UBA (ubiquitin-associated) domain.  This CD represents the amino-terminal ubiquitin-like domain of DDI1.
Probab=25.66  E-value=29  Score=17.71  Aligned_cols=23  Identities=9%  Similarity=0.082  Sum_probs=17.9

Q ss_pred             hhhcCCCCCccceeeccccchhH
Q psy12003          5 RDKNPPRGTERQIKIWFQNRRMK   27 (61)
Q Consensus         5 eLA~~l~Lte~~VqvWFqNrRak   27 (61)
                      .++...|++..+.+++|..+-..
T Consensus        28 ~I~~~~gip~~~q~Li~~Gk~L~   50 (71)
T cd01796          28 LCEAESGIPASQQQLIYNGRELV   50 (71)
T ss_pred             HHHHHhCCCHHHeEEEECCeEcc
Confidence            45777899999999999876543


No 331
>TIGR03613 RutR pyrimidine utilization regulatory protein R. This protein is observed in operons extremely similar to that characterized in E. coli K-12 responsible for the import and catabolism of pyrimidines, primarily uracil. This protein is a member of the TetR family of transcriptional regulators defined by the N-teminal model pfam00440 and the C-terminal model pfam08362 (YcdC-like protein, C-terminal region).
Probab=25.65  E-value=13  Score=22.01  Aligned_cols=23  Identities=9%  Similarity=0.154  Sum_probs=20.0

Q ss_pred             hhhhhcCCCCCccceeeccccch
Q psy12003          3 LLRDKNPPRGTERQIKIWFQNRR   25 (61)
Q Consensus         3 ~~eLA~~l~Lte~~VqvWFqNrR   25 (61)
                      |.+||++.|++...+--.|.|+-
T Consensus        31 ~~~IA~~agvs~~~lY~hF~sKe   53 (202)
T TIGR03613        31 LEQIAELAGVSKTNLLYYFPSKD   53 (202)
T ss_pred             HHHHHHHhCCCHHHHHHHcCCHH
Confidence            67899999999999999998874


No 332
>cd01803 Ubiquitin Ubiquitin. Ubiquitin  (includes Ubq/RPL40e and Ubq/RPS27a fusions as well as homopolymeric multiubiquitin protein chains)
Probab=25.56  E-value=26  Score=17.52  Aligned_cols=21  Identities=10%  Similarity=0.180  Sum_probs=16.0

Q ss_pred             hhhcCCCCCccceeeccccch
Q psy12003          5 RDKNPPRGTERQIKIWFQNRR   25 (61)
Q Consensus         5 eLA~~l~Lte~~VqvWFqNrR   25 (61)
                      .|+..++++....++||.++-
T Consensus        29 ~i~~~~g~~~~~q~L~~~g~~   49 (76)
T cd01803          29 KIQDKEGIPPDQQRLIFAGKQ   49 (76)
T ss_pred             HHHHHhCCCHHHeEEEECCEE
Confidence            456777888889999987553


No 333
>PRK13870 transcriptional regulator TraR; Provisional
Probab=25.51  E-value=8.4  Score=24.34  Aligned_cols=24  Identities=0%  Similarity=-0.057  Sum_probs=19.1

Q ss_pred             hhhhcCCCCCccceeeccccchhH
Q psy12003          4 LRDKNPPRGTERQIKIWFQNRRMK   27 (61)
Q Consensus         4 ~eLA~~l~Lte~~VqvWFqNrRak   27 (61)
                      -|+|..||++|.+|..=.+|=+.|
T Consensus       192 ~EIa~ILgISe~TV~~Hl~na~~K  215 (234)
T PRK13870        192 EEIADVEGVKYNSVRVKLREAMKR  215 (234)
T ss_pred             HHHHHHHCCCHHHHHHHHHHHHHH
Confidence            478999999999998766665554


No 334
>PF14549 P22_Cro:  DNA-binding transcriptional regulator Cro; PDB: 1RZS_A 3BD1_A 3QWS_A 2HIN_B.
Probab=25.39  E-value=7.8  Score=19.86  Aligned_cols=27  Identities=7%  Similarity=0.182  Sum_probs=19.0

Q ss_pred             hhhhhcCCCCCccceeeccccchhHHHHH
Q psy12003          3 LLRDKNPPRGTERQIKIWFQNRRMKWKKE   31 (61)
Q Consensus         3 ~~eLA~~l~Lte~~VqvWFqNrRak~kr~   31 (61)
                      ..+||+.||++...|--|  ..+-..++.
T Consensus        12 ~~~lAkalGVs~~aVs~W--~~~IP~~ra   38 (60)
T PF14549_consen   12 QSKLAKALGVSPQAVSQW--GERIPAERA   38 (60)
T ss_dssp             HHHHHHHHTS-HHHHHHH--HTS--HHHH
T ss_pred             HHHHHHHHCCCHHHHHHh--cCccCHHHH
Confidence            468999999999999999  455555554


No 335
>TIGR02612 mob_myst_A mobile mystery protein A. Members of this protein family are found in mobization-related contexts more often than not, including within a CRISPR-associated gene region in Geobacter sulfurreducens PCA, and on plasmids in Agrobacterium tumefaciens and Coxiella burnetii, always together with mobile mystery protein B, a member of the Fic protein family (pfam02661). This protein is encoded by the upstream member of the gene pair and belongs to a family of helix-turn-helix DNA binding proteins (pfam01381).
Probab=25.39  E-value=13  Score=22.29  Aligned_cols=24  Identities=4%  Similarity=-0.139  Sum_probs=20.2

Q ss_pred             chhhhhcCCCCCccceeeccccch
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRR   25 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrR   25 (61)
                      -..+||..+|++...|.-|..+..
T Consensus        40 Tq~eLAerlGVS~~tIs~iE~G~~   63 (150)
T TIGR02612        40 SGAQLAGRLGVTPQRVEALEKSEL   63 (150)
T ss_pred             CHHHHHHHhCCCHHHHHHHHcCCC
Confidence            457899999999999999987754


No 336
>smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases. Helix-turn-helix-containing domain. Also known as Zab.
Probab=25.36  E-value=15  Score=18.82  Aligned_cols=16  Identities=6%  Similarity=0.038  Sum_probs=13.2

Q ss_pred             hhhhhcCCCCCcccee
Q psy12003          3 LLRDKNPPRGTERQIK   18 (61)
Q Consensus         3 ~~eLA~~l~Lte~~Vq   18 (61)
                      ..|||..+|++...|.
T Consensus        25 a~eLa~~lgl~~~~v~   40 (68)
T smart00550       25 ALQLAKNLGLPKKEVN   40 (68)
T ss_pred             HHHHHHHHCCCHHHHH
Confidence            5689999999988773


No 337
>PRK09975 DNA-binding transcriptional regulator EnvR; Provisional
Probab=25.28  E-value=15  Score=21.95  Aligned_cols=24  Identities=21%  Similarity=0.159  Sum_probs=21.2

Q ss_pred             hhhhhcCCCCCccceeeccccchh
Q psy12003          3 LLRDKNPPRGTERQIKIWFQNRRM   26 (61)
Q Consensus         3 ~~eLA~~l~Lte~~VqvWFqNrRa   26 (61)
                      |.++|.+.|++...+--.|.++-.
T Consensus        34 i~~Ia~~agvsk~t~Y~~F~sKe~   57 (213)
T PRK09975         34 LNDIADAANVTRGAIYWHFENKTQ   57 (213)
T ss_pred             HHHHHHHcCCCHHHHHHHcCCHHH
Confidence            678999999999999999998855


No 338
>PF05119 Terminase_4:  Phage terminase, small subunit;  InterPro: IPR006448 This entry is represented by Streptococcus phage 7201, Orf21. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This group of sequences describe the distinct family of phage (and integrated prophage) putative terminase small subunit sequnces. Members tend to be encoded by the gene adjacent to the phage terminase large subunit gene.
Probab=25.12  E-value=23  Score=18.97  Aligned_cols=14  Identities=7%  Similarity=-0.216  Sum_probs=11.5

Q ss_pred             chhhhhcCCCCCcc
Q psy12003          2 NLLRDKNPPRGTER   15 (61)
Q Consensus         2 ~~~eLA~~l~Lte~   15 (61)
                      +|..|+.+||||+.
T Consensus        72 ~~~~l~~~lGLtP~   85 (100)
T PF05119_consen   72 QMRSLASELGLTPA   85 (100)
T ss_pred             HHHHHHHHcCCCHH
Confidence            46788999999974


No 339
>PRK06424 transcription factor; Provisional
Probab=24.82  E-value=14  Score=22.11  Aligned_cols=25  Identities=4%  Similarity=-0.230  Sum_probs=21.1

Q ss_pred             hhhhhcCCCCCccceeeccccchhH
Q psy12003          3 LLRDKNPPRGTERQIKIWFQNRRMK   27 (61)
Q Consensus         3 ~~eLA~~l~Lte~~VqvWFqNrRak   27 (61)
                      ..+||..+|++...|.-|..+++..
T Consensus       100 Q~eLA~~iGvs~stIskiE~G~~~P  124 (144)
T PRK06424        100 QADLAAKIFERKNVIASIERGDLLP  124 (144)
T ss_pred             HHHHHHHhCCCHHHHHHHHCCCCCC
Confidence            4689999999999999998877653


No 340
>PRK05932 RNA polymerase factor sigma-54; Reviewed
Probab=24.79  E-value=31  Score=24.25  Aligned_cols=18  Identities=17%  Similarity=-0.020  Sum_probs=15.9

Q ss_pred             CchhhhhcCCCCCcccee
Q psy12003          1 MNLLRDKNPPRGTERQIK   18 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~Vq   18 (61)
                      |-|.++|..+||.|.+|-
T Consensus       344 LtlkdvAe~lglheSTVS  361 (455)
T PRK05932        344 LVLKDIAEELGMHESTIS  361 (455)
T ss_pred             ccHHHHHHHhCCCccchh
Confidence            468899999999999994


No 341
>cd01769 UBL Ubiquitin-like domain of UBL. UBLs function by remodeling the surface of their target proteins, changing their target's half-life, enzymatic activity, protein-protein interactions, subcellular localization or other properties. At least 10 different ubiquitin-like modifications exist in mammals, and attachment of different ubls to a target leads to different biological consequences. Ubl-conjugation cascades are initiated by activating enzymes, which also coordinate the ubls with their downstream pathways.
Probab=24.46  E-value=30  Score=16.67  Aligned_cols=20  Identities=5%  Similarity=0.091  Sum_probs=15.4

Q ss_pred             hhhcCCCCCccceeeccccc
Q psy12003          5 RDKNPPRGTERQIKIWFQNR   24 (61)
Q Consensus         5 eLA~~l~Lte~~VqvWFqNr   24 (61)
                      .++..++++...++++|..+
T Consensus        26 ~i~~~~~~~~~~~~l~~~g~   45 (69)
T cd01769          26 KIAAKEGVPPEQQRLIYAGK   45 (69)
T ss_pred             HHHHHHCcChHHEEEEECCc
Confidence            35667788888899988764


No 342
>PRK09635 sigI RNA polymerase sigma factor SigI; Provisional
Probab=24.13  E-value=13  Score=24.18  Aligned_cols=26  Identities=8%  Similarity=-0.051  Sum_probs=20.3

Q ss_pred             chhhhhcCCCCCccceeeccccchhH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMK   27 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak   27 (61)
                      ...|+|..+|+|+..|+...+-=|.+
T Consensus       136 s~~EIA~~Lgis~~tVr~~l~RAr~~  161 (290)
T PRK09635        136 PYQQIATTIGSQASTCRQLAHRARRK  161 (290)
T ss_pred             CHHHHHHHHCcCHHHHHHHHHHHHHH
Confidence            46799999999999999876533333


No 343
>PF13730 HTH_36:  Helix-turn-helix domain
Probab=24.00  E-value=12  Score=17.87  Aligned_cols=18  Identities=6%  Similarity=-0.188  Sum_probs=14.0

Q ss_pred             hhhhhcCCCCCccceeec
Q psy12003          3 LLRDKNPPRGTERQIKIW   20 (61)
Q Consensus         3 ~~eLA~~l~Lte~~VqvW   20 (61)
                      +..||..+|++.++|+-+
T Consensus        28 ~~~la~~~g~s~~Tv~~~   45 (55)
T PF13730_consen   28 QETLAKDLGVSRRTVQRA   45 (55)
T ss_pred             HHHHHHHHCcCHHHHHHH
Confidence            467888899998888644


No 344
>PF08784 RPA_C:  Replication protein A C terminal;  InterPro: IPR014892 This protein corresponds to the C-terminal of the single stranded DNA binding protein RPA (replication protein A). RPA is involved in many DNA metabolic pathways including DNA replication, DNA repair, recombination, cell cycle and DNA damage checkpoints. ; PDB: 1QUQ_C 2PQA_C 3KDF_B 2Z6K_B 2PI2_B 1L1O_E 1DPU_A 1Z1D_A.
Probab=23.94  E-value=11  Score=20.63  Aligned_cols=17  Identities=6%  Similarity=0.038  Sum_probs=12.5

Q ss_pred             chhhhhcCCCCCcccee
Q psy12003          2 NLLRDKNPPRGTERQIK   18 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~Vq   18 (61)
                      .+.+||++|++++..|+
T Consensus        67 ~v~~I~~~l~~~~~~v~   83 (102)
T PF08784_consen   67 HVDEIAQQLGMSENEVR   83 (102)
T ss_dssp             EHHHHHHHSTS-HHHHH
T ss_pred             cHHHHHHHhCcCHHHHH
Confidence            36788888899888775


No 345
>cd08805 Death_ank1 Death domain of Ankyrin-1. Death Domain (DD) of the human protein ankyrin-1 (ANK-1) and related proteins. Ankyrins are modular proteins comprising three conserved domains, an N-terminal membrane-binding domain containing ANK repeats, a spectrin-binding domain and a C-terminal DD. ANK-1, also called ankyrin-R (for restricted), is found in brain, muscle, and erythrocytes and is thought to function in linking integral membrane proteins to the underlying cytoskeleton. It plays a critical nonredundant role in erythroid development and is associated with hereditary spherocytosis (HS), a common disorder of the red cell membrane. The small alternatively-spliced variant, sANK-1, found in striated muscle and concentrated in the sarcoplasmic reticulum (SR) binds obscurin and titin, which facilitates the anchoring of the network SR to the contractile apparatus. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common featur
Probab=23.57  E-value=18  Score=19.69  Aligned_cols=15  Identities=7%  Similarity=-0.124  Sum_probs=11.8

Q ss_pred             hhhhcCCCCCcccee
Q psy12003          4 LRDKNPPRGTERQIK   18 (61)
Q Consensus         4 ~eLA~~l~Lte~~Vq   18 (61)
                      .+||.+|+++++.|.
T Consensus        19 ~~Lar~L~vs~~dI~   33 (84)
T cd08805          19 AELARELQFSVEDIN   33 (84)
T ss_pred             HHHHHHcCCCHHHHH
Confidence            468999999997664


No 346
>PF04539 Sigma70_r3:  Sigma-70 region 3;  InterPro: IPR007624 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. RNA polymerase recruits alternative sigma factors as a means of switching on specific regulons. Most bacteria express a multiplicity of sigma factors. Two of these factors, sigma-70 (gene rpoD), generally known as the major or primary sigma factor, and sigma-54 (gene rpoN or ntrA) direct the transcription of a wide variety of genes. The other sigma factors, known as alternative sigma factors, are required for the transcription of specific subsets of genes.  With regard to sequence similarity, sigma factors can be grouped into two classes, the sigma-54 and sigma-70 families. Sequence alignments of the sigma70 family members reveal four conserved regions that can be further divided into subregions eg. sub-region 2.2, which may be involved in the binding of the sigma factor to the core RNA polymerase; and sub-region 4.2, which seems to harbor a DNA-binding 'helix-turn-helix' motif involved in binding the conserved -35 region of promoters recognised by the major sigma factors [, ].  Region 3 forms a discrete compact three helical domain within the sigma-factor. Region is not normally involved in the recognition of promoter DNA, but in some specific bacterial promoters containing an extended -10 promoter element, residues within region 3 play an important role. Region 3 primarily is involved in binding the core RNA polymerase in the holoenzyme [].; GO: 0003677 DNA binding, 0003700 sequence-specific DNA binding transcription factor activity, 0016987 sigma factor activity, 0006352 transcription initiation, DNA-dependent, 0006355 regulation of transcription, DNA-dependent; PDB: 1L0O_C 1KU2_B 1RP3_C 1SC5_A 1TTY_A 2BE5_F 2A6E_F 2CW0_F 2A69_P 2A6H_P ....
Probab=23.55  E-value=8.9  Score=19.69  Aligned_cols=17  Identities=0%  Similarity=-0.255  Sum_probs=13.2

Q ss_pred             hhhhhcCCCCCccceee
Q psy12003          3 LLRDKNPPRGTERQIKI   19 (61)
Q Consensus         3 ~~eLA~~l~Lte~~Vqv   19 (61)
                      ..|||..||++...|+-
T Consensus        23 ~eEiA~~lgis~~~v~~   39 (78)
T PF04539_consen   23 DEEIAEELGISVEEVRE   39 (78)
T ss_dssp             HHHHHHHHTS-HHHHHH
T ss_pred             HHHHHHHHcccHHHHHH
Confidence            46899999999988863


No 347
>PF08671 SinI:  Anti-repressor SinI;  InterPro: IPR010981 The SinR repressor is part of a group of Sin (sporulation inhibition) proteins in Bacillus subtilis that regulate the commitment to sporulation in response to extreme adversity []. SinR is a tetrameric repressor protein that binds to the promoters of genes essential for entry into sporulation and prevents their transcription. This repression is overcome through the activity of SinI, which disrupts the SinR tetramer through the formation of a SinI-SinR heterodimer, thereby allowing sporulation to proceed. The SinR structure consists of two domains: a dimerisation domain stabilised by a hydrophobic core, and a DNA-binding domain that is identical to domains of the bacteriophage 434 CI and Cro proteins that regulate prophage induction. The dimerisation domain is a four-helical bundle formed from two helices from the C-terminal residues of SinR and two helices from the central residues of SinI. These regions in SinR and SinI are similar in both structure and sequence. The interaction of SinR monomers to form tetramers is weaker than between SinR and SinI, since SinI can effectively disrupt SinR tetramers. This entry represents the dimerisation domain in both SinI and SinR proteins.; GO: 0005488 binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1B0N_A 2YAL_A.
Probab=23.34  E-value=9.7  Score=17.01  Aligned_cols=19  Identities=11%  Similarity=0.359  Sum_probs=12.9

Q ss_pred             chhhhhcCCCCCccceeec
Q psy12003          2 NLLRDKNPPRGTERQIKIW   20 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvW   20 (61)
                      +|..-|...|||..+|+-.
T Consensus         7 ~Li~eA~~~Gls~eeir~F   25 (30)
T PF08671_consen    7 ELIKEAKESGLSKEEIREF   25 (30)
T ss_dssp             HHHHHHHHTT--HHHHHHH
T ss_pred             HHHHHHHHcCCCHHHHHHH
Confidence            5677799999998887644


No 348
>PTZ00044 ubiquitin; Provisional
Probab=23.31  E-value=28  Score=17.66  Aligned_cols=23  Identities=13%  Similarity=0.244  Sum_probs=18.1

Q ss_pred             hhhcCCCCCccceeeccccchhH
Q psy12003          5 RDKNPPRGTERQIKIWFQNRRMK   27 (61)
Q Consensus         5 eLA~~l~Lte~~VqvWFqNrRak   27 (61)
                      .|+...|++....+++|..+-..
T Consensus        29 ~i~~~~gi~~~~q~L~~~g~~L~   51 (76)
T PTZ00044         29 ALQEKEGIDVKQIRLIYSGKQMS   51 (76)
T ss_pred             HHHHHHCCCHHHeEEEECCEEcc
Confidence            35777899999999999877643


No 349
>PF11976 Rad60-SLD:  Ubiquitin-2 like Rad60 SUMO-like;  InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins. SUMOs are small proteins that are covalently attached to lysines as post-translational modifications and are used to control multiple cellular process including signal transduction, nuclear transport and DNA replication and repair []. Unlike ubiquitin, they are not involved in protein degradation.  This entry also contains the C-terminal Rad60 DNA repair protein SUMO-like domain.; PDB: 3RD2_A 2JXX_A 3RCZ_A 3GOE_A 3A4S_D 3A4R_B 2IO1_D 1U4A_A 2K1F_A 1WZ0_A ....
Probab=23.20  E-value=27  Score=17.50  Aligned_cols=24  Identities=13%  Similarity=0.216  Sum_probs=17.7

Q ss_pred             hhhhcCCCCCc-cceeeccccchhH
Q psy12003          4 LRDKNPPRGTE-RQIKIWFQNRRMK   27 (61)
Q Consensus         4 ~eLA~~l~Lte-~~VqvWFqNrRak   27 (61)
                      ...+.+.+++. ..++.+|...+..
T Consensus        28 ~~~~~~~~i~~~~~~~l~fdG~~L~   52 (72)
T PF11976_consen   28 EKYCEKKGIPPEESIRLIFDGKRLD   52 (72)
T ss_dssp             HHHHHHHTTTT-TTEEEEETTEEE-
T ss_pred             HHHHHhhCCCccceEEEEECCEEcC
Confidence            34567778888 8999999876653


No 350
>PRK09191 two-component response regulator; Provisional
Probab=23.04  E-value=17  Score=22.22  Aligned_cols=21  Identities=0%  Similarity=-0.097  Sum_probs=17.3

Q ss_pred             chhhhhcCCCCCccceeeccc
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      ...|+|..+|+++..|+.-..
T Consensus       106 s~~eIA~~l~~s~~tV~~~l~  126 (261)
T PRK09191        106 SVEEAAEILGVDPAEAEALLD  126 (261)
T ss_pred             CHHHHHHHHCCCHHHHHHHHH
Confidence            467899999999999986553


No 351
>COG1737 RpiR Transcriptional regulators [Transcription]
Probab=22.98  E-value=20  Score=23.15  Aligned_cols=17  Identities=0%  Similarity=-0.070  Sum_probs=14.3

Q ss_pred             chhhhhcCCCCCcccee
Q psy12003          2 NLLRDKNPPRGTERQIK   18 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~Vq   18 (61)
                      -+.|||..+|+++.+|=
T Consensus        38 si~elA~~a~VS~aTv~   54 (281)
T COG1737          38 SIAELAERAGVSPATVV   54 (281)
T ss_pred             HHHHHHHHhCCCHHHHH
Confidence            47899999999998874


No 352
>smart00344 HTH_ASNC helix_turn_helix ASNC type. AsnC: an autogenously regulated activator of asparagine synthetase A transcription in Escherichia coli
Probab=22.88  E-value=18  Score=19.55  Aligned_cols=16  Identities=6%  Similarity=-0.074  Sum_probs=13.3

Q ss_pred             hhhhhcCCCCCcccee
Q psy12003          3 LLRDKNPPRGTERQIK   18 (61)
Q Consensus         3 ~~eLA~~l~Lte~~Vq   18 (61)
                      ..+||..+|+++..|.
T Consensus        20 ~~~la~~l~~s~~tv~   35 (108)
T smart00344       20 LAELAKKVGLSPSTVH   35 (108)
T ss_pred             HHHHHHHHCcCHHHHH
Confidence            4688999999998884


No 353
>TIGR02392 rpoH_proteo alternative sigma factor RpoH. A sigma factor is a DNA-binding protein protein that binds to the DNA-directed RNA polymerase core to produce the holoenzyme capable of initiating transcription at specific sites. Different sigma factors act in vegetative growth, heat shock, extracytoplasmic functions (ECF), etc. This model represents the clade of sigma factors called RpoH and further restricted to the Proteobacteria. This protein may be called sigma-32, sigma factor H, heat shock sigma factor, and alternative sigma factor RpoH. Note that in some species the single locus rpoH may be replaced by two or more differentially regulated stress response sigma factors.
Probab=22.79  E-value=16  Score=23.40  Aligned_cols=21  Identities=10%  Similarity=-0.081  Sum_probs=16.6

Q ss_pred             chhhhhcCCCCCccceeeccc
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      -+.|+|..+|+|..+|+-...
T Consensus       238 t~~eIA~~lgvS~~~V~q~~~  258 (270)
T TIGR02392       238 TLQELAAEYGVSAERIRQIEK  258 (270)
T ss_pred             CHHHHHHHHCCCHHHHHHHHH
Confidence            468999999999999974433


No 354
>TIGR03624 putative hydrolase. Members of this protein family have a phylogenetic distribution skewed toward the Actinobacteria (high GC Gram-positive bacteria), but with a few members occuring in the Archaea and Chloroflexi. The function is unknown.
Probab=22.43  E-value=19  Score=24.54  Aligned_cols=30  Identities=7%  Similarity=0.279  Sum_probs=24.6

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKE   31 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~   31 (61)
                      ||.+.++.|++++..|.+|..-|=+=+.++
T Consensus       140 NI~~~~~~L~v~~~d~rlwlalhE~aH~~l  169 (345)
T TIGR03624       140 NIVAVERGLGVPPDDFRLWVALHEVTHRRQ  169 (345)
T ss_pred             HHHHHHHHcCCCHHHHHHHHHHHHHHHHHH
Confidence            789999999999999999988775444443


No 355
>PRK06596 RNA polymerase factor sigma-32; Reviewed
Probab=22.43  E-value=18  Score=23.46  Aligned_cols=19  Identities=5%  Similarity=-0.064  Sum_probs=16.0

Q ss_pred             chhhhhcCCCCCccceeec
Q psy12003          2 NLLRDKNPPRGTERQIKIW   20 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvW   20 (61)
                      .+.|+|..+|+|..+|+-.
T Consensus       250 Tl~EIA~~lgvS~~rVrqi  268 (284)
T PRK06596        250 TLQELAAEYGVSAERVRQI  268 (284)
T ss_pred             CHHHHHHHHCCCHHHHHHH
Confidence            4689999999999999743


No 356
>PF12793 SgrR_N:  Sugar transport-related sRNA regulator N-term
Probab=22.39  E-value=19  Score=20.54  Aligned_cols=17  Identities=12%  Similarity=-0.060  Sum_probs=13.8

Q ss_pred             chhhhhcCCCCCcccee
Q psy12003          2 NLLRDKNPPRGTERQIK   18 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~Vq   18 (61)
                      -|.|||..+.+|++.++
T Consensus        21 tl~elA~~l~cS~Rn~r   37 (115)
T PF12793_consen   21 TLDELAELLFCSRRNAR   37 (115)
T ss_pred             eHHHHHHHhCCCHHHHH
Confidence            37789999999988775


No 357
>PRK07500 rpoH2 RNA polymerase factor sigma-32; Reviewed
Probab=22.32  E-value=17  Score=23.68  Aligned_cols=28  Identities=7%  Similarity=-0.093  Sum_probs=20.5

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWK   29 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~k   29 (61)
                      .+.|+|..+|+|..+|+-.-..=+.|-|
T Consensus       247 t~~EIa~~lgvs~~~V~q~~~~Al~kLr  274 (289)
T PRK07500        247 TLEALGEELGISKERVRQIEARALEKLR  274 (289)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHHHHHHH
Confidence            4789999999999999866443333333


No 358
>COG1318 Predicted transcriptional regulators [Transcription]
Probab=22.30  E-value=18  Score=22.67  Aligned_cols=19  Identities=11%  Similarity=0.060  Sum_probs=15.5

Q ss_pred             chhhhhcCCCCCccceeec
Q psy12003          2 NLLRDKNPPRGTERQIKIW   20 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvW   20 (61)
                      -+-|+|..+|.||.+|+--
T Consensus        63 Ti~EIAeelG~TeqTir~h   81 (182)
T COG1318          63 TISEIAEELGRTEQTVRNH   81 (182)
T ss_pred             cHHHHHHHhCCCHHHHHHH
Confidence            4678999999999999743


No 359
>PRK13719 conjugal transfer transcriptional regulator TraJ; Provisional
Probab=22.26  E-value=20  Score=22.99  Aligned_cols=17  Identities=12%  Similarity=-0.396  Sum_probs=14.9

Q ss_pred             hhhhhcCCCCCccceee
Q psy12003          3 LLRDKNPPRGTERQIKI   19 (61)
Q Consensus         3 ~~eLA~~l~Lte~~Vqv   19 (61)
                      -.|+|.+|++++++|+.
T Consensus       161 nkEIA~~L~IS~~TVk~  177 (217)
T PRK13719        161 HEYIAQLLNITVGSSKN  177 (217)
T ss_pred             HHHHHHHhCCCHHHHHH
Confidence            46899999999999974


No 360
>PRK10360 DNA-binding transcriptional activator UhpA; Provisional
Probab=22.01  E-value=13  Score=21.40  Aligned_cols=25  Identities=8%  Similarity=-0.066  Sum_probs=18.0

Q ss_pred             hhhhhcCCCCCccceeeccccchhH
Q psy12003          3 LLRDKNPPRGTERQIKIWFQNRRMK   27 (61)
Q Consensus         3 ~~eLA~~l~Lte~~VqvWFqNrRak   27 (61)
                      ..++|..+++++++|++..++=|.|
T Consensus       155 ~~~Ia~~l~~s~~tv~~~~~~l~~K  179 (196)
T PRK10360        155 VKEIAAELGLSPKTVHVHRANLMEK  179 (196)
T ss_pred             HHHHHHHhCCCHHHHHHHHHHHHHH
Confidence            4578889999999998765544433


No 361
>cd04790 HTH_Cfa-like_unk Helix-Turn-Helix DNA binding domain of putative Cfa-like transcription regulators. Putative helix-turn-helix (HTH) MerR-like transcription regulator; conserved, Cfa-like, unknown proteins (~172 a.a.). The N-terminal domain of these proteins appears to be related to the HTH domain of Cfa, a cyclopropane fatty acid synthase. These Cfa-like proteins have a unique C-terminal domain with conserved histidines (motif HXXFX7HXXF). Based on sequence similarity of the N-terminal domains, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domain
Probab=21.95  E-value=15  Score=22.30  Aligned_cols=19  Identities=0%  Similarity=-0.085  Sum_probs=16.6

Q ss_pred             chhhhhcCCCCCccceeec
Q psy12003          2 NLLRDKNPPRGTERQIKIW   20 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvW   20 (61)
                      -|-|+|..+|+|..+|+-|
T Consensus         3 ~I~evA~~~gvs~~tLRyY   21 (172)
T cd04790           3 TISQLARQFGLSRSTLLYY   21 (172)
T ss_pred             CHHHHHHHHCcCHHHHHHH
Confidence            4779999999999999877


No 362
>COG3149 PulM Type II secretory pathway, component PulM [Intracellular trafficking and secretion]
Probab=21.87  E-value=37  Score=21.26  Aligned_cols=14  Identities=14%  Similarity=0.517  Sum_probs=10.4

Q ss_pred             CCCCccceeecccc
Q psy12003         10 PRGTERQIKIWFQN   23 (61)
Q Consensus        10 l~Lte~~VqvWFqN   23 (61)
                      +...+..|||||+-
T Consensus       122 l~~~ge~vQV~i~p  135 (181)
T COG3149         122 LDNRGEAVQVWIQP  135 (181)
T ss_pred             ecCCCceEEEEecc
Confidence            34467789999984


No 363
>PF09301 DUF1970:  Domain of unknown function (DUF1970);  InterPro: IPR015380 This entry is represented by Bacteriophage PRD1, P16; it is a family of uncharacterised viral proteins.; PDB: 1W8X_P.
Probab=21.70  E-value=18  Score=20.35  Aligned_cols=11  Identities=45%  Similarity=0.984  Sum_probs=7.0

Q ss_pred             eeeccccchhH
Q psy12003         17 IKIWFQNRRMK   27 (61)
Q Consensus        17 VqvWFqNrRak   27 (61)
                      |=+||.||-+-
T Consensus        19 iwlwfrnrpaa   29 (117)
T PF09301_consen   19 IWLWFRNRPAA   29 (117)
T ss_dssp             HHHHHHHTT-S
T ss_pred             HHHHHccChHH
Confidence            34699998653


No 364
>PRK05863 sulfur carrier protein ThiS; Provisional
Probab=21.64  E-value=96  Score=15.54  Aligned_cols=29  Identities=14%  Similarity=0.139  Sum_probs=23.2

Q ss_pred             chhhhhcCCCCCccceeeccccc---hhHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNR---RMKWKK   30 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNr---Rak~kr   30 (61)
                      -|.+|-..+++++..|-|..-+.   |..|..
T Consensus        17 tl~~ll~~l~~~~~~vav~~N~~iv~r~~~~~   48 (65)
T PRK05863         17 TVAALLDSLGFPEKGIAVAVDWSVLPRSDWAT   48 (65)
T ss_pred             cHHHHHHHcCCCCCcEEEEECCcCcChhHhhh
Confidence            37788889999999999998775   666653


No 365
>cd00419 Ferrochelatase_C Ferrochelatase, C-terminal domain: Ferrochelatase (protoheme ferrolyase or HemH) is the terminal enzyme of the heme biosynthetic pathway. It catalyzes the insertion of ferrous iron into the protoporphyrin IX ring yielding protoheme. This enzyme is ubiquitous in nature and widely distributed in bacteria and eukaryotes. Recently, some archaeal members have been identified. The oligomeric state of these enzymes varies depending on the presence of a dimerization motif at the C-terminus.
Probab=21.61  E-value=40  Score=19.56  Aligned_cols=21  Identities=10%  Similarity=-0.088  Sum_probs=16.5

Q ss_pred             hhhcCCCCCccceeeccccch
Q psy12003          5 RDKNPPRGTERQIKIWFQNRR   25 (61)
Q Consensus         5 eLA~~l~Lte~~VqvWFqNrR   25 (61)
                      .|+..++++..++.+-||+|-
T Consensus        49 ~v~~~l~~~~~~~~~~fqS~~   69 (135)
T cd00419          49 LVAERLGLPFDEYELAYQSRF   69 (135)
T ss_pred             HHHHHhCCCCCCEEEEecCCC
Confidence            356778877888999999864


No 366
>PRK15201 fimbriae regulatory protein FimW; Provisional
Probab=21.60  E-value=21  Score=22.68  Aligned_cols=17  Identities=24%  Similarity=0.030  Sum_probs=15.0

Q ss_pred             hhhhhcCCCCCccceee
Q psy12003          3 LLRDKNPPRGTERQIKI   19 (61)
Q Consensus         3 ~~eLA~~l~Lte~~Vqv   19 (61)
                      ..|+|..|++++++|+.
T Consensus       151 nKEIAe~L~IS~rTVkt  167 (198)
T PRK15201        151 LSETAALLSLSEEQTKS  167 (198)
T ss_pred             HHHHHHHhCCCHHHHHH
Confidence            56899999999999974


No 367
>smart00420 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor.
Probab=21.52  E-value=19  Score=16.41  Aligned_cols=18  Identities=11%  Similarity=-0.079  Sum_probs=13.3

Q ss_pred             chhhhhcCCCCCccceee
Q psy12003          2 NLLRDKNPPRGTERQIKI   19 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~Vqv   19 (61)
                      .+.+||..++++...|.-
T Consensus        16 s~~~l~~~l~~s~~tv~~   33 (53)
T smart00420       16 SVEELAELLGVSEMTIRR   33 (53)
T ss_pred             CHHHHHHHHCCCHHHHHH
Confidence            356788888888887753


No 368
>PRK09943 DNA-binding transcriptional repressor PuuR; Provisional
Probab=21.37  E-value=18  Score=21.77  Aligned_cols=22  Identities=18%  Similarity=0.028  Sum_probs=12.0

Q ss_pred             hhhhhcCCCCCccceeeccccc
Q psy12003          3 LLRDKNPPRGTERQIKIWFQNR   24 (61)
Q Consensus         3 ~~eLA~~l~Lte~~VqvWFqNr   24 (61)
                      +.+||..+|++...|.-|.+++
T Consensus        23 ~~elA~~~gis~~~is~~E~g~   44 (185)
T PRK09943         23 QRRAAELSGLTHSAISTIEQDK   44 (185)
T ss_pred             HHHHHHHHCCCHHHHHHHHcCC
Confidence            3455555555555555555444


No 369
>PF04046 PSP:  PSP;  InterPro: IPR006568 PSP is a proline-rich domain of unknown function found in spliceosome associated proteins.
Probab=21.34  E-value=27  Score=17.28  Aligned_cols=19  Identities=11%  Similarity=0.055  Sum_probs=16.1

Q ss_pred             hhhhcCCCCCccceeeccc
Q psy12003          4 LRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         4 ~eLA~~l~Lte~~VqvWFq   22 (61)
                      .||=.+|||.+.+.--|+.
T Consensus         7 ~~LR~ALg~~~~~~PPwl~   25 (48)
T PF04046_consen    7 DELREALGMQENDPPPWLY   25 (48)
T ss_pred             HHHHHHcCCCCCCCChHHH
Confidence            3677789999999999986


No 370
>cd01806 Nedd8 Nebb8-like  ubiquitin protein. Nedd8 (also known as Rub1) has a single conserved ubiquitin-like domain that is part of a protein modification pathway similar to that of ubiquitin.  Nedd8 modifies a family of molecular scaffold proteins called cullins that are responsible for assembling the ROC1/Rbx1 RING-based E3 ubiquitin ligases, of which several play a direct role in tumorigenesis.
Probab=21.32  E-value=48  Score=16.53  Aligned_cols=22  Identities=14%  Similarity=0.261  Sum_probs=17.1

Q ss_pred             hhhcCCCCCccceeeccccchh
Q psy12003          5 RDKNPPRGTERQIKIWFQNRRM   26 (61)
Q Consensus         5 eLA~~l~Lte~~VqvWFqNrRa   26 (61)
                      .|+...+++....+++|..+..
T Consensus        29 ~i~~~~g~~~~~qrL~~~g~~L   50 (76)
T cd01806          29 RVEEKEGIPPQQQRLIYSGKQM   50 (76)
T ss_pred             HHhHhhCCChhhEEEEECCeEc
Confidence            4567779999999999986654


No 371
>PRK09935 transcriptional regulator FimZ; Provisional
Probab=21.16  E-value=14  Score=21.36  Aligned_cols=25  Identities=8%  Similarity=-0.169  Sum_probs=18.3

Q ss_pred             hhhhhcCCCCCccceeeccccchhH
Q psy12003          3 LLRDKNPPRGTERQIKIWFQNRRMK   27 (61)
Q Consensus         3 ~~eLA~~l~Lte~~VqvWFqNrRak   27 (61)
                      ..|+|..+++++++|+++..+=|.|
T Consensus       167 ~~eIa~~l~~s~~tv~~~~~~~~~k  191 (210)
T PRK09935        167 NKEIADQLLLSNKTVSAHKSNIYGK  191 (210)
T ss_pred             HHHHHHHhCCCHHHHHHHHHHHHHH
Confidence            4578889999999998775544443


No 372
>PRK10281 hypothetical protein; Provisional
Probab=20.99  E-value=31  Score=22.64  Aligned_cols=16  Identities=6%  Similarity=-0.047  Sum_probs=12.3

Q ss_pred             chhhhhcCCCCCccce
Q psy12003          2 NLLRDKNPPRGTERQI   17 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~V   17 (61)
                      +|..+|+++|++|+.-
T Consensus        34 ~Mq~IAre~n~SETaF   49 (299)
T PRK10281         34 QMQLIARELNHSETAF   49 (299)
T ss_pred             HHHHHHHHhCCceEEE
Confidence            5678899999988643


No 373
>TIGR03883 DUF2342_F420 uncharacterized protein, coenzyme F420 biosynthesis associated. protein whose crystal structure has been determined (PDB:3CMN_A). This has been annotated as a putative hydrolase, but the support for that assertion is untraceable. There is no cofactor present in the structure.
Probab=20.99  E-value=21  Score=24.33  Aligned_cols=30  Identities=7%  Similarity=0.227  Sum_probs=24.4

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWKKE   31 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~kr~   31 (61)
                      ||.+.++.|++++..+.+|..-|=+=+.++
T Consensus       144 NI~~~~~~L~v~~~d~rlwlalhE~aH~~~  173 (346)
T TIGR03883       144 NIVAVERELGVDPHDFRLWVCLHEVTHRVQ  173 (346)
T ss_pred             hHHHHHHHcCCCHHHHHHHHHHHHHHHHHH
Confidence            789999999999999999988775444443


No 374
>TIGR02997 Sig70-cyanoRpoD RNA polymerase sigma factor, cyanobacterial RpoD-like family. This family includes a number of closely related sigma-70 (TIGR02937) factors in the cyanobacteria. All appear most closely related to the essential sigma-70 factor RpoD, and some score above trusted to the RpoD C-terminal domain model (TIGR02393).
Probab=20.96  E-value=20  Score=23.28  Aligned_cols=19  Identities=5%  Similarity=-0.038  Sum_probs=16.1

Q ss_pred             chhhhhcCCCCCccceeec
Q psy12003          2 NLLRDKNPPRGTERQIKIW   20 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvW   20 (61)
                      -+.|+|..+|+|..+|+..
T Consensus       271 Tl~EIa~~lgiS~erVrq~  289 (298)
T TIGR02997       271 TLAEIGRRLNLSRERVRQI  289 (298)
T ss_pred             CHHHHHHHHCcCHHHHHHH
Confidence            4789999999999999743


No 375
>COG3413 Predicted DNA binding protein [General function prediction only]
Probab=20.94  E-value=23  Score=21.94  Aligned_cols=26  Identities=15%  Similarity=0.026  Sum_probs=17.6

Q ss_pred             chhhhhcCCCCCccceeeccccchhHHH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMKWK   29 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak~k   29 (61)
                      .|.+||..+|++...+.  ..=|||..|
T Consensus       180 ~l~dLA~~lGISkst~~--ehLRrAe~K  205 (215)
T COG3413         180 SLKDLAKELGISKSTLS--EHLRRAERK  205 (215)
T ss_pred             CHHHHHHHhCCCHHHHH--HHHHHHHHH
Confidence            47899999999987653  333444433


No 376
>cd08311 Death_p75NR Death domain of p75 Neurotophin Receptor. Death Domain (DD) found in p75 neurotrophin receptor (p75NTR, NGFR, TNFRSF16). p75NTR binds members of the neurotrophin (NT) family including nerve growth factor (NGF), brain-derived neurotrophic factor (BDNF), and NT3, among others. It contains an NT-binding extracellular region that bears four cysteine-rich repeats, a transmembrane domain, and an intracellular DD. p75NTR plays roles in the immune, vascular, and nervous systems, and has been shown to promote cell death or survival, and to induce neurite outgrowth or collapse depending on its ligands and co-receptors. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN. They serve as adaptor
Probab=20.94  E-value=18  Score=19.29  Aligned_cols=17  Identities=6%  Similarity=-0.074  Sum_probs=14.3

Q ss_pred             hhhhcCCCCCccceeec
Q psy12003          4 LRDKNPPRGTERQIKIW   20 (61)
Q Consensus         4 ~eLA~~l~Lte~~VqvW   20 (61)
                      ..||.+||+++..|..+
T Consensus        19 ~~LA~~LG~~~~~I~~i   35 (77)
T cd08311          19 RSLAGELGYEDEAIDTF   35 (77)
T ss_pred             HHHHHHcCCCHHHHHHH
Confidence            36899999999988865


No 377
>PHA00542 putative Cro-like protein
Probab=20.90  E-value=15  Score=19.50  Aligned_cols=23  Identities=9%  Similarity=0.039  Sum_probs=19.6

Q ss_pred             chhhhhcCCCCCccceeeccccc
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNR   24 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNr   24 (61)
                      ...+||..+|++...|--|..++
T Consensus        33 Tq~elA~~lgIs~~tIsr~e~g~   55 (82)
T PHA00542         33 SQEQIADATDVSQPTICRIYSGR   55 (82)
T ss_pred             CHHHHHHHHCcCHHHHHHHHcCC
Confidence            35789999999999999888776


No 378
>PF00531 Death:  Death domain;  InterPro: IPR000488 The death domain (DD) is a homotypic protein interaction module composed of a bundle of six alpha-helices. DD is related in sequence and structure to the death effector domain (DED, see IPR001875 from INTERPRO) and the caspase recruitment domain (CARD, see IPR001315 from INTERPRO), which work in similar pathways and show similar interaction properties []. DD bind each other forming oligomers. Mammals have numerous and diverse DD-containing proteins []. Within these proteins, the DD domains can be found in combination with other domains, including: CARDs, DEDs, ankyrin repeats (IPR002110 from INTERPRO), caspase-like folds, kinase domains, leucine zippers (IPR002158 from INTERPRO), leucine-rich repeats (LRR) (IPR001611 from INTERPRO), TIR domains (IPR000157 from INTERPRO), and ZU5 domains (IPR000906 from INTERPRO) []. Some DD-containing proteins are involved in the regulation of apoptosis and inflammation through their activation of caspases and NF-kappaB, which typically involves interactions with TNF (tumour necrosis factor) cytokine receptors [, ]. In humans, eight of the over 30 known TNF receptors contain DD in their cytoplasmic tails; several of these TNF receptors use caspase activation as a signalling mechanism. The DD mediates self-association of these receptors, thus giving the signal to downstream events that lead to apoptosis. Other DD-containing proteins, such as ankyrin, MyD88 and pelle, are probably not directly involved in cell death signalling. DD-containing proteins also have links to innate immunity, communicating with Toll family receptors through bipartite adapter proteins such as MyD88 [].; GO: 0005515 protein binding, 0007165 signal transduction; PDB: 3OQ9_L 3EZQ_F 1E41_A 1E3Y_A 2GF5_A 2OF5_L 3EWV_E 3G5B_A 3MOP_L 2A9I_A ....
Probab=20.78  E-value=14  Score=18.83  Aligned_cols=17  Identities=18%  Similarity=-0.048  Sum_probs=12.8

Q ss_pred             hhhhcCCCCCccceeec
Q psy12003          4 LRDKNPPRGTERQIKIW   20 (61)
Q Consensus         4 ~eLA~~l~Lte~~VqvW   20 (61)
                      -.||..||+++..|+..
T Consensus        16 k~La~~Lg~~~~~i~~i   32 (83)
T PF00531_consen   16 KRLARKLGLSESEIENI   32 (83)
T ss_dssp             HHHHHHTTS-HHHHHHH
T ss_pred             HHHHHHhCcCHHHHHHH
Confidence            46899999999988744


No 379
>PF13693 HTH_35:  Winged helix-turn-helix DNA-binding; PDB: 1NEQ_A 1NER_A.
Probab=20.76  E-value=18  Score=19.54  Aligned_cols=26  Identities=8%  Similarity=-0.041  Sum_probs=18.7

Q ss_pred             chhhhhcCCCCCccceeeccccchhH
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQNRRMK   27 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFqNrRak   27 (61)
                      .|++||.+.||+...+..=+...-.|
T Consensus        17 sL~~lsr~~Gl~~~tl~nal~r~~pk   42 (78)
T PF13693_consen   17 SLAALSREAGLSSSTLRNALRRPWPK   42 (78)
T ss_dssp             -HHHHHHHHSS-HHHHHHTTTSS-HH
T ss_pred             CHHHHHHHcCCCHHHHHHHHcCCChH
Confidence            57899999999999999777655433


No 380
>PRK11303 DNA-binding transcriptional regulator FruR; Provisional
Probab=20.76  E-value=24  Score=22.35  Aligned_cols=24  Identities=8%  Similarity=-0.028  Sum_probs=19.7

Q ss_pred             CchhhhhcCCCCCccceeeccccc
Q psy12003          1 MNLLRDKNPPRGTERQIKIWFQNR   24 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWFqNr   24 (61)
                      |-|.++|+.+|++-.+|---+-|+
T Consensus         1 ~ti~dIA~~aGVS~~TVSrvLn~~   24 (328)
T PRK11303          1 MKLDEIARLAGVSRTTASYVINGK   24 (328)
T ss_pred             CCHHHHHHHhCCCHHHHHHHHcCC
Confidence            568899999999999888767665


No 381
>PF09862 DUF2089:  Protein of unknown function (DUF2089);  InterPro: IPR018658  This family consists of various hypothetical prokaryotic proteins. 
Probab=20.69  E-value=22  Score=20.55  Aligned_cols=17  Identities=12%  Similarity=0.012  Sum_probs=15.1

Q ss_pred             chhhhhcCCCCCcccee
Q psy12003          2 NLLRDKNPPRGTERQIK   18 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~Vq   18 (61)
                      +|-|+|+.+|+++-+|+
T Consensus        51 nlKe~e~~lgiSYPTvR   67 (113)
T PF09862_consen   51 NLKEMEKELGISYPTVR   67 (113)
T ss_pred             CHHHHHHHHCCCcHHHH
Confidence            67899999999999986


No 382
>PRK10668 DNA-binding transcriptional repressor AcrR; Provisional
Probab=20.66  E-value=21  Score=21.38  Aligned_cols=24  Identities=21%  Similarity=0.116  Sum_probs=21.1

Q ss_pred             hhhhhcCCCCCccceeeccccchh
Q psy12003          3 LLRDKNPPRGTERQIKIWFQNRRM   26 (61)
Q Consensus         3 ~~eLA~~l~Lte~~VqvWFqNrRa   26 (61)
                      |.+||.+.|++...+--.|.|+..
T Consensus        34 ~~~Ia~~agvs~~tlY~~F~sKe~   57 (215)
T PRK10668         34 LADIAKAAGVTRGAIYWHFKNKSD   57 (215)
T ss_pred             HHHHHHHhCCChHHHHHHCCCHHH
Confidence            678999999999999999998854


No 383
>COG0384 Predicted epimerase, PhzC/PhzF homolog [General function prediction only]
Probab=20.58  E-value=33  Score=22.78  Aligned_cols=15  Identities=7%  Similarity=-0.137  Sum_probs=12.0

Q ss_pred             chhhhhcCCCCCccc
Q psy12003          2 NLLRDKNPPRGTERQ   16 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~   16 (61)
                      +|..+|+++|++|+.
T Consensus        35 ~MQ~IA~e~n~SET~   49 (291)
T COG0384          35 QMQAIAREFNLSETA   49 (291)
T ss_pred             HHHHHHHHhCCceeE
Confidence            467888899998874


No 384
>cd08803 Death_ank3 Death domain of Ankyrin-3. Death Domain (DD) of the human protein ankyrin-3 (ANK-3) and related proteins. Ankyrins are modular proteins comprising three conserved domains, an N-terminal membrane-binding domain containing ANK repeats, a spectrin-binding domain and a C-terminal DD. ANK-3, also called anykyrin-G (for general or giant), is found in neurons and at least one splice variant has been shown to be essential for propagation of action potentials as a binding partner to neurofascin and voltage-gated sodium channels. It is required for maintaining axo-dendritic polarity, and may be a genetic risk factor associated with bipolar disorder. ANK-3 may also play roles in other cell types. Mutations affecting ANK-3 pathways for Na channel localization are associated with Brugada syndrome, a potentially fata arrythmia. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by se
Probab=20.51  E-value=24  Score=19.13  Aligned_cols=16  Identities=6%  Similarity=-0.180  Sum_probs=12.8

Q ss_pred             hhhhcCCCCCccceee
Q psy12003          4 LRDKNPPRGTERQIKI   19 (61)
Q Consensus         4 ~eLA~~l~Lte~~Vqv   19 (61)
                      .+||..||+++..|..
T Consensus        19 ~~LA~eLg~s~~dI~~   34 (84)
T cd08803          19 TELARELNFSVDEINQ   34 (84)
T ss_pred             HHHHHHcCCCHHHHHH
Confidence            4689999999987763


No 385
>PF12840 HTH_20:  Helix-turn-helix domain; PDB: 1ULY_A 2CWE_A 1Y0U_B 2QUF_B 2QLZ_C 2OQG_B 2ZKZ_C 3PQK_A 3PQJ_D 3F6O_B ....
Probab=20.45  E-value=11  Score=18.58  Aligned_cols=16  Identities=0%  Similarity=-0.103  Sum_probs=11.0

Q ss_pred             chhhhhcCCCCCccce
Q psy12003          2 NLLRDKNPPRGTERQI   17 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~V   17 (61)
                      .+.|||..+|++...|
T Consensus        26 t~~ela~~l~~~~~t~   41 (61)
T PF12840_consen   26 TVSELAEELGISQSTV   41 (61)
T ss_dssp             EHHHHHHHHTS-HHHH
T ss_pred             CHHHHHHHHCCCHHHH
Confidence            4568888888887665


No 386
>PRK08215 sporulation sigma factor SigG; Reviewed
Probab=20.44  E-value=19  Score=22.76  Aligned_cols=19  Identities=5%  Similarity=-0.059  Sum_probs=15.8

Q ss_pred             chhhhhcCCCCCccceeec
Q psy12003          2 NLLRDKNPPRGTERQIKIW   20 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvW   20 (61)
                      -+.|+|..+|++..+|...
T Consensus       227 t~~eIA~~lgis~~~V~~~  245 (258)
T PRK08215        227 TQMEVAEEIGISQAQVSRL  245 (258)
T ss_pred             CHHHHHHHHCcCHHHHHHH
Confidence            4678999999999998754


No 387
>PF15599 Imm38:  Immunity protein 38
Probab=20.43  E-value=49  Score=19.05  Aligned_cols=21  Identities=5%  Similarity=0.172  Sum_probs=16.2

Q ss_pred             chhhhhcCCCCCccceeeccc
Q psy12003          2 NLLRDKNPPRGTERQIKIWFQ   22 (61)
Q Consensus         2 ~~~eLA~~l~Lte~~VqvWFq   22 (61)
                      +|.+|+.++|.++..+..-+.
T Consensus         6 ~i~~l~~k~g~~~~~~~~~~~   26 (124)
T PF15599_consen    6 EIDELARKIGAPDNEYPLFFR   26 (124)
T ss_pred             HHHHHHHHhCCCccccccccc
Confidence            578899999998877765544


No 388
>PF10846 DUF2722:  Protein of unknown function (DUF2722);  InterPro: IPR021216  This eukaryotic family of proteins has no known function. 
Probab=20.18  E-value=31  Score=24.12  Aligned_cols=21  Identities=24%  Similarity=0.294  Sum_probs=19.8

Q ss_pred             CchhhhhcCCCCCccceeecc
Q psy12003          1 MNLLRDKNPPRGTERQIKIWF   21 (61)
Q Consensus         1 ~~~~eLA~~l~Lte~~VqvWF   21 (61)
                      +||+++|.+.|++...|-.-|
T Consensus        88 lelLr~Al~~gIPp~lIP~LF  108 (416)
T PF10846_consen   88 LELLRTALQAGIPPNLIPLLF  108 (416)
T ss_pred             HHHHHHHHHcCCChhhcceee
Confidence            589999999999999999999


No 389
>PF02567 PhzC-PhzF:  Phenazine biosynthesis-like protein;  InterPro: IPR003719 Five genes, phzF, phzA, phzB, phzC and phzD, encode enzymes for phenazine biosynthesis in the biological control bacterium Pseudomonas chlororaphis (also known as Pseudomonas aureofaciens). Protein PhzF is similar to 3-deoxy-D-arabino-heptulosonate-7-phosphate synthases of solanaceous plants. PhzC is responsible for the conversion of phenazine-I-carboxylic acid to 2-hydroxy-phenazine-I-carboxylic acid [].; GO: 0003824 catalytic activity, 0009058 biosynthetic process; PDB: 1U0K_A 1QYA_B 1QY9_D 1SDJ_A 1U1X_A 1U1W_B 1T6K_A 1XUA_A 1XUB_A 1U1V_A ....
Probab=20.16  E-value=21  Score=22.59  Aligned_cols=14  Identities=7%  Similarity=-0.142  Sum_probs=11.1

Q ss_pred             chhhhhcCCCCCcc
Q psy12003          2 NLLRDKNPPRGTER   15 (61)
Q Consensus         2 ~~~eLA~~l~Lte~   15 (61)
                      +|..||+++|++|+
T Consensus        27 ~mq~iA~e~n~sET   40 (281)
T PF02567_consen   27 QMQAIAREFNLSET   40 (281)
T ss_dssp             HHHHHHHHHTSSEE
T ss_pred             HHHHHHHHcCCCee
Confidence            46778888888886


Done!