BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy1201
         (179 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3KKZ|A Chain A, Crystal Structure Of The Q5les9_bacfn Protein From
           Bacteroides Fragilis. Northeast Structural Genomics
           Consortium Target Bfr250.
 pdb|3KKZ|B Chain B, Crystal Structure Of The Q5les9_bacfn Protein From
           Bacteroides Fragilis. Northeast Structural Genomics
           Consortium Target Bfr250
          Length = 267

 Score = 28.5 bits (62), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 22/57 (38%), Gaps = 14/57 (24%)

Query: 29  YPSITSLVKSTSPVHTE--------------WTDKYFTPVIAFLVFSVCDYLGRFIA 71
           YP I ++    + +H                WTD YFTP +A     +  Y G  IA
Sbjct: 170 YPEIDTIPNQVAKIHKAGYLPVATFILPENCWTDHYFTPKVAAQKIFLTKYAGNKIA 226


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.330    0.141    0.465 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,714,892
Number of Sequences: 62578
Number of extensions: 171627
Number of successful extensions: 297
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 294
Number of HSP's gapped (non-prelim): 3
length of query: 179
length of database: 14,973,337
effective HSP length: 93
effective length of query: 86
effective length of database: 9,153,583
effective search space: 787208138
effective search space used: 787208138
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 48 (23.1 bits)