Query         psy12011
Match_columns 94
No_of_seqs    105 out of 1775
Neff          11.3
Searched_HMMs 46136
Date          Fri Aug 16 16:24:45 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12011.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12011hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.9 9.4E-27   2E-31  131.6   4.9   88    6-94    159-249 (279)
  2 KOG2462|consensus               99.8 6.2E-21 1.3E-25  108.2   3.2   78    4-82    183-265 (279)
  3 KOG3623|consensus               99.7 3.3E-18 7.1E-23  107.6   0.5   78    3-81    889-971 (1007)
  4 KOG3576|consensus               99.6 4.1E-17 8.8E-22   89.7   0.1   90    4-94    113-218 (267)
  5 KOG3623|consensus               99.6   1E-15 2.2E-20   96.7   1.7   67   27-94    890-956 (1007)
  6 KOG3576|consensus               99.4 1.1E-14 2.5E-19   80.2  -0.4   65   29-94    115-179 (267)
  7 PHA00733 hypothetical protein   99.3 1.1E-12 2.4E-17   68.7   2.7   78    6-86     38-125 (128)
  8 KOG3608|consensus               99.3 2.1E-12 4.5E-17   76.4   2.4   89    2-91    201-322 (467)
  9 KOG1074|consensus               99.2 6.1E-12 1.3E-16   80.9   0.7   58   31-89    353-410 (958)
 10 KOG3608|consensus               99.1 1.5E-11 3.3E-16   72.9   0.1   85    8-94    263-358 (467)
 11 KOG1074|consensus               99.1 3.2E-11 6.8E-16   77.7   1.4   56   30-86    604-659 (958)
 12 PHA02768 hypothetical protein;  99.1 3.7E-11 8.1E-16   53.5   1.1   43   31-76      5-47  (55)
 13 PHA02768 hypothetical protein;  99.1 1.2E-10 2.7E-15   51.9   2.3   32   61-94      6-37  (55)
 14 PHA00616 hypothetical protein   99.0 3.4E-10 7.4E-15   48.2   1.5   33   60-92      1-33  (44)
 15 PLN03086 PRLI-interacting fact  98.9   3E-09 6.5E-14   67.2   4.4   84    6-94    451-547 (567)
 16 PLN03086 PRLI-interacting fact  98.8 1.3E-08 2.8E-13   64.4   4.7   60   29-94    451-510 (567)
 17 PF13465 zf-H2C2_2:  Zinc-finge  98.8 5.2E-09 1.1E-13   40.2   1.9   24   47-71      2-25  (26)
 18 PF13465 zf-H2C2_2:  Zinc-finge  98.8   5E-09 1.1E-13   40.2   1.6   20   75-94      1-20  (26)
 19 PHA00733 hypothetical protein   98.7   9E-09   2E-13   54.0   2.3   55    2-56     67-124 (128)
 20 PHA00732 hypothetical protein   98.6 3.6E-08 7.7E-13   47.6   1.9   44   31-81      1-45  (79)
 21 PHA00616 hypothetical protein   98.6 3.3E-08 7.2E-13   42.2   1.3   34   31-65      1-34  (44)
 22 KOG3993|consensus               98.4 2.3E-08 5.1E-13   60.8  -1.1   79    7-85    266-381 (500)
 23 PF00096 zf-C2H2:  Zinc finger,  98.4 4.3E-07 9.4E-12   33.6   2.3   23   61-83      1-23  (23)
 24 PF13894 zf-C2H2_4:  C2H2-type   98.2 1.8E-06   4E-11   31.9   2.5   24   61-84      1-24  (24)
 25 PF13912 zf-C2H2_6:  C2H2-type   98.2 1.2E-06 2.5E-11   33.7   1.8   26   60-85      1-26  (27)
 26 PHA00732 hypothetical protein   98.1 3.6E-06 7.7E-11   40.7   2.5   32   60-94      1-33  (79)
 27 PF05605 zf-Di19:  Drought indu  98.1 8.2E-06 1.8E-10   36.6   3.4   52   31-85      2-54  (54)
 28 PF09237 GAGA:  GAGA factor;  I  98.1 4.9E-06 1.1E-10   36.4   2.5   35   54-88     18-52  (54)
 29 PF00096 zf-C2H2:  Zinc finger,  98.0 2.7E-06 5.9E-11   31.4   0.9   23   32-54      1-23  (23)
 30 PF13912 zf-C2H2_6:  C2H2-type   97.8   9E-06 1.9E-10   31.1   1.0   26   31-56      1-26  (27)
 31 PF12756 zf-C2H2_2:  C2H2 type   97.7 5.3E-05 1.2E-09   37.7   2.7   72   10-83      1-73  (100)
 32 smart00355 ZnF_C2H2 zinc finge  97.7 5.6E-05 1.2E-09   28.1   2.1   24   61-84      1-24  (26)
 33 PF13894 zf-C2H2_4:  C2H2-type   97.6 3.4E-05 7.5E-10   28.3   1.2   23   32-54      1-23  (24)
 34 PF13909 zf-H2C2_5:  C2H2-type   97.6  0.0001 2.2E-09   27.3   2.3   24   61-85      1-24  (24)
 35 COG5189 SFP1 Putative transcri  97.5   4E-05 8.7E-10   45.8   0.9   24   57-81    396-419 (423)
 36 PRK04860 hypothetical protein;  97.4 0.00013 2.9E-09   39.8   2.5   31   60-94    119-149 (160)
 37 PF05605 zf-Di19:  Drought indu  97.2 0.00065 1.4E-08   30.4   3.0   33   61-94      3-37  (54)
 38 smart00355 ZnF_C2H2 zinc finge  97.2 0.00028   6E-09   26.1   1.5   24   32-55      1-24  (26)
 39 PF12874 zf-met:  Zinc-finger o  97.1 0.00045 9.7E-09   25.7   1.8   22   61-82      1-22  (25)
 40 PF09237 GAGA:  GAGA factor;  I  97.1 0.00041 8.9E-09   30.5   1.7   34   26-59     19-52  (54)
 41 KOG3993|consensus               97.1 0.00015 3.2E-09   44.9   0.2   53   31-84    267-319 (500)
 42 PF12874 zf-met:  Zinc-finger o  96.9 0.00044 9.6E-09   25.7   0.8   23   32-54      1-23  (25)
 43 PRK04860 hypothetical protein;  96.7 0.00082 1.8E-08   36.8   1.3   38   31-73    119-156 (160)
 44 PF12171 zf-C2H2_jaz:  Zinc-fin  96.7  0.0013 2.9E-08   25.0   1.5   21   32-52      2-22  (27)
 45 COG5189 SFP1 Putative transcri  95.9  0.0055 1.2E-07   37.1   1.7   37   57-94    347-404 (423)
 46 PF13913 zf-C2HC_2:  zinc-finge  95.9  0.0098 2.1E-07   22.3   1.8   20   61-81      3-22  (25)
 47 TIGR02098 MJ0042_CXXC MJ0042 f  95.1   0.017 3.6E-07   23.8   1.4   10   61-70     26-35  (38)
 48 PF13717 zinc_ribbon_4:  zinc-r  95.0   0.021 4.6E-07   23.3   1.5   10   61-70     26-35  (36)
 49 smart00451 ZnF_U1 U1-like zinc  94.9   0.031 6.7E-07   22.3   2.0   22   61-82      4-25  (35)
 50 PF13719 zinc_ribbon_5:  zinc-r  94.6   0.027 5.8E-07   23.2   1.4   32   33-70      4-35  (37)
 51 COG5048 FOG: Zn-finger [Genera  94.6   0.012 2.7E-07   36.2   0.5   61   30-91    288-354 (467)
 52 PF09723 Zn-ribbon_8:  Zinc rib  94.3   0.037   8E-07   23.4   1.5   28    9-38      6-33  (42)
 53 COG2888 Predicted Zn-ribbon RN  94.0   0.051 1.1E-06   24.7   1.7   32   30-67     26-57  (61)
 54 smart00834 CxxC_CXXC_SSSS Puta  93.0   0.085 1.8E-06   21.8   1.5   13    9-21      6-18  (41)
 55 COG1592 Rubrerythrin [Energy p  92.5    0.14 3.1E-06   28.3   2.3    8    8-15    134-141 (166)
 56 cd00350 rubredoxin_like Rubred  92.3    0.16 3.4E-06   20.2   1.8   24   32-68      2-25  (33)
 57 smart00531 TFIIE Transcription  92.3    0.12 2.6E-06   28.0   1.9   39   28-71     96-134 (147)
 58 TIGR02605 CxxC_CxxC_SSSS putat  92.1    0.13 2.7E-06   22.6   1.5   28    9-38      6-33  (52)
 59 PRK00398 rpoP DNA-directed RNA  91.7    0.16 3.5E-06   21.8   1.6   28    8-40      3-30  (46)
 60 KOG1146|consensus               91.7    0.21 4.6E-06   35.9   2.8   56   26-82    460-540 (1406)
 61 cd00729 rubredoxin_SM Rubredox  91.6     0.2 4.3E-06   20.2   1.7   10    8-17      2-11  (34)
 62 PF12756 zf-C2H2_2:  C2H2 type   91.3    0.14   3E-06   25.3   1.4   25   31-55     50-74  (100)
 63 smart00659 RPOLCX RNA polymera  90.7    0.19 4.1E-06   21.5   1.3   10   61-70     20-29  (44)
 64 PF09538 FYDLN_acid:  Protein o  90.2     0.2 4.4E-06   25.8   1.3   30    9-44     10-39  (108)
 65 KOG2186|consensus               90.1    0.17 3.7E-06   29.9   1.1   38   32-72      4-41  (276)
 66 TIGR00373 conserved hypothetic  89.9    0.22 4.7E-06   27.4   1.4   35   27-71    105-139 (158)
 67 smart00614 ZnF_BED BED zinc fi  89.8     0.4 8.7E-06   20.9   2.0   22   61-82     19-45  (50)
 68 PRK00464 nrdR transcriptional   89.7    0.17 3.7E-06   27.7   0.9   39   10-48      2-45  (154)
 69 PF05443 ROS_MUCR:  ROS/MUCR tr  89.4    0.27 5.9E-06   26.2   1.5   25   61-88     73-97  (132)
 70 PRK14890 putative Zn-ribbon RN  89.2     0.4 8.8E-06   21.9   1.8   52    6-68      5-56  (59)
 71 PF10571 UPF0547:  Uncharacteri  89.1    0.28 6.1E-06   18.5   1.1    9   62-70     16-24  (26)
 72 PRK06266 transcription initiat  89.0     0.3 6.4E-06   27.4   1.5   33   29-71    115-147 (178)
 73 PF09986 DUF2225:  Uncharacteri  88.8    0.15 3.2E-06   29.4   0.3   16    7-22      4-19  (214)
 74 COG1997 RPL43A Ribosomal prote  88.2    0.28 6.1E-06   24.2   1.0   11   61-71     54-64  (89)
 75 COG4049 Uncharacterized protei  88.1    0.36 7.7E-06   21.7   1.2   23   30-52     16-38  (65)
 76 PF12013 DUF3505:  Protein of u  87.9    0.65 1.4E-05   23.7   2.3   25   61-85     81-109 (109)
 77 PF04959 ARS2:  Arsenite-resist  87.5    0.35 7.5E-06   28.0   1.2   31   56-87     74-104 (214)
 78 PF02892 zf-BED:  BED zinc fing  87.5    0.74 1.6E-05   19.4   2.0   22   61-82     17-42  (45)
 79 PF06524 NOA36:  NOA36 protein;  85.8    0.41   9E-06   28.5   1.0   77    3-81    137-230 (314)
 80 PHA00626 hypothetical protein   85.8    0.66 1.4E-05   20.9   1.4   11   31-41     23-33  (59)
 81 KOG2893|consensus               85.5     0.2 4.4E-06   29.4  -0.4   28   37-69     16-43  (341)
 82 PF05191 ADK_lid:  Adenylate ki  85.0    0.82 1.8E-05   18.6   1.4   29    9-40      2-30  (36)
 83 KOG2893|consensus               85.0     0.2 4.4E-06   29.4  -0.5   42   10-51     12-54  (341)
 84 TIGR02300 FYDLN_acid conserved  84.3    0.82 1.8E-05   24.3   1.5   31    9-45     10-40  (129)
 85 PF03604 DNA_RNApol_7kD:  DNA d  84.0    0.45 9.8E-06   18.9   0.4    9   61-69     18-26  (32)
 86 smart00734 ZnF_Rad18 Rad18-lik  83.9     1.3 2.9E-05   16.6   1.7   20   61-81      2-21  (26)
 87 PF07754 DUF1610:  Domain of un  81.2     1.7 3.8E-05   16.0   1.5   10    7-16     15-24  (24)
 88 KOG4173|consensus               79.6    0.43 9.4E-06   27.5  -0.5   78    7-84     78-170 (253)
 89 PTZ00255 60S ribosomal protein  79.6    0.71 1.5E-05   23.0   0.3   11   61-71     55-65  (90)
 90 TIGR01206 lysW lysine biosynth  79.2     1.4   3E-05   19.8   1.2   30    9-41      3-32  (54)
 91 PF10276 zf-CHCC:  Zinc-finger   79.0     1.9   4E-05   18.1   1.4   12    7-18     28-39  (40)
 92 PF14311 DUF4379:  Domain of un  78.8     2.9 6.2E-05   18.5   2.1   15   61-75     29-43  (55)
 93 KOG2593|consensus               78.6       1 2.2E-05   28.8   0.8   33    7-39    127-161 (436)
 94 PF12760 Zn_Tnp_IS1595:  Transp  77.9     1.6 3.6E-05   18.6   1.2    8    9-16     19-26  (46)
 95 COG1996 RPC10 DNA-directed RNA  77.6     1.5 3.3E-05   19.2   1.0   11   31-41      6-16  (49)
 96 PF13451 zf-trcl:  Probable zin  77.6    0.81 1.8E-05   20.1   0.1   15   30-44      3-17  (49)
 97 KOG4167|consensus               75.6    0.69 1.5E-05   31.6  -0.5   24   61-84    793-816 (907)
 98 COG0068 HypF Hydrogenase matur  75.0     2.2 4.9E-05   29.2   1.6   52   11-69    126-182 (750)
 99 COG4957 Predicted transcriptio  75.0     1.8   4E-05   23.2   1.1   25   61-88     77-101 (148)
100 PF01780 Ribosomal_L37ae:  Ribo  74.7    0.95 2.1E-05   22.6  -0.0   11   61-71     54-64  (90)
101 PF10083 DUF2321:  Uncharacteri  74.6     2.4 5.1E-05   23.4   1.4   36   10-45     41-82  (158)
102 KOG1146|consensus               73.6     2.3   5E-05   31.2   1.5   76    9-85   1261-1353(1406)
103 COG3364 Zn-ribbon containing p  73.5     1.2 2.7E-05   22.7   0.2   16    8-23      2-17  (112)
104 KOG3408|consensus               72.9     2.6 5.6E-05   22.3   1.3   26   56-82     54-79  (129)
105 COG4888 Uncharacterized Zn rib  72.6     2.1 4.6E-05   21.8   0.9   38    6-43     20-58  (104)
106 TIGR00280 L37a ribosomal prote  72.3     1.2 2.7E-05   22.2   0.0   11   61-71     54-64  (91)
107 COG3677 Transposase and inacti  72.1     2.8   6E-05   22.4   1.3   16   29-44     51-66  (129)
108 COG3357 Predicted transcriptio  71.6       3 6.4E-05   20.9   1.3   13   31-43     58-70  (97)
109 PRK04023 DNA polymerase II lar  69.9     7.3 0.00016   28.1   3.1   10    8-17    626-635 (1121)
110 PF08274 PhnA_Zn_Ribbon:  PhnA   68.5     3.6 7.9E-05   16.0   1.0    8   61-68     20-27  (30)
111 PF05129 Elf1:  Transcription e  68.0     1.8 3.9E-05   21.1   0.1    9    7-15     21-29  (81)
112 PF09845 DUF2072:  Zn-ribbon co  66.2       3 6.6E-05   22.3   0.7   15    8-22      1-15  (131)
113 smart00154 ZnF_AN1 AN1-like Zi  66.2     3.9 8.4E-05   16.9   0.9   16    8-23     12-27  (39)
114 PF00301 Rubredoxin:  Rubredoxi  64.3     8.1 0.00018   16.8   1.8    9    9-17      2-10  (47)
115 PRK03976 rpl37ae 50S ribosomal  63.5     2.2 4.8E-05   21.3  -0.1   11   61-71     55-65  (90)
116 PRK09678 DNA-binding transcrip  63.4     3.4 7.4E-05   19.7   0.5   37    9-45      2-43  (72)
117 PF13453 zf-TFIIB:  Transcripti  63.2     4.7  0.0001   16.7   0.9   15   33-47     21-35  (41)
118 PF07975 C1_4:  TFIIH C1-like d  62.9     3.8 8.2E-05   18.2   0.6   26   29-54     19-44  (51)
119 smart00731 SprT SprT homologue  62.4     7.3 0.00016   21.0   1.8   32   31-70    112-143 (146)
120 PF15269 zf-C2H2_7:  Zinc-finge  62.3     7.3 0.00016   16.8   1.4   21   61-81     21-41  (54)
121 PF14446 Prok-RING_1:  Prokaryo  61.6     4.5 9.7E-05   18.2   0.7   14   10-23      7-20  (54)
122 KOG0782|consensus               61.6     1.8 3.9E-05   29.1  -0.7   36   10-45    255-290 (1004)
123 PF08271 TF_Zn_Ribbon:  TFIIB z  61.0     5.3 0.00012   16.7   0.9   28    9-40      1-28  (43)
124 COG1571 Predicted DNA-binding   61.0     6.1 0.00013   25.5   1.5   30   10-45    352-381 (421)
125 PF05290 Baculo_IE-1:  Baculovi  60.5     8.7 0.00019   20.7   1.8   57    5-75     77-136 (140)
126 PF10263 SprT-like:  SprT-like   60.4     5.8 0.00012   21.4   1.2   31   31-70    123-153 (157)
127 PF01428 zf-AN1:  AN1-like Zinc  59.8     4.5 9.7E-05   17.0   0.5   17    7-23     12-28  (43)
128 COG3091 SprT Zn-dependent meta  59.3     4.3 9.4E-05   22.3   0.6   29   61-94    118-146 (156)
129 PF01363 FYVE:  FYVE zinc finge  58.8     5.8 0.00013   18.3   0.9   30    8-44      9-38  (69)
130 COG5048 FOG: Zn-finger [Genera  58.4     9.5 0.00021   23.7   2.0   59   29-88     31-91  (467)
131 PF08790 zf-LYAR:  LYAR-type C2  58.0     4.5 9.7E-05   15.6   0.4    9   33-41      2-10  (28)
132 PRK12380 hydrogenase nickel in  57.8     8.3 0.00018   20.0   1.4   11   31-41     70-80  (113)
133 PF07295 DUF1451:  Protein of u  57.4     6.8 0.00015   21.4   1.1    9   31-39    112-120 (146)
134 PF01155 HypA:  Hydrogenase exp  56.6     7.4 0.00016   20.1   1.1   11   32-42     71-81  (113)
135 COG1198 PriA Primosomal protei  55.6     9.6 0.00021   26.5   1.8   11   29-39    473-483 (730)
136 PLN02294 cytochrome c oxidase   55.2     7.5 0.00016   21.9   1.0   15    6-20    139-153 (174)
137 PF04423 Rad50_zn_hook:  Rad50   54.6     5.8 0.00013   17.5   0.5   12   10-21     22-33  (54)
138 PF02748 PyrI_C:  Aspartate car  54.0     4.9 0.00011   17.8   0.2   15    5-19     32-46  (52)
139 KOG4167|consensus               53.5     3.5 7.5E-05   28.5  -0.4   26   30-55    791-816 (907)
140 PF14353 CpXC:  CpXC protein     53.4     8.8 0.00019   20.1   1.1   19    7-25     37-55  (128)
141 COG1675 TFA1 Transcription ini  53.0     8.7 0.00019   21.8   1.1    9   61-69    133-141 (176)
142 PF05180 zf-DNL:  DNL zinc fing  52.7     5.8 0.00013   18.6   0.3   34   32-69      5-38  (66)
143 PRK03824 hypA hydrogenase nick  52.7      12 0.00026   20.1   1.6   15    7-21     69-83  (135)
144 smart00440 ZnF_C2C2 C2C2 Zinc   51.9      13 0.00028   15.4   1.3    9   61-69     29-37  (40)
145 TIGR00100 hypA hydrogenase nic  51.5      13 0.00027   19.4   1.5   13   31-43     70-82  (115)
146 PF08394 Arc_trans_TRASH:  Arch  51.4       5 0.00011   16.5   0.0    9   11-19      1-9   (37)
147 PRK04351 hypothetical protein;  51.2      14  0.0003   20.3   1.7   32   31-71    112-143 (149)
148 PF01286 XPA_N:  XPA protein N-  51.1     9.4  0.0002   15.4   0.8   16   10-25      5-20  (34)
149 PRK14892 putative transcriptio  51.0      18 0.00039   18.5   1.9   34    7-42     20-53  (99)
150 KOG3507|consensus               50.7      19 0.00042   16.5   1.8   12   61-72     38-49  (62)
151 PF06397 Desulfoferrod_N:  Desu  49.5      11 0.00025   15.4   0.9   12    7-18      5-16  (36)
152 PF12773 DZR:  Double zinc ribb  49.4      17 0.00036   15.5   1.5    9   61-69     30-38  (50)
153 PF11789 zf-Nse:  Zinc-finger o  49.2     9.5 0.00021   17.2   0.7   15   31-45     24-38  (57)
154 COG2879 Uncharacterized small   49.1      21 0.00045   16.6   1.8   19   72-90     24-42  (65)
155 cd00065 FYVE FYVE domain; Zinc  48.5      12 0.00026   16.3   1.1   27   10-43      4-30  (57)
156 COG4391 Uncharacterized protei  48.4     8.9 0.00019   17.7   0.6   12    8-19     48-59  (62)
157 cd00924 Cyt_c_Oxidase_Vb Cytoc  47.7     9.1  0.0002   19.4   0.6   22   48-71     69-90  (97)
158 PRK00432 30S ribosomal protein  47.1      13 0.00029   16.3   1.0    9   61-69     38-46  (50)
159 PF09963 DUF2197:  Uncharacteri  46.6     5.4 0.00012   18.1  -0.3    6   61-66     32-37  (56)
160 PF01927 Mut7-C:  Mut7-C RNAse   46.4      12 0.00026   20.3   1.0   16   61-76    125-140 (147)
161 smart00661 RPOL9 RNA polymeras  46.2      18 0.00039   15.5   1.4   11   31-41     20-30  (52)
162 PF10013 DUF2256:  Uncharacteri  45.0      18 0.00038   15.4   1.2   12   10-21     10-21  (42)
163 PRK00564 hypA hydrogenase nick  44.4      17 0.00036   19.0   1.3   12   31-42     71-82  (117)
164 TIGR00622 ssl1 transcription f  44.4      26 0.00057   18.3   2.0   74    8-84     15-105 (112)
165 TIGR03831 YgiT_finger YgiT-typ  44.0      14  0.0003   15.2   0.9   12    8-19     32-43  (46)
166 PF07282 OrfB_Zn_ribbon:  Putat  43.9      17 0.00037   16.7   1.2   11   61-71     47-57  (69)
167 smart00064 FYVE Protein presen  43.5      17 0.00038   16.6   1.2   29    8-43     10-38  (68)
168 PRK03681 hypA hydrogenase nick  43.1      19 0.00041   18.7   1.4   11   31-41     70-80  (114)
169 COG4530 Uncharacterized protei  42.9      13 0.00027   19.4   0.7   29    9-43     10-38  (129)
170 KOG2482|consensus               41.4      17 0.00037   23.0   1.2   22   61-82    196-217 (423)
171 PTZ00043 cytochrome c oxidase   40.5      15 0.00032   21.8   0.8   18    5-22    178-195 (268)
172 PF07649 C1_3:  C1-like domain;  40.4      18 0.00038   13.7   0.8    6   61-66     16-21  (30)
173 PF10537 WAC_Acf1_DNA_bd:  ATP-  40.0      36 0.00078   17.4   2.1   33    7-39      2-38  (102)
174 smart00132 LIM Zinc-binding do  39.6      22 0.00047   13.7   1.1    7   61-67     28-34  (39)
175 COG1773 Rubredoxin [Energy pro  39.4      16 0.00036   16.5   0.7   12    8-19      3-14  (55)
176 PRK12496 hypothetical protein;  39.2      27 0.00059   19.4   1.7   10   32-41    128-137 (164)
177 PF13878 zf-C2H2_3:  zinc-finge  39.1      35 0.00075   14.2   2.1   23   61-83     14-38  (41)
178 COG1655 Uncharacterized protei  37.7     7.2 0.00016   23.1  -0.7    9   61-69     63-71  (267)
179 KOG2932|consensus               37.7      50  0.0011   20.8   2.7   73    4-84     86-171 (389)
180 PRK05978 hypothetical protein;  37.2      29 0.00062   19.1   1.5    6   11-16     36-41  (148)
181 PF12907 zf-met2:  Zinc-binding  37.2      17 0.00036   15.3   0.5   22   61-82      2-26  (40)
182 TIGR00319 desulf_FeS4 desulfof  36.6      27 0.00059   13.6   1.1   13    6-18      5-17  (34)
183 cd00974 DSRD Desulforedoxin (D  36.6      27 0.00059   13.6   1.1   12    7-18      3-14  (34)
184 PF02176 zf-TRAF:  TRAF-type zi  36.3      24 0.00053   15.5   1.1   27   44-71     23-53  (60)
185 KOG2071|consensus               35.9      27 0.00059   23.7   1.5   24   61-84    419-442 (579)
186 TIGR00143 hypF [NiFe] hydrogen  35.5      29 0.00063   24.2   1.7   53   11-70     93-150 (711)
187 PF11494 Ta0938:  Ta0938;  Inte  35.4      24 0.00052   18.0   1.0   38    5-42     11-48  (105)
188 PF01215 COX5B:  Cytochrome c o  35.1      19 0.00042   19.5   0.7   13    7-19    111-123 (136)
189 PF09151 DUF1936:  Domain of un  35.0      14  0.0003   14.5   0.1    9    9-17      2-10  (36)
190 KOG2636|consensus               34.3      25 0.00055   23.1   1.2   27   26-52    396-423 (497)
191 PRK03564 formate dehydrogenase  34.1      45 0.00098   20.8   2.2   11    7-17    186-196 (309)
192 PRK11823 DNA repair protein Ra  33.9      44 0.00096   21.8   2.2   15    6-20      5-19  (446)
193 PF13240 zinc_ribbon_2:  zinc-r  33.8      28  0.0006   12.5   0.8    7   11-17      2-8   (23)
194 PRK11032 hypothetical protein;  33.4      43 0.00092   18.8   1.8    8   31-38    124-131 (160)
195 PF04641 Rtf2:  Rtf2 RING-finge  33.4      32 0.00069   20.7   1.5   18    5-22    110-127 (260)
196 PF14255 Cys_rich_CPXG:  Cystei  32.6      23  0.0005   15.8   0.6   13   10-22      2-14  (52)
197 PF06689 zf-C4_ClpX:  ClpX C4-t  32.4      11 0.00023   15.7  -0.4   28   10-37      3-30  (41)
198 KOG2785|consensus               32.3      68  0.0015   20.7   2.7   51   31-82    166-242 (390)
199 PF03811 Zn_Tnp_IS1:  InsA N-te  32.3      45 0.00098   13.5   1.6    6   61-66     30-35  (36)
200 KOG0978|consensus               32.3      13 0.00027   25.8  -0.3   16   61-76    679-694 (698)
201 PF04810 zf-Sec23_Sec24:  Sec23  32.1      42 0.00092   13.7   1.4    8   31-38     24-31  (40)
202 PF15135 UPF0515:  Uncharacteri  32.1      37  0.0008   20.6   1.5   11    5-15    109-119 (278)
203 PRK05452 anaerobic nitric oxid  31.8      55  0.0012   21.7   2.4   14   29-42    423-436 (479)
204 TIGR00627 tfb4 transcription f  31.8      37  0.0008   20.8   1.6   12   30-41    254-265 (279)
205 PF04780 DUF629:  Protein of un  31.3      52  0.0011   21.9   2.2   23   61-83     58-80  (466)
206 PF00412 LIM:  LIM domain;  Int  30.9      28 0.00061   15.0   0.8   13   30-42     25-37  (58)
207 PTZ00448 hypothetical protein;  30.6      40 0.00087   21.6   1.6   22   61-82    315-336 (373)
208 PF05741 zf-nanos:  Nanos RNA b  30.5      21 0.00047   16.1   0.3   11    7-17     32-42  (55)
209 PF08209 Sgf11:  Sgf11 (transcr  30.5      36 0.00079   13.5   1.0   22   60-82      4-25  (33)
210 TIGR03829 YokU_near_AblA uncha  30.3      25 0.00055   17.6   0.6   16    9-24     36-51  (89)
211 cd01121 Sms Sms (bacterial rad  30.3      30 0.00066   22.0   1.1    9    9-17      1-9   (372)
212 PHA02998 RNA polymerase subuni  30.0      40 0.00086   19.3   1.4   38   32-73    144-184 (195)
213 PRK12722 transcriptional activ  29.8      52  0.0011   19.0   1.8   10   33-42    136-145 (187)
214 PRK00420 hypothetical protein;  29.7      37  0.0008   17.8   1.2    8   32-39     41-48  (112)
215 KOG1842|consensus               29.4      32  0.0007   22.7   1.1   21   61-81     16-36  (505)
216 TIGR01562 FdhE formate dehydro  29.3      59  0.0013   20.3   2.1   10    8-17    184-193 (305)
217 PRK00762 hypA hydrogenase nick  29.3      50  0.0011   17.5   1.7   14   30-44     69-82  (124)
218 COG4338 Uncharacterized protei  29.2      15 0.00033   16.1  -0.3   13   10-22     14-26  (54)
219 TIGR00416 sms DNA repair prote  29.0      40 0.00087   22.1   1.5   23    7-38      6-28  (454)
220 COG4306 Uncharacterized protei  28.9      46   0.001   17.9   1.4   15   30-44     67-81  (160)
221 COG5112 UFD2 U1-like Zn-finger  28.9      20 0.00044   18.6   0.1   21   61-81     56-76  (126)
222 KOG0562|consensus               28.8      52  0.0011   18.7   1.7   24   61-84    154-177 (184)
223 PF02150 RNA_POL_M_15KD:  RNA p  28.7      17 0.00038   14.5  -0.1    8   33-40     22-29  (35)
224 COG2331 Uncharacterized protei  28.4      25 0.00055   17.1   0.4   28    9-39     13-41  (82)
225 PF14690 zf-ISL3:  zinc-finger   27.7      28 0.00061   14.5   0.5    9    8-16      2-10  (47)
226 COG4847 Uncharacterized protei  27.7      24 0.00053   17.9   0.3   30    5-34      3-34  (103)
227 PF08792 A2L_zn_ribbon:  A2L zi  27.6      53  0.0012   13.0   1.2    7    9-15      4-10  (33)
228 PF11672 DUF3268:  Protein of u  27.6      27 0.00059   17.9   0.5   12   30-41      1-12  (102)
229 KOG3214|consensus               27.3      43 0.00093   17.2   1.1   11   33-43     49-59  (109)
230 PF01096 TFIIS_C:  Transcriptio  26.8      33 0.00071   14.0   0.6   11    8-18     28-38  (39)
231 PRK01343 zinc-binding protein;  26.6      57  0.0012   14.9   1.3   13    7-19      8-20  (57)
232 COG1066 Sms Predicted ATP-depe  26.4      71  0.0015   21.1   2.1   16    7-22      6-21  (456)
233 PRK12860 transcriptional activ  25.9      82  0.0018   18.2   2.2    9   33-41    136-144 (189)
234 TIGR00595 priA primosomal prot  25.8      56  0.0012   21.8   1.7   12   28-39    250-261 (505)
235 PF11023 DUF2614:  Protein of u  25.8      56  0.0012   17.2   1.4    8   31-38     69-76  (114)
236 KOG4124|consensus               25.8      23 0.00049   22.6  -0.0   19    7-25    348-368 (442)
237 KOG4477|consensus               25.8      36 0.00077   19.6   0.7   10    5-14     21-30  (228)
238 PF04606 Ogr_Delta:  Ogr/Delta-  25.4      16 0.00035   15.6  -0.5    6   66-71     33-38  (47)
239 PF13639 zf-RING_2:  Ring finge  24.7      68  0.0015   13.1   1.8   27   61-94     17-43  (44)
240 PF02591 DUF164:  Putative zinc  24.7      32  0.0007   15.2   0.4   32   33-69     24-55  (56)
241 PF12156 ATPase-cat_bd:  Putati  24.5      49  0.0011   16.3   1.0   33   10-42      2-37  (88)
242 PF14369 zf-RING_3:  zinc-finge  24.2      41 0.00089   13.5   0.6   10   10-19     23-32  (35)
243 KOG0320|consensus               24.2      23  0.0005   20.2  -0.2   11   61-71    168-178 (187)
244 TIGR00686 phnA alkylphosphonat  24.2      49  0.0011   17.3   1.0   12   31-42     19-30  (109)
245 PLN02748 tRNA dimethylallyltra  23.7      46 0.00099   22.1   1.0   24   30-53    417-441 (468)
246 KOG0717|consensus               23.7      48   0.001   22.1   1.1   22   61-82    293-314 (508)
247 PRK14873 primosome assembly pr  23.5      75  0.0016   22.2   2.0   10    9-18    393-402 (665)
248 cd00730 rubredoxin Rubredoxin;  23.3      40 0.00087   14.8   0.5   11    9-19      2-12  (50)
249 KOG2231|consensus               23.3      90   0.002   21.9   2.3   23   33-55    184-206 (669)
250 COG5236 Uncharacterized conser  23.0      66  0.0014   20.6   1.6   23   33-55    222-244 (493)
251 PRK10220 hypothetical protein;  23.0      59  0.0013   17.0   1.2   12   31-42     20-31  (111)
252 PF14803 Nudix_N_2:  Nudix N-te  22.9      67  0.0014   12.8   1.1   13    5-17     19-31  (34)
253 COG1779 C4-type Zn-finger prot  22.6      35 0.00076   19.8   0.3   34    9-42     15-54  (201)
254 PF13824 zf-Mss51:  Zinc-finger  22.4      49  0.0011   15.0   0.7   12    6-17     12-23  (55)
255 PF11331 DUF3133:  Protein of u  22.0      46   0.001   14.4   0.6    6   33-38     33-38  (46)
256 KOG0402|consensus               22.0      26 0.00055   17.3  -0.2   34   27-71     32-65  (92)
257 KOG1280|consensus               21.8   1E+02  0.0022   19.8   2.1   29   61-89     80-108 (381)
258 KOG3352|consensus               21.8      34 0.00073   19.0   0.2   22   49-72    124-145 (153)
259 PRK05580 primosome assembly pr  21.7      73  0.0016   22.2   1.7   13   28-40    418-430 (679)
260 PF10915 DUF2709:  Protein of u  21.7      83  0.0018   18.4   1.7   20    4-23     83-102 (238)
261 PF14447 Prok-RING_4:  Prokaryo  21.3      60  0.0013   14.7   0.9    8   11-18     42-49  (55)
262 PF14787 zf-CCHC_5:  GAG-polypr  20.9      69  0.0015   13.1   0.9   14   10-23      4-17  (36)
263 PF00130 C1_1:  Phorbol esters/  20.6      94   0.002   13.2   1.8   12    7-18     10-21  (53)
264 PF13248 zf-ribbon_3:  zinc-rib  20.4      62  0.0013   11.8   0.7    7   10-16      4-10  (26)
265 KOG4602|consensus               20.3      41 0.00089   20.5   0.3   11    7-17    267-277 (318)

No 1  
>KOG2462|consensus
Probab=99.93  E-value=9.4e-27  Score=131.56  Aligned_cols=88  Identities=20%  Similarity=0.503  Sum_probs=79.6

Q ss_pred             CceeecCCCCccccchhccC-C--CCCCccccccchhhccChHHHHcchhhhcCCCCceeCCCCcccccchhHHHHHHHH
Q psy12011          6 LQVHFCGLFPESFLTWSNLK-P--NLNGMFACDLCDKEYKYKRNLYSHKKDECGQEPRFQCPQCSYRTKRKGNLKSHLAI   82 (94)
Q Consensus         6 ~~~~~c~~c~~~~~~~~~l~-~--~~~k~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~   82 (94)
                      .+.+.|++|||.|...-.|+ |  +..-+++|.+||+.|..+..|+.|+++|+||+| |.|..|+++|.-++||+.|++|
T Consensus       159 ~ka~~C~~C~K~YvSmpALkMHirTH~l~c~C~iCGKaFSRPWLLQGHiRTHTGEKP-F~C~hC~kAFADRSNLRAHmQT  237 (279)
T KOG2462|consen  159 KKAFSCKYCGKVYVSMPALKMHIRTHTLPCECGICGKAFSRPWLLQGHIRTHTGEKP-FSCPHCGKAFADRSNLRAHMQT  237 (279)
T ss_pred             cccccCCCCCceeeehHHHhhHhhccCCCcccccccccccchHHhhcccccccCCCC-ccCCcccchhcchHHHHHHHHh
Confidence            56677888888887777776 2  444689999999999999999999999999999 9999999999999999999999


Q ss_pred             hcCcccCCCCCC
Q psy12011         83 RHECYLDDSANC   94 (94)
Q Consensus        83 ~~~~~~~~c~~C   94 (94)
                      |.+.|.|+|..|
T Consensus       238 HS~~K~~qC~~C  249 (279)
T KOG2462|consen  238 HSDVKKHQCPRC  249 (279)
T ss_pred             hcCCccccCcch
Confidence            999999999987


No 2  
>KOG2462|consensus
Probab=99.82  E-value=6.2e-21  Score=108.22  Aligned_cols=78  Identities=23%  Similarity=0.384  Sum_probs=73.2

Q ss_pred             CCCceeecCCCCccccchhccC-----CCCCCccccccchhhccChHHHHcchhhhcCCCCceeCCCCcccccchhHHHH
Q psy12011          4 QNLQVHFCGLFPESFLTWSNLK-----PNLNGMFACDLCDKEYKYKRNLYSHKKDECGQEPRFQCPQCSYRTKRKGNLKS   78 (94)
Q Consensus         4 ~~~~~~~c~~c~~~~~~~~~l~-----~~~~k~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~   78 (94)
                      +..-+++|..|||.|...+-|+     |+|||||.|..|++.|.+.++|..||++|.+.++ |+|..|+|.|...+-|.+
T Consensus       183 TH~l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~-~qC~~C~KsFsl~SyLnK  261 (279)
T KOG2462|consen  183 THTLPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKK-HQCPRCGKSFALKSYLNK  261 (279)
T ss_pred             ccCCCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCcc-ccCcchhhHHHHHHHHHH
Confidence            4456899999999999999887     8999999999999999999999999999999998 999999999999999999


Q ss_pred             HHHH
Q psy12011         79 HLAI   82 (94)
Q Consensus        79 h~~~   82 (94)
                      |...
T Consensus       262 H~ES  265 (279)
T KOG2462|consen  262 HSES  265 (279)
T ss_pred             hhhh
Confidence            9864


No 3  
>KOG3623|consensus
Probab=99.69  E-value=3.3e-18  Score=107.65  Aligned_cols=78  Identities=27%  Similarity=0.533  Sum_probs=69.1

Q ss_pred             CCCCceeecCCCCccccchhccC-----CCCCCccccccchhhccChHHHHcchhhhcCCCCceeCCCCcccccchhHHH
Q psy12011          3 SQNLQVHFCGLFPESFLTWSNLK-----PNLNGMFACDLCDKEYKYKRNLYSHKKDECGQEPRFQCPQCSYRTKRKGNLK   77 (94)
Q Consensus         3 ~~~~~~~~c~~c~~~~~~~~~l~-----~~~~k~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~   77 (94)
                      .+...+|.|..|+|.|...+.|.     |+|.+||+|.+|.+.|..+..|..|.+.|.|++| |+|..|++.|..+++..
T Consensus       889 kte~gmyaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKP-fQCdKClKRFSHSGSYS  967 (1007)
T KOG3623|consen  889 KTEDGMYACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKP-FQCDKCLKRFSHSGSYS  967 (1007)
T ss_pred             cCccccchHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCc-chhhhhhhhcccccchH
Confidence            45667899999999998877776     8999999999999999999999999999999888 99999999999999888


Q ss_pred             HHHH
Q psy12011         78 SHLA   81 (94)
Q Consensus        78 ~h~~   81 (94)
                      .||-
T Consensus       968 QHMN  971 (1007)
T KOG3623|consen  968 QHMN  971 (1007)
T ss_pred             hhhc
Confidence            8875


No 4  
>KOG3576|consensus
Probab=99.63  E-value=4.1e-17  Score=89.67  Aligned_cols=90  Identities=21%  Similarity=0.404  Sum_probs=76.8

Q ss_pred             CCCceeecCCCCccccchhccC-----CCCCCccccccchhhccChHHHHcchhhhcCCCCceeCCCCcccccchhHHHH
Q psy12011          4 QNLQVHFCGLFPESFLTWSNLK-----PNLNGMFACDLCDKEYKYKRNLYSHKKDECGQEPRFQCPQCSYRTKRKGNLKS   78 (94)
Q Consensus         4 ~~~~~~~c~~c~~~~~~~~~l~-----~~~~k~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~   78 (94)
                      .+...|.|..|+|.|....-|.     |...+-+-|..||+.|.+.-+|.+|+++|+|.+| |+|..|+++|+..-+|..
T Consensus       113 sd~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrp-ykc~~c~kaftqrcsles  191 (267)
T KOG3576|consen  113 SDQDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRP-YKCSLCEKAFTQRCSLES  191 (267)
T ss_pred             CCCCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccc-cchhhhhHHHHhhccHHH
Confidence            3456799999999998777665     6777889999999999999999999999999887 999999999999999999


Q ss_pred             HHHHhcC-----------cccCCCCCC
Q psy12011         79 HLAIRHE-----------CYLDDSANC   94 (94)
Q Consensus        79 h~~~~~~-----------~~~~~c~~C   94 (94)
                      |++.-|+           .|.|.|..|
T Consensus       192 hl~kvhgv~~~yaykerr~kl~vcedc  218 (267)
T KOG3576|consen  192 HLKKVHGVQHQYAYKERRAKLYVCEDC  218 (267)
T ss_pred             HHHHHcCchHHHHHHHhhhheeeeccc
Confidence            9986554           455666655


No 5  
>KOG3623|consensus
Probab=99.56  E-value=1e-15  Score=96.70  Aligned_cols=67  Identities=33%  Similarity=0.635  Sum_probs=63.8

Q ss_pred             CCCCccccccchhhccChHHHHcchhhhcCCCCceeCCCCcccccchhHHHHHHHHhcCcccCCCCCC
Q psy12011         27 NLNGMFACDLCDKEYKYKRNLYSHKKDECGQEPRFQCPQCSYRTKRKGNLKSHLAIRHECYLDDSANC   94 (94)
Q Consensus        27 ~~~k~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~c~~C   94 (94)
                      +.+.+|.|+.|++.|.-.+.|.+|..-|.|.+| |+|.+|.++|..+..|..|+|.|.|||||+|.+|
T Consensus       890 te~gmyaCDqCDK~FqKqSSLaRHKYEHsGqRP-yqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKC  956 (1007)
T KOG3623|consen  890 TEDGMYACDQCDKAFQKQSSLARHKYEHSGQRP-YQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKC  956 (1007)
T ss_pred             CccccchHHHHHHHHHhhHHHHHhhhhhcCCCC-cccchhhHhhhhhhhhhhhhhhccCCCcchhhhh
Confidence            556789999999999999999999999999888 9999999999999999999999999999999988


No 6  
>KOG3576|consensus
Probab=99.44  E-value=1.1e-14  Score=80.16  Aligned_cols=65  Identities=22%  Similarity=0.383  Sum_probs=61.6

Q ss_pred             CCccccccchhhccChHHHHcchhhhcCCCCceeCCCCcccccchhHHHHHHHHhcCcccCCCCCC
Q psy12011         29 NGMFACDLCDKEYKYKRNLYSHKKDECGQEPRFQCPQCSYRTKRKGNLKSHLAIRHECYLDDSANC   94 (94)
Q Consensus        29 ~k~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~c~~C   94 (94)
                      ...+.|.+|++.|.....|.+|++.|...+. +.|.-||+.|.-.-+|++|+++|+|..||+|..|
T Consensus       115 ~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr-~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c  179 (267)
T KOG3576|consen  115 QDSFTCRVCGKKFGLQRMLNRHLKCHSDVKR-HLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLC  179 (267)
T ss_pred             CCeeeeehhhhhhhHHHHHHHHhhhccHHHH-HHHhhccCcccchhhhhhhhccccCccccchhhh
Confidence            4568999999999999999999999999888 9999999999999999999999999999999887


No 7  
>PHA00733 hypothetical protein
Probab=99.32  E-value=1.1e-12  Score=68.66  Aligned_cols=78  Identities=14%  Similarity=0.264  Sum_probs=65.2

Q ss_pred             CceeecCCCCccccchhccC----------CCCCCccccccchhhccChHHHHcchhhhcCCCCceeCCCCcccccchhH
Q psy12011          6 LQVHFCGLFPESFLTWSNLK----------PNLNGMFACDLCDKEYKYKRNLYSHKKDECGQEPRFQCPQCSYRTKRKGN   75 (94)
Q Consensus         6 ~~~~~c~~c~~~~~~~~~l~----------~~~~k~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~   75 (94)
                      .+++.|..|.+.|.....|.          +.++++|.|..|++.|.....|..|++.+  ..+ +.|.+|++.|.....
T Consensus        38 ~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~-~~C~~CgK~F~~~~s  114 (128)
T PHA00733         38 QKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHS-KVCPVCGKEFRNTDS  114 (128)
T ss_pred             hhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcC-ccCCCCCCccCCHHH
Confidence            46678888888777666555          35578999999999999999999999876  345 999999999999999


Q ss_pred             HHHHHHHhcCc
Q psy12011         76 LKSHLAIRHEC   86 (94)
Q Consensus        76 l~~h~~~~~~~   86 (94)
                      |..|+...|+.
T Consensus       115 L~~H~~~~h~~  125 (128)
T PHA00733        115 TLDHVCKKHNI  125 (128)
T ss_pred             HHHHHHHhcCc
Confidence            99999987764


No 8  
>KOG3608|consensus
Probab=99.28  E-value=2.1e-12  Score=76.44  Aligned_cols=89  Identities=24%  Similarity=0.396  Sum_probs=48.5

Q ss_pred             CCCCCceeecCCCCccccchhccC-C------CCCCcc--------------------------ccccchhhccChHHHH
Q psy12011          2 SSQNLQVHFCGLFPESFLTWSNLK-P------NLNGMF--------------------------ACDLCDKEYKYKRNLY   48 (94)
Q Consensus         2 ~~~~~~~~~c~~c~~~~~~~~~l~-~------~~~k~~--------------------------~c~~c~~~~~~~~~l~   48 (94)
                      .|+++|.-.|+.||.-|.+...|- |      ....+|                          +|+.|+-+....+.|.
T Consensus       201 ~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn~ykCplCdmtc~~~ssL~  280 (467)
T KOG3608|consen  201 THSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHVNCYKCPLCDMTCSSASSLT  280 (467)
T ss_pred             hcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhhhcccccccccCCCChHHHH
Confidence            467777778888887777666543 1      112244                          4444444444555555


Q ss_pred             cchhhhcCCCCceeCCCCcccccchhHHHHHHHHhcCcccCCC
Q psy12011         49 SHKKDECGQEPRFQCPQCSYRTKRKGNLKSHLAIRHECYLDDS   91 (94)
Q Consensus        49 ~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~c   91 (94)
                      .|++..+.+..||+|..|++.+...+.|.+|..+|. +..|.|
T Consensus       281 ~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C  322 (467)
T KOG3608|consen  281 THIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS-KTVYQC  322 (467)
T ss_pred             HHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc-ccceec
Confidence            555442222222666666666666666666655554 445555


No 9  
>KOG1074|consensus
Probab=99.17  E-value=6.1e-12  Score=80.87  Aligned_cols=58  Identities=34%  Similarity=0.658  Sum_probs=54.0

Q ss_pred             ccccccchhhccChHHHHcchhhhcCCCCceeCCCCcccccchhHHHHHHHHhcCcccC
Q psy12011         31 MFACDLCDKEYKYKRNLYSHKKDECGQEPRFQCPQCSYRTKRKGNLKSHLAIRHECYLD   89 (94)
Q Consensus        31 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~   89 (94)
                      .++|..|.+.|...+.|+.|++.|+|++| |+|++||..|..+++|+.|...|+...|+
T Consensus       353 khkCr~CakvfgS~SaLqiHlRSHTGERP-fqCnvCG~~FSTkGNLKvH~~rH~e~~p~  410 (958)
T KOG1074|consen  353 KHKCRFCAKVFGSDSALQIHLRSHTGERP-FQCNVCGNRFSTKGNLKVHFQRHREKYPH  410 (958)
T ss_pred             cchhhhhHhhcCchhhhhhhhhccCCCCC-eeecccccccccccceeeeeeeccccCCc
Confidence            46899999999999999999999999998 99999999999999999999998877653


No 10 
>KOG3608|consensus
Probab=99.09  E-value=1.5e-11  Score=72.88  Aligned_cols=85  Identities=22%  Similarity=0.413  Sum_probs=71.0

Q ss_pred             eeecCCCCccccchhccC------CCCCCccccccchhhccChHHHHcchhhhcCCCCceeCCC--CcccccchhHHHHH
Q psy12011          8 VHFCGLFPESFLTWSNLK------PNLNGMFACDLCDKEYKYKRNLYSHKKDECGQEPRFQCPQ--CSYRTKRKGNLKSH   79 (94)
Q Consensus         8 ~~~c~~c~~~~~~~~~l~------~~~~k~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~--c~~~f~~~~~l~~h   79 (94)
                      -|.|+.|+.+....+.|.      |..+||++|+.|+..+...++|.+|...|. +.. |+|..  |...|.....+++|
T Consensus       263 ~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~-y~C~h~~C~~s~r~~~q~~~H  340 (467)
T KOG3608|consen  263 CYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS-KTV-YQCEHPDCHYSVRTYTQMRRH  340 (467)
T ss_pred             cccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc-ccc-eecCCCCCcHHHHHHHHHHHH
Confidence            367888887777777665      788999999999999999999999999887 354 99987  88889999999999


Q ss_pred             HHHhc---CcccCCCCCC
Q psy12011         80 LAIRH---ECYLDDSANC   94 (94)
Q Consensus        80 ~~~~~---~~~~~~c~~C   94 (94)
                      .+.++   ...+|.|..|
T Consensus       341 ~~evhEg~np~~Y~CH~C  358 (467)
T KOG3608|consen  341 FLEVHEGNNPILYACHCC  358 (467)
T ss_pred             HHHhccCCCCCceeeecc
Confidence            99877   3456888766


No 11 
>KOG1074|consensus
Probab=99.09  E-value=3.2e-11  Score=77.73  Aligned_cols=56  Identities=27%  Similarity=0.557  Sum_probs=51.1

Q ss_pred             CccccccchhhccChHHHHcchhhhcCCCCceeCCCCcccccchhHHHHHHHHhcCc
Q psy12011         30 GMFACDLCDKEYKYKRNLYSHKKDECGQEPRFQCPQCSYRTKRKGNLKSHLAIRHEC   86 (94)
Q Consensus        30 k~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~   86 (94)
                      .|.+|.+|.+...-.+.|+.|.++|+|++| |+|.+||++|+.++||+.|+..|-..
T Consensus       604 dPNqCiiC~rVlSC~saLqmHyrtHtGERP-FkCKiCgRAFtTkGNLkaH~~vHka~  659 (958)
T KOG1074|consen  604 DPNQCIICLRVLSCPSALQMHYRTHTGERP-FKCKICGRAFTTKGNLKAHMSVHKAK  659 (958)
T ss_pred             CccceeeeeecccchhhhhhhhhcccCcCc-cccccccchhccccchhhcccccccC
Confidence            478999999999999999999999999888 99999999999999999999887543


No 12 
>PHA02768 hypothetical protein; Provisional
Probab=99.08  E-value=3.7e-11  Score=53.52  Aligned_cols=43  Identities=16%  Similarity=0.510  Sum_probs=35.1

Q ss_pred             ccccccchhhccChHHHHcchhhhcCCCCceeCCCCcccccchhHH
Q psy12011         31 MFACDLCDKEYKYKRNLYSHKKDECGQEPRFQCPQCSYRTKRKGNL   76 (94)
Q Consensus        31 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l   76 (94)
                      .|+|++||+.|...+.|..|++.|.  ++ ++|..|++.|...++|
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~-~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TN-LKLSNCKRISLRTGEY   47 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--Cc-ccCCcccceeccccee
Confidence            4688888888888888888988887  45 8888888888876655


No 13 
>PHA02768 hypothetical protein; Provisional
Probab=99.06  E-value=1.2e-10  Score=51.85  Aligned_cols=32  Identities=22%  Similarity=0.513  Sum_probs=29.2

Q ss_pred             eeCCCCcccccchhHHHHHHHHhcCcccCCCCCC
Q psy12011         61 FQCPQCSYRTKRKGNLKSHLAIRHECYLDDSANC   94 (94)
Q Consensus        61 ~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~c~~C   94 (94)
                      |.|+.||+.|...++|..|+++|+  ++++|.+|
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C   37 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN--TNLKLSNC   37 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC--CcccCCcc
Confidence            899999999999999999999999  67777766


No 14 
>PHA00616 hypothetical protein
Probab=98.96  E-value=3.4e-10  Score=48.21  Aligned_cols=33  Identities=21%  Similarity=0.290  Sum_probs=24.7

Q ss_pred             ceeCCCCcccccchhHHHHHHHHhcCcccCCCC
Q psy12011         60 RFQCPQCSYRTKRKGNLKSHLAIRHECYLDDSA   92 (94)
Q Consensus        60 ~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~c~   92 (94)
                      ||+|..||+.|...++|..|++.||+++++.+.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~   33 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLE   33 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCcccee
Confidence            377777777777777777777777777777653


No 15 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.88  E-value=3e-09  Score=67.15  Aligned_cols=84  Identities=14%  Similarity=0.309  Sum_probs=63.4

Q ss_pred             CceeecCCCCccccchhccC-C--CCCCccccccchhhccChHHHHcchhhhcCCCCceeCCCCcccccc----------
Q psy12011          6 LQVHFCGLFPESFLTWSNLK-P--NLNGMFACDLCDKEYKYKRNLYSHKKDECGQEPRFQCPQCSYRTKR----------   72 (94)
Q Consensus         6 ~~~~~c~~c~~~~~~~~~l~-~--~~~k~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~----------   72 (94)
                      +..+.|+.|++.|. ...|. |  .-.+++.|. |++.+ ....|..|+..+...++ +.|..|+..|..          
T Consensus       451 ~~H~~C~~Cgk~f~-~s~LekH~~~~Hkpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kp-i~C~fC~~~v~~g~~~~d~~d~  526 (567)
T PLN03086        451 KNHVHCEKCGQAFQ-QGEMEKHMKVFHEPLQCP-CGVVL-EKEQMVQHQASTCPLRL-ITCRFCGDMVQAGGSAMDVRDR  526 (567)
T ss_pred             ccCccCCCCCCccc-hHHHHHHHHhcCCCccCC-CCCCc-chhHHHhhhhccCCCCc-eeCCCCCCccccCccccchhhh
Confidence            34567999998885 34454 2  113788898 98655 56788889888888777 999999988842          


Q ss_pred             hhHHHHHHHHhcCcccCCCCCC
Q psy12011         73 KGNLKSHLAIRHECYLDDSANC   94 (94)
Q Consensus        73 ~~~l~~h~~~~~~~~~~~c~~C   94 (94)
                      ...|..|..+. +.+++.|..|
T Consensus       527 ~s~Lt~HE~~C-G~rt~~C~~C  547 (567)
T PLN03086        527 LRGMSEHESIC-GSRTAPCDSC  547 (567)
T ss_pred             hhhHHHHHHhc-CCcceEcccc
Confidence            35788888874 8899999887


No 16 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.78  E-value=1.3e-08  Score=64.36  Aligned_cols=60  Identities=25%  Similarity=0.486  Sum_probs=51.3

Q ss_pred             CCccccccchhhccChHHHHcchhhhcCCCCceeCCCCcccccchhHHHHHHHHhcCcccCCCCCC
Q psy12011         29 NGMFACDLCDKEYKYKRNLYSHKKDECGQEPRFQCPQCSYRTKRKGNLKSHLAIRHECYLDDSANC   94 (94)
Q Consensus        29 ~k~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~c~~C   94 (94)
                      ++++.|..|++.|. ...+..|+..++  .+ +.|+ |+..+ ....|..|+.+|.+.+++.|..|
T Consensus       451 ~~H~~C~~Cgk~f~-~s~LekH~~~~H--kp-v~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC  510 (567)
T PLN03086        451 KNHVHCEKCGQAFQ-QGEMEKHMKVFH--EP-LQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFC  510 (567)
T ss_pred             ccCccCCCCCCccc-hHHHHHHHHhcC--CC-ccCC-CCCCc-chhHHHhhhhccCCCCceeCCCC
Confidence            45678999999996 577899999874  56 9999 99755 66899999999999999999987


No 17 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.77  E-value=5.2e-09  Score=40.16  Aligned_cols=24  Identities=29%  Similarity=0.802  Sum_probs=18.7

Q ss_pred             HHcchhhhcCCCCceeCCCCccccc
Q psy12011         47 LYSHKKDECGQEPRFQCPQCSYRTK   71 (94)
Q Consensus        47 l~~h~~~~~~~~~~~~c~~c~~~f~   71 (94)
                      |..|++.|.++++ |.|+.|++.|.
T Consensus         2 l~~H~~~H~~~k~-~~C~~C~k~F~   25 (26)
T PF13465_consen    2 LRRHMRTHTGEKP-YKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHSSSSS-EEESSSSEEES
T ss_pred             HHHHhhhcCCCCC-CCCCCCcCeeC
Confidence            6678888888777 88888887775


No 18 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.76  E-value=5e-09  Score=40.19  Aligned_cols=20  Identities=20%  Similarity=0.305  Sum_probs=18.8

Q ss_pred             HHHHHHHHhcCcccCCCCCC
Q psy12011         75 NLKSHLAIRHECYLDDSANC   94 (94)
Q Consensus        75 ~l~~h~~~~~~~~~~~c~~C   94 (94)
                      +|.+|+++|++++||.|+.|
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C   20 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYC   20 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSS
T ss_pred             CHHHHhhhcCCCCCCCCCCC
Confidence            58899999999999999998


No 19 
>PHA00733 hypothetical protein
Probab=98.72  E-value=9e-09  Score=54.03  Aligned_cols=55  Identities=20%  Similarity=0.309  Sum_probs=46.1

Q ss_pred             CCCCCceeecCCCCccccchhccC-CCC--CCccccccchhhccChHHHHcchhhhcC
Q psy12011          2 SSQNLQVHFCGLFPESFLTWSNLK-PNL--NGMFACDLCDKEYKYKRNLYSHKKDECG   56 (94)
Q Consensus         2 ~~~~~~~~~c~~c~~~~~~~~~l~-~~~--~k~~~c~~c~~~~~~~~~l~~h~~~~~~   56 (94)
                      .+.+.++|.|+.|++.|...+.|. |..  +.++.|..|++.|.....|..|+...++
T Consensus        67 ~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h~~~~~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         67 TSKAVSPYVCPLCLMPFSSSVSLKQHIRYTEHSKVCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             ccCCCCCccCCCCCCcCCCHHHHHHHHhcCCcCccCCCCCCccCCHHHHHHHHHHhcC
Confidence            345678999999999999999987 322  5689999999999999999999876654


No 20 
>PHA00732 hypothetical protein
Probab=98.58  E-value=3.6e-08  Score=47.59  Aligned_cols=44  Identities=25%  Similarity=0.517  Sum_probs=24.2

Q ss_pred             ccccccchhhccChHHHHcchhh-hcCCCCceeCCCCcccccchhHHHHHHH
Q psy12011         31 MFACDLCDKEYKYKRNLYSHKKD-ECGQEPRFQCPQCSYRTKRKGNLKSHLA   81 (94)
Q Consensus        31 ~~~c~~c~~~~~~~~~l~~h~~~-~~~~~~~~~c~~c~~~f~~~~~l~~h~~   81 (94)
                      ||.|..|++.|.....|..|++. |.   + +.|..|++.|.   .+..|.+
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~-~~C~~CgKsF~---~l~~H~~   45 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---L-TKCPVCNKSYR---RLNQHFY   45 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---C-CccCCCCCEeC---Chhhhhc
Confidence            35566666666666666666553 32   2 45666666665   2344544


No 21 
>PHA00616 hypothetical protein
Probab=98.56  E-value=3.3e-08  Score=42.15  Aligned_cols=34  Identities=18%  Similarity=0.348  Sum_probs=30.8

Q ss_pred             ccccccchhhccChHHHHcchhhhcCCCCceeCCC
Q psy12011         31 MFACDLCDKEYKYKRNLYSHKKDECGQEPRFQCPQ   65 (94)
Q Consensus        31 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~   65 (94)
                      ||+|..||+.|...+.+..|++.++++++ +.+..
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~-~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNK-LTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCc-cceeE
Confidence            68999999999999999999999999888 87754


No 22 
>KOG3993|consensus
Probab=98.42  E-value=2.3e-08  Score=60.79  Aligned_cols=79  Identities=24%  Similarity=0.426  Sum_probs=64.2

Q ss_pred             ceeecCCCCccccchhccC-C----CCCCccccccchhhccChHHHHcchhhhcC--------CCC--------------
Q psy12011          7 QVHFCGLFPESFLTWSNLK-P----NLNGMFACDLCDKEYKYKRNLYSHKKDECG--------QEP--------------   59 (94)
Q Consensus         7 ~~~~c~~c~~~~~~~~~l~-~----~~~k~~~c~~c~~~~~~~~~l~~h~~~~~~--------~~~--------------   59 (94)
                      ..|+|..|...|.+...|. |    .....|+|.+|++.|.-+.+|..|.++|.-        ..+              
T Consensus       266 GdyiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea  345 (500)
T KOG3993|consen  266 GDYICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEA  345 (500)
T ss_pred             HHHHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhc
Confidence            3478888888888877776 3    344579999999999999999999998841        111              


Q ss_pred             ----------ceeCCCCcccccchhHHHHHHHHhcC
Q psy12011         60 ----------RFQCPQCSYRTKRKGNLKSHLAIRHE   85 (94)
Q Consensus        60 ----------~~~c~~c~~~f~~~~~l~~h~~~~~~   85 (94)
                                .|.|..|++.|....-|+.|+.+|+.
T Consensus       346 ~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~  381 (500)
T KOG3993|consen  346 ERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQR  381 (500)
T ss_pred             cccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhc
Confidence                      38999999999999999999988874


No 23 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.38  E-value=4.3e-07  Score=33.60  Aligned_cols=23  Identities=35%  Similarity=0.752  Sum_probs=18.1

Q ss_pred             eeCCCCcccccchhHHHHHHHHh
Q psy12011         61 FQCPQCSYRTKRKGNLKSHLAIR   83 (94)
Q Consensus        61 ~~c~~c~~~f~~~~~l~~h~~~~   83 (94)
                      |.|..|++.|....+|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            57888888888888888888763


No 24 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.22  E-value=1.8e-06  Score=31.94  Aligned_cols=24  Identities=38%  Similarity=0.866  Sum_probs=18.1

Q ss_pred             eeCCCCcccccchhHHHHHHHHhc
Q psy12011         61 FQCPQCSYRTKRKGNLKSHLAIRH   84 (94)
Q Consensus        61 ~~c~~c~~~f~~~~~l~~h~~~~~   84 (94)
                      |.|..|++.|.....|..|+++++
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            578888888888888888888764


No 25 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.21  E-value=1.2e-06  Score=33.71  Aligned_cols=26  Identities=19%  Similarity=0.431  Sum_probs=20.9

Q ss_pred             ceeCCCCcccccchhHHHHHHHHhcC
Q psy12011         60 RFQCPQCSYRTKRKGNLKSHLAIRHE   85 (94)
Q Consensus        60 ~~~c~~c~~~f~~~~~l~~h~~~~~~   85 (94)
                      ||.|..|++.|....+|..|++.|..
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhcC
Confidence            47888888888888888888877653


No 26 
>PHA00732 hypothetical protein
Probab=98.09  E-value=3.6e-06  Score=40.68  Aligned_cols=32  Identities=28%  Similarity=0.529  Sum_probs=27.2

Q ss_pred             ceeCCCCcccccchhHHHHHHHH-hcCcccCCCCCC
Q psy12011         60 RFQCPQCSYRTKRKGNLKSHLAI-RHECYLDDSANC   94 (94)
Q Consensus        60 ~~~c~~c~~~f~~~~~l~~h~~~-~~~~~~~~c~~C   94 (94)
                      ||.|..|++.|....+|..|++. |.+   +.|..|
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~---~~C~~C   33 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL---TKCPVC   33 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC---CccCCC
Confidence            48999999999999999999985 553   578777


No 27 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.08  E-value=8.2e-06  Score=36.61  Aligned_cols=52  Identities=33%  Similarity=0.602  Sum_probs=35.9

Q ss_pred             ccccccchhhccChHHHHcchhh-hcCCCCceeCCCCcccccchhHHHHHHHHhcC
Q psy12011         31 MFACDLCDKEYKYKRNLYSHKKD-ECGQEPRFQCPQCSYRTKRKGNLKSHLAIRHE   85 (94)
Q Consensus        31 ~~~c~~c~~~~~~~~~l~~h~~~-~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~   85 (94)
                      .|.|+.|++. .....|..|... |..+...+.|+.|...+.  .+|..|+...|+
T Consensus         2 ~f~CP~C~~~-~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H~   54 (54)
T PF05605_consen    2 SFTCPYCGKG-FSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQHR   54 (54)
T ss_pred             CcCCCCCCCc-cCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhcC
Confidence            4678888884 455678888665 444333489999987544  488889887763


No 28 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=98.07  E-value=4.9e-06  Score=36.39  Aligned_cols=35  Identities=31%  Similarity=0.498  Sum_probs=23.9

Q ss_pred             hcCCCCceeCCCCcccccchhHHHHHHHHhcCccc
Q psy12011         54 ECGQEPRFQCPQCSYRTKRKGNLKSHLAIRHECYL   88 (94)
Q Consensus        54 ~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~   88 (94)
                      +.....|-.|++|+..+...-+|++|+.+.|+.||
T Consensus        18 ~~~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   18 KSQSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             CCTTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             hhccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            33334448999999999999999999999888876


No 29 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.00  E-value=2.7e-06  Score=31.36  Aligned_cols=23  Identities=30%  Similarity=0.761  Sum_probs=19.2

Q ss_pred             cccccchhhccChHHHHcchhhh
Q psy12011         32 FACDLCDKEYKYKRNLYSHKKDE   54 (94)
Q Consensus        32 ~~c~~c~~~~~~~~~l~~h~~~~   54 (94)
                      |+|..|++.|.....|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            57888999999999999888763


No 30 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.82  E-value=9e-06  Score=31.14  Aligned_cols=26  Identities=35%  Similarity=0.775  Sum_probs=22.1

Q ss_pred             ccccccchhhccChHHHHcchhhhcC
Q psy12011         31 MFACDLCDKEYKYKRNLYSHKKDECG   56 (94)
Q Consensus        31 ~~~c~~c~~~~~~~~~l~~h~~~~~~   56 (94)
                      +|+|..|++.|.....|..|++.|..
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhcC
Confidence            57899999999999999999887643


No 31 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.66  E-value=5.3e-05  Score=37.75  Aligned_cols=72  Identities=21%  Similarity=0.384  Sum_probs=21.5

Q ss_pred             ecCCCCccccchhccCCCCCCcccccc-chhhccChHHHHcchhhhcCCCCceeCCCCcccccchhHHHHHHHHh
Q psy12011         10 FCGLFPESFLTWSNLKPNLNGMFACDL-CDKEYKYKRNLYSHKKDECGQEPRFQCPQCSYRTKRKGNLKSHLAIR   83 (94)
Q Consensus        10 ~c~~c~~~~~~~~~l~~~~~k~~~c~~-c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~   83 (94)
                      .|..|+..|.....|..+-...+.-.. ....+.....+..+...... .. +.|..|++.|.....|..|++.+
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~~~l~~~~~~~~~~~~~~~-~~-~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIPDQKYLVDPNRLLNYLRKKVK-ES-FRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             -------------------------------------------------SS-EEBSSSS-EESSHHHHHHHHHHT
T ss_pred             CccccccccccccccccccccccccccccccccccccccccccccccC-CC-CCCCccCCCCcCHHHHHHHHcCc
Confidence            377888888887777622222221111 11112222333333332222 34 99999999999999999999975


No 32 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.66  E-value=5.6e-05  Score=28.15  Aligned_cols=24  Identities=33%  Similarity=0.751  Sum_probs=16.2

Q ss_pred             eeCCCCcccccchhHHHHHHHHhc
Q psy12011         61 FQCPQCSYRTKRKGNLKSHLAIRH   84 (94)
Q Consensus        61 ~~c~~c~~~f~~~~~l~~h~~~~~   84 (94)
                      |.|..|++.|.....|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            356777777777777777776543


No 33 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.60  E-value=3.4e-05  Score=28.31  Aligned_cols=23  Identities=30%  Similarity=0.801  Sum_probs=17.7

Q ss_pred             cccccchhhccChHHHHcchhhh
Q psy12011         32 FACDLCDKEYKYKRNLYSHKKDE   54 (94)
Q Consensus        32 ~~c~~c~~~~~~~~~l~~h~~~~   54 (94)
                      |.|+.|++.|.....|..|+..+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            57888999999999999888765


No 34 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.58  E-value=0.0001  Score=27.34  Aligned_cols=24  Identities=54%  Similarity=1.089  Sum_probs=17.9

Q ss_pred             eeCCCCcccccchhHHHHHHHHhcC
Q psy12011         61 FQCPQCSYRTKRKGNLKSHLAIRHE   85 (94)
Q Consensus        61 ~~c~~c~~~f~~~~~l~~h~~~~~~   85 (94)
                      |+|+.|+.... ...|..|++.+++
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhCc
Confidence            67888987777 7789999988764


No 35 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.48  E-value=4e-05  Score=45.76  Aligned_cols=24  Identities=33%  Similarity=0.686  Sum_probs=19.4

Q ss_pred             CCCceeCCCCcccccchhHHHHHHH
Q psy12011         57 QEPRFQCPQCSYRTKRKGNLKSHLA   81 (94)
Q Consensus        57 ~~~~~~c~~c~~~f~~~~~l~~h~~   81 (94)
                      .+| |+|.+|++.+.....|+.|..
T Consensus       396 ~KP-YrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         396 DKP-YRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             CCc-eeccccchhhccCccceeccc
Confidence            366 999999999988888877754


No 36 
>PRK04860 hypothetical protein; Provisional
Probab=97.44  E-value=0.00013  Score=39.83  Aligned_cols=31  Identities=13%  Similarity=0.390  Sum_probs=24.8

Q ss_pred             ceeCCCCcccccchhHHHHHHHHhcCcccCCCCCC
Q psy12011         60 RFQCPQCSYRTKRKGNLKSHLAIRHECYLDDSANC   94 (94)
Q Consensus        60 ~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~c~~C   94 (94)
                      +|.|. |+.   ....+++|.+++.++++|.|..|
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C  149 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRC  149 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCC
Confidence            38887 876   66677888888888888888877


No 37 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.22  E-value=0.00065  Score=30.38  Aligned_cols=33  Identities=24%  Similarity=0.410  Sum_probs=26.3

Q ss_pred             eeCCCCcccccchhHHHHHHHHhcC--cccCCCCCC
Q psy12011         61 FQCPQCSYRTKRKGNLKSHLAIRHE--CYLDDSANC   94 (94)
Q Consensus        61 ~~c~~c~~~f~~~~~l~~h~~~~~~--~~~~~c~~C   94 (94)
                      |.|+.|++. .....|..|....|.  .+.+.|++|
T Consensus         3 f~CP~C~~~-~~~~~L~~H~~~~H~~~~~~v~CPiC   37 (54)
T PF05605_consen    3 FTCPYCGKG-FSESSLVEHCEDEHRSESKNVVCPIC   37 (54)
T ss_pred             cCCCCCCCc-cCHHHHHHHHHhHCcCCCCCccCCCc
Confidence            899999994 556789999887654  357899987


No 38 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.18  E-value=0.00028  Score=26.12  Aligned_cols=24  Identities=29%  Similarity=0.613  Sum_probs=20.2

Q ss_pred             cccccchhhccChHHHHcchhhhc
Q psy12011         32 FACDLCDKEYKYKRNLYSHKKDEC   55 (94)
Q Consensus        32 ~~c~~c~~~~~~~~~l~~h~~~~~   55 (94)
                      ++|..|++.|.....+..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            478899999999999999988654


No 39 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.14  E-value=0.00045  Score=25.72  Aligned_cols=22  Identities=27%  Similarity=0.591  Sum_probs=15.3

Q ss_pred             eeCCCCcccccchhHHHHHHHH
Q psy12011         61 FQCPQCSYRTKRKGNLKSHLAI   82 (94)
Q Consensus        61 ~~c~~c~~~f~~~~~l~~h~~~   82 (94)
                      |.|..|++.|.....+..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            4567777777777777777664


No 40 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.11  E-value=0.00041  Score=30.46  Aligned_cols=34  Identities=21%  Similarity=0.336  Sum_probs=24.3

Q ss_pred             CCCCCccccccchhhccChHHHHcchhhhcCCCC
Q psy12011         26 PNLNGMFACDLCDKEYKYKRNLYSHKKDECGQEP   59 (94)
Q Consensus        26 ~~~~k~~~c~~c~~~~~~~~~l~~h~~~~~~~~~   59 (94)
                      ...+.|..|++|+..+....+|..|+...++.++
T Consensus        19 ~~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   19 SQSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             CTTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             hccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            4556788999999999999999999988887665


No 41 
>KOG3993|consensus
Probab=97.07  E-value=0.00015  Score=44.90  Aligned_cols=53  Identities=25%  Similarity=0.501  Sum_probs=46.3

Q ss_pred             ccccccchhhccChHHHHcchhhhcCCCCceeCCCCcccccchhHHHHHHHHhc
Q psy12011         31 MFACDLCDKEYKYKRNLYSHKKDECGQEPRFQCPQCSYRTKRKGNLKSHLAIRH   84 (94)
Q Consensus        31 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~   84 (94)
                      -|.|.+|...|.+.-.|.+|.-..+.... |+|++|+|.|+=..||-.|.|=|-
T Consensus       267 dyiCqLCK~kYeD~F~LAQHrC~RIV~vE-YrCPEC~KVFsCPANLASHRRWHK  319 (500)
T KOG3993|consen  267 DYICQLCKEKYEDAFALAQHRCPRIVHVE-YRCPECDKVFSCPANLASHRRWHK  319 (500)
T ss_pred             HHHHHHHHHhhhhHHHHhhccCCeeEEee-ecCCcccccccCchhhhhhhcccC
Confidence            47899999999999999999877666666 999999999999999999987553


No 42 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.90  E-value=0.00044  Score=25.73  Aligned_cols=23  Identities=30%  Similarity=0.830  Sum_probs=19.1

Q ss_pred             cccccchhhccChHHHHcchhhh
Q psy12011         32 FACDLCDKEYKYKRNLYSHKKDE   54 (94)
Q Consensus        32 ~~c~~c~~~~~~~~~l~~h~~~~   54 (94)
                      |.|.+|++.|.....+..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            56889999999999998887654


No 43 
>PRK04860 hypothetical protein; Provisional
Probab=96.73  E-value=0.00082  Score=36.78  Aligned_cols=38  Identities=18%  Similarity=0.516  Sum_probs=32.0

Q ss_pred             ccccccchhhccChHHHHcchhhhcCCCCceeCCCCcccccch
Q psy12011         31 MFACDLCDKEYKYKRNLYSHKKDECGQEPRFQCPQCSYRTKRK   73 (94)
Q Consensus        31 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~   73 (94)
                      +|.|. |+.   ....+..|.+++.++++ |.|..|+..|...
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~-YrC~~C~~~l~~~  156 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAV-YRCRRCGETLVFK  156 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCcc-EECCCCCceeEEe
Confidence            68897 886   56667899999999888 9999999888654


No 44 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.72  E-value=0.0013  Score=25.00  Aligned_cols=21  Identities=43%  Similarity=0.823  Sum_probs=12.5

Q ss_pred             cccccchhhccChHHHHcchh
Q psy12011         32 FACDLCDKEYKYKRNLYSHKK   52 (94)
Q Consensus        32 ~~c~~c~~~~~~~~~l~~h~~   52 (94)
                      |.|..|++.|.....+..|+.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~   22 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMK   22 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTT
T ss_pred             CCcccCCCCcCCHHHHHHHHc
Confidence            446666666666666666554


No 45 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=95.90  E-value=0.0055  Score=37.06  Aligned_cols=37  Identities=24%  Similarity=0.521  Sum_probs=26.9

Q ss_pred             CCCceeCCC--CcccccchhHHHHHHHHh-------------------cCcccCCCCCC
Q psy12011         57 QEPRFQCPQ--CSYRTKRKGNLKSHLAIR-------------------HECYLDDSANC   94 (94)
Q Consensus        57 ~~~~~~c~~--c~~~f~~~~~l~~h~~~~-------------------~~~~~~~c~~C   94 (94)
                      ++| |+|++  |.+.+.....|+.|+..-                   ..+|||.|..|
T Consensus       347 ~Kp-ykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC  404 (423)
T COG5189         347 GKP-YKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVC  404 (423)
T ss_pred             Cce-ecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceecccc
Confidence            355 88876  778888877787777532                   24599999887


No 46 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=95.87  E-value=0.0098  Score=22.26  Aligned_cols=20  Identities=25%  Similarity=0.599  Sum_probs=12.5

Q ss_pred             eeCCCCcccccchhHHHHHHH
Q psy12011         61 FQCPQCSYRTKRKGNLKSHLA   81 (94)
Q Consensus        61 ~~c~~c~~~f~~~~~l~~h~~   81 (94)
                      ..|+.||+.| ....|..|+.
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHH
Confidence            4677777777 4445566654


No 47 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=95.13  E-value=0.017  Score=23.75  Aligned_cols=10  Identities=20%  Similarity=0.574  Sum_probs=5.0

Q ss_pred             eeCCCCcccc
Q psy12011         61 FQCPQCSYRT   70 (94)
Q Consensus        61 ~~c~~c~~~f   70 (94)
                      +.|+.|+..|
T Consensus        26 v~C~~C~~~~   35 (38)
T TIGR02098        26 VRCGKCGHVW   35 (38)
T ss_pred             EECCCCCCEE
Confidence            4555555443


No 48 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=95.01  E-value=0.021  Score=23.34  Aligned_cols=10  Identities=20%  Similarity=0.683  Sum_probs=5.3

Q ss_pred             eeCCCCcccc
Q psy12011         61 FQCPQCSYRT   70 (94)
Q Consensus        61 ~~c~~c~~~f   70 (94)
                      .+|+.|+..|
T Consensus        26 v~C~~C~~~f   35 (36)
T PF13717_consen   26 VRCSKCGHVF   35 (36)
T ss_pred             EECCCCCCEe
Confidence            5555555444


No 49 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=94.93  E-value=0.031  Score=22.29  Aligned_cols=22  Identities=23%  Similarity=0.457  Sum_probs=17.7

Q ss_pred             eeCCCCcccccchhHHHHHHHH
Q psy12011         61 FQCPQCSYRTKRKGNLKSHLAI   82 (94)
Q Consensus        61 ~~c~~c~~~f~~~~~l~~h~~~   82 (94)
                      |.|..|+..|.....+..|+..
T Consensus         4 ~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        4 FYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             eEccccCCccCCHHHHHHHHCh
Confidence            7888888888888888877764


No 50 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=94.60  E-value=0.027  Score=23.15  Aligned_cols=32  Identities=19%  Similarity=0.587  Sum_probs=16.6

Q ss_pred             ccccchhhccChHHHHcchhhhcCCCCceeCCCCcccc
Q psy12011         33 ACDLCDKEYKYKRNLYSHKKDECGQEPRFQCPQCSYRT   70 (94)
Q Consensus        33 ~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f   70 (94)
                      +|+.|+..|..+..-     ...+... .+|+.|+..|
T Consensus         4 ~CP~C~~~f~v~~~~-----l~~~~~~-vrC~~C~~~f   35 (37)
T PF13719_consen    4 TCPNCQTRFRVPDDK-----LPAGGRK-VRCPKCGHVF   35 (37)
T ss_pred             ECCCCCceEEcCHHH-----cccCCcE-EECCCCCcEe
Confidence            456666666555431     1122234 6677666555


No 51 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=94.58  E-value=0.012  Score=36.19  Aligned_cols=61  Identities=21%  Similarity=0.459  Sum_probs=53.3

Q ss_pred             CccccccchhhccChHHHHcchh--hhcCC--CCceeCC--CCcccccchhHHHHHHHHhcCcccCCC
Q psy12011         30 GMFACDLCDKEYKYKRNLYSHKK--DECGQ--EPRFQCP--QCSYRTKRKGNLKSHLAIRHECYLDDS   91 (94)
Q Consensus        30 k~~~c~~c~~~~~~~~~l~~h~~--~~~~~--~~~~~c~--~c~~~f~~~~~l~~h~~~~~~~~~~~c   91 (94)
                      .++.+..|...|.....+..|.+  .|.++  ++ +.|+  .|++.|.....+.+|..+|.+..+..+
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~-~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  354 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKP-FSCPYSLCGKLFSRNDALKRHILLHTSISPAKE  354 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCc-eeeeccCCCccccccccccCCcccccCCCcccc
Confidence            36788899999999999999999  78888  67 9999  799999999999999999988877665


No 52 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=94.28  E-value=0.037  Score=23.39  Aligned_cols=28  Identities=14%  Similarity=0.330  Sum_probs=13.3

Q ss_pred             eecCCCCccccchhccCCCCCCccccccch
Q psy12011          9 HFCGLFPESFLTWSNLKPNLNGMFACDLCD   38 (94)
Q Consensus         9 ~~c~~c~~~~~~~~~l~~~~~k~~~c~~c~   38 (94)
                      |.|..||..|.....+..  .....|+.||
T Consensus         6 y~C~~Cg~~fe~~~~~~~--~~~~~CP~Cg   33 (42)
T PF09723_consen    6 YRCEECGHEFEVLQSISE--DDPVPCPECG   33 (42)
T ss_pred             EEeCCCCCEEEEEEEcCC--CCCCcCCCCC
Confidence            555666655554433222  3344455554


No 53 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=93.98  E-value=0.051  Score=24.71  Aligned_cols=32  Identities=28%  Similarity=0.670  Sum_probs=17.8

Q ss_pred             CccccccchhhccChHHHHcchhhhcCCCCceeCCCCc
Q psy12011         30 GMFACDLCDKEYKYKRNLYSHKKDECGQEPRFQCPQCS   67 (94)
Q Consensus        30 k~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~   67 (94)
                      ..|.|+.||+.......     +...-..+ |.|+.||
T Consensus        26 v~F~CPnCGe~~I~Rc~-----~CRk~g~~-Y~Cp~CG   57 (61)
T COG2888          26 VKFPCPNCGEVEIYRCA-----KCRKLGNP-YRCPKCG   57 (61)
T ss_pred             eEeeCCCCCceeeehhh-----hHHHcCCc-eECCCcC
Confidence            35678888755433321     12222355 8888887


No 54 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=93.02  E-value=0.085  Score=21.81  Aligned_cols=13  Identities=15%  Similarity=0.112  Sum_probs=7.0

Q ss_pred             eecCCCCccccch
Q psy12011          9 HFCGLFPESFLTW   21 (94)
Q Consensus         9 ~~c~~c~~~~~~~   21 (94)
                      |.|+.||..|...
T Consensus         6 y~C~~Cg~~fe~~   18 (41)
T smart00834        6 YRCEDCGHTFEVL   18 (41)
T ss_pred             EEcCCCCCEEEEE
Confidence            5566666555443


No 55 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=92.51  E-value=0.14  Score=28.34  Aligned_cols=8  Identities=25%  Similarity=0.501  Sum_probs=3.9

Q ss_pred             eeecCCCC
Q psy12011          8 VHFCGLFP   15 (94)
Q Consensus         8 ~~~c~~c~   15 (94)
                      .|+|++||
T Consensus       134 ~~vC~vCG  141 (166)
T COG1592         134 VWVCPVCG  141 (166)
T ss_pred             EEEcCCCC
Confidence            45555554


No 56 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=92.34  E-value=0.16  Score=20.22  Aligned_cols=24  Identities=29%  Similarity=0.937  Sum_probs=14.8

Q ss_pred             cccccchhhccChHHHHcchhhhcCCCCceeCCCCcc
Q psy12011         32 FACDLCDKEYKYKRNLYSHKKDECGQEPRFQCPQCSY   68 (94)
Q Consensus        32 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   68 (94)
                      |.|..||..+....            .+ +.|+.|+.
T Consensus         2 ~~C~~CGy~y~~~~------------~~-~~CP~Cg~   25 (33)
T cd00350           2 YVCPVCGYIYDGEE------------AP-WVCPVCGA   25 (33)
T ss_pred             EECCCCCCEECCCc------------CC-CcCcCCCC
Confidence            56778874442211            34 88888874


No 57 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=92.30  E-value=0.12  Score=27.97  Aligned_cols=39  Identities=21%  Similarity=0.586  Sum_probs=20.5

Q ss_pred             CCCccccccchhhccChHHHHcchhhhcCCCCceeCCCCccccc
Q psy12011         28 LNGMFACDLCDKEYKYKRNLYSHKKDECGQEPRFQCPQCSYRTK   71 (94)
Q Consensus        28 ~~k~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~   71 (94)
                      +...|.|+.|+..|.....+.. .  .. ... |.|+.||....
T Consensus        96 ~~~~Y~Cp~C~~~y~~~ea~~~-~--d~-~~~-f~Cp~Cg~~l~  134 (147)
T smart00531       96 NNAYYKCPNCQSKYTFLEANQL-L--DM-DGT-FTCPRCGEELE  134 (147)
T ss_pred             CCcEEECcCCCCEeeHHHHHHh-c--CC-CCc-EECCCCCCEEE
Confidence            3445677777766665433221 0  11 233 77777776543


No 58 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=92.12  E-value=0.13  Score=22.61  Aligned_cols=28  Identities=14%  Similarity=0.354  Sum_probs=13.3

Q ss_pred             eecCCCCccccchhccCCCCCCccccccch
Q psy12011          9 HFCGLFPESFLTWSNLKPNLNGMFACDLCD   38 (94)
Q Consensus         9 ~~c~~c~~~~~~~~~l~~~~~k~~~c~~c~   38 (94)
                      |.|..||..|.....+..  +..-.|+.||
T Consensus         6 y~C~~Cg~~fe~~~~~~~--~~~~~CP~Cg   33 (52)
T TIGR02605         6 YRCTACGHRFEVLQKMSD--DPLATCPECG   33 (52)
T ss_pred             EEeCCCCCEeEEEEecCC--CCCCCCCCCC
Confidence            556666665554322211  2333455555


No 59 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=91.69  E-value=0.16  Score=21.78  Aligned_cols=28  Identities=11%  Similarity=0.019  Sum_probs=13.3

Q ss_pred             eeecCCCCccccchhccCCCCCCccccccchhh
Q psy12011          8 VHFCGLFPESFLTWSNLKPNLNGMFACDLCDKE   40 (94)
Q Consensus         8 ~~~c~~c~~~~~~~~~l~~~~~k~~~c~~c~~~   40 (94)
                      .|.|+.||..|......     ....|+.||..
T Consensus         3 ~y~C~~CG~~~~~~~~~-----~~~~Cp~CG~~   30 (46)
T PRK00398          3 EYKCARCGREVELDEYG-----TGVRCPYCGYR   30 (46)
T ss_pred             EEECCCCCCEEEECCCC-----CceECCCCCCe
Confidence            45666666554432211     14455555543


No 60 
>KOG1146|consensus
Probab=91.68  E-value=0.21  Score=35.87  Aligned_cols=56  Identities=29%  Similarity=0.611  Sum_probs=43.6

Q ss_pred             CCCCCccccccchhhccChHHHHcchhhhc-------------------------CCCCceeCCCCcccccchhHHHHHH
Q psy12011         26 PNLNGMFACDLCDKEYKYKRNLYSHKKDEC-------------------------GQEPRFQCPQCSYRTKRKGNLKSHL   80 (94)
Q Consensus        26 ~~~~k~~~c~~c~~~~~~~~~l~~h~~~~~-------------------------~~~~~~~c~~c~~~f~~~~~l~~h~   80 (94)
                      +.-.+-+.|..|+..|.+...|..|++..+                         +.++ |.|..|...+....+|..|+
T Consensus       460 ~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p-~~C~~C~~stttng~Lsihl  538 (1406)
T KOG1146|consen  460 HSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKP-YPCRACNYSTTTNGNLSIHL  538 (1406)
T ss_pred             ecccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCc-ccceeeeeeeecchHHHHHH
Confidence            344467788888888888888888887611                         2244 89999999999999999999


Q ss_pred             HH
Q psy12011         81 AI   82 (94)
Q Consensus        81 ~~   82 (94)
                      +.
T Consensus       539 qS  540 (1406)
T KOG1146|consen  539 QS  540 (1406)
T ss_pred             HH
Confidence            75


No 61 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=91.65  E-value=0.2  Score=20.15  Aligned_cols=10  Identities=20%  Similarity=0.252  Sum_probs=5.5

Q ss_pred             eeecCCCCcc
Q psy12011          8 VHFCGLFPES   17 (94)
Q Consensus         8 ~~~c~~c~~~   17 (94)
                      .|+|..||-.
T Consensus         2 ~~~C~~CG~i   11 (34)
T cd00729           2 VWVCPVCGYI   11 (34)
T ss_pred             eEECCCCCCE
Confidence            3556666644


No 62 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=91.33  E-value=0.14  Score=25.25  Aligned_cols=25  Identities=24%  Similarity=0.687  Sum_probs=21.6

Q ss_pred             ccccccchhhccChHHHHcchhhhc
Q psy12011         31 MFACDLCDKEYKYKRNLYSHKKDEC   55 (94)
Q Consensus        31 ~~~c~~c~~~~~~~~~l~~h~~~~~   55 (94)
                      .+.|..|++.|.....|..|++.+.
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~~~   74 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRSKH   74 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHHTT
T ss_pred             CCCCCccCCCCcCHHHHHHHHcCcc
Confidence            6899999999999999999998653


No 63 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=90.69  E-value=0.19  Score=21.52  Aligned_cols=10  Identities=40%  Similarity=1.255  Sum_probs=5.6

Q ss_pred             eeCCCCcccc
Q psy12011         61 FQCPQCSYRT   70 (94)
Q Consensus        61 ~~c~~c~~~f   70 (94)
                      ..|+.||...
T Consensus        20 irC~~CG~rI   29 (44)
T smart00659       20 VRCRECGYRI   29 (44)
T ss_pred             eECCCCCceE
Confidence            5666666443


No 64 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=90.15  E-value=0.2  Score=25.78  Aligned_cols=30  Identities=17%  Similarity=0.415  Sum_probs=20.7

Q ss_pred             eecCCCCccccchhccCCCCCCccccccchhhccCh
Q psy12011          9 HFCGLFPESFLTWSNLKPNLNGMFACDLCDKEYKYK   44 (94)
Q Consensus         9 ~~c~~c~~~~~~~~~l~~~~~k~~~c~~c~~~~~~~   44 (94)
                      .+|+.||+.|....      ..|..|+.||..|...
T Consensus        10 R~Cp~CG~kFYDLn------k~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCPSCGAKFYDLN------KDPIVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCcchhccCC------CCCccCCCCCCccCcc
Confidence            56888888776533      2466788888777666


No 65 
>KOG2186|consensus
Probab=90.08  E-value=0.17  Score=29.88  Aligned_cols=38  Identities=24%  Similarity=0.553  Sum_probs=16.4

Q ss_pred             cccccchhhccChHHHHcchhhhcCCCCceeCCCCcccccc
Q psy12011         32 FACDLCDKEYKYKRNLYSHKKDECGQEPRFQCPQCSYRTKR   72 (94)
Q Consensus        32 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~   72 (94)
                      |.|..||....-+. +.+|+....+ .- |.|..|++.|..
T Consensus         4 FtCnvCgEsvKKp~-vekH~srCrn-~~-fSCIDC~k~F~~   41 (276)
T KOG2186|consen    4 FTCNVCGESVKKPQ-VEKHMSRCRN-AY-FSCIDCGKTFER   41 (276)
T ss_pred             Eehhhhhhhccccc-hHHHHHhccC-Ce-eEEeeccccccc
Confidence            34444444443332 2334444433 22 555555555544


No 66 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=89.91  E-value=0.22  Score=27.38  Aligned_cols=35  Identities=20%  Similarity=0.481  Sum_probs=21.9

Q ss_pred             CCCCccccccchhhccChHHHHcchhhhcCCCCceeCCCCccccc
Q psy12011         27 NLNGMFACDLCDKEYKYKRNLYSHKKDECGQEPRFQCPQCSYRTK   71 (94)
Q Consensus        27 ~~~k~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~   71 (94)
                      .+..-|.|+.|+..|.....+.         .. |.|+.||....
T Consensus       105 ~~~~~Y~Cp~c~~r~tf~eA~~---------~~-F~Cp~Cg~~L~  139 (158)
T TIGR00373       105 TNNMFFICPNMCVRFTFNEAME---------LN-FTCPRCGAMLD  139 (158)
T ss_pred             cCCCeEECCCCCcEeeHHHHHH---------cC-CcCCCCCCEee
Confidence            3445577777777776665543         13 78888876544


No 67 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=89.77  E-value=0.4  Score=20.90  Aligned_cols=22  Identities=32%  Similarity=0.640  Sum_probs=16.8

Q ss_pred             eeCCCCcccccc-----hhHHHHHHHH
Q psy12011         61 FQCPQCSYRTKR-----KGNLKSHLAI   82 (94)
Q Consensus        61 ~~c~~c~~~f~~-----~~~l~~h~~~   82 (94)
                      ..|..|++.+..     .++|.+|++.
T Consensus        19 a~C~~C~~~l~~~~~~gTs~L~rHl~~   45 (50)
T smart00614       19 AKCKYCGKKLSRSSKGGTSNLRRHLRR   45 (50)
T ss_pred             EEecCCCCEeeeCCCCCcHHHHHHHHh
Confidence            688888877754     3689999884


No 68 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=89.74  E-value=0.17  Score=27.72  Aligned_cols=39  Identities=13%  Similarity=0.138  Sum_probs=22.7

Q ss_pred             ecCCCCccccc--hhc-cCC--CCCCccccccchhhccChHHHH
Q psy12011         10 FCGLFPESFLT--WSN-LKP--NLNGMFACDLCDKEYKYKRNLY   48 (94)
Q Consensus        10 ~c~~c~~~~~~--~~~-l~~--~~~k~~~c~~c~~~~~~~~~l~   48 (94)
                      .||+||.....  .+. +..  ...+.++|..||..|..-..+.
T Consensus         2 ~cp~c~~~~~~~~~s~~~~~~~~~~~~~~c~~c~~~f~~~e~~~   45 (154)
T PRK00464          2 RCPFCGHPDTRVIDSRPAEDGNAIRRRRECLACGKRFTTFERVE   45 (154)
T ss_pred             cCCCCCCCCCEeEeccccCCCCceeeeeeccccCCcceEeEecc
Confidence            68999865421  111 112  2233488999999887654443


No 69 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=89.35  E-value=0.27  Score=26.23  Aligned_cols=25  Identities=28%  Similarity=0.442  Sum_probs=16.5

Q ss_pred             eeCCCCcccccchhHHHHHHHHhcCccc
Q psy12011         61 FQCPQCSYRTKRKGNLKSHLAIRHECYL   88 (94)
Q Consensus        61 ~~c~~c~~~f~~~~~l~~h~~~~~~~~~   88 (94)
                      ..|.+||+.|..-   .+|+++|+|..|
T Consensus        73 i~clecGk~~k~L---krHL~~~~gltp   97 (132)
T PF05443_consen   73 IICLECGKKFKTL---KRHLRTHHGLTP   97 (132)
T ss_dssp             EE-TBT--EESBH---HHHHHHTT-S-H
T ss_pred             eEEccCCcccchH---HHHHHHccCCCH
Confidence            8999999988765   799999987654


No 70 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=89.22  E-value=0.4  Score=21.85  Aligned_cols=52  Identities=19%  Similarity=0.469  Sum_probs=27.1

Q ss_pred             CceeecCCCCccccchhccCCCCCCccccccchhhccChHHHHcchhhhcCCCCceeCCCCcc
Q psy12011          6 LQVHFCGLFPESFLTWSNLKPNLNGMFACDLCDKEYKYKRNLYSHKKDECGQEPRFQCPQCSY   68 (94)
Q Consensus         6 ~~~~~c~~c~~~~~~~~~l~~~~~k~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   68 (94)
                      ..+.+|..|+......     ..-..|.|+.||+.....-     .+......+ |.|+.||.
T Consensus         5 ~~~~~CtSCg~~i~~~-----~~~~~F~CPnCG~~~I~RC-----~~CRk~~~~-Y~CP~CGF   56 (59)
T PRK14890          5 MEPPKCTSCGIEIAPR-----EKAVKFLCPNCGEVIIYRC-----EKCRKQSNP-YTCPKCGF   56 (59)
T ss_pred             ccCccccCCCCcccCC-----CccCEeeCCCCCCeeEeec-----hhHHhcCCc-eECCCCCC
Confidence            3455677777543211     1134577888886522221     111122255 99999873


No 71 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=89.08  E-value=0.28  Score=18.49  Aligned_cols=9  Identities=44%  Similarity=1.291  Sum_probs=4.0

Q ss_pred             eCCCCcccc
Q psy12011         62 QCPQCSYRT   70 (94)
Q Consensus        62 ~c~~c~~~f   70 (94)
                      .|+.||..|
T Consensus        16 ~Cp~CG~~F   24 (26)
T PF10571_consen   16 FCPHCGYDF   24 (26)
T ss_pred             cCCCCCCCC
Confidence            344444444


No 72 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=88.99  E-value=0.3  Score=27.43  Aligned_cols=33  Identities=27%  Similarity=0.697  Sum_probs=19.4

Q ss_pred             CCccccccchhhccChHHHHcchhhhcCCCCceeCCCCccccc
Q psy12011         29 NGMFACDLCDKEYKYKRNLYSHKKDECGQEPRFQCPQCSYRTK   71 (94)
Q Consensus        29 ~k~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~   71 (94)
                      ..-|.|+.|+..|.....+.         .. |.|+.||....
T Consensus       115 ~~~Y~Cp~C~~rytf~eA~~---------~~-F~Cp~Cg~~L~  147 (178)
T PRK06266        115 NMFFFCPNCHIRFTFDEAME---------YG-FRCPQCGEMLE  147 (178)
T ss_pred             CCEEECCCCCcEEeHHHHhh---------cC-CcCCCCCCCCe
Confidence            34566777776666654432         23 77777775543


No 73 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=88.83  E-value=0.15  Score=29.45  Aligned_cols=16  Identities=19%  Similarity=0.212  Sum_probs=11.0

Q ss_pred             ceeecCCCCccccchh
Q psy12011          7 QVHFCGLFPESFLTWS   22 (94)
Q Consensus         7 ~~~~c~~c~~~~~~~~   22 (94)
                      +...||+|++.|....
T Consensus         4 k~~~CPvC~~~F~~~~   19 (214)
T PF09986_consen    4 KKITCPVCGKEFKTKK   19 (214)
T ss_pred             CceECCCCCCeeeeeE
Confidence            4567888887777654


No 74 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=88.16  E-value=0.28  Score=24.17  Aligned_cols=11  Identities=18%  Similarity=0.818  Sum_probs=6.6

Q ss_pred             eeCCCCccccc
Q psy12011         61 FQCPQCSYRTK   71 (94)
Q Consensus        61 ~~c~~c~~~f~   71 (94)
                      |.|..|+..|.
T Consensus        54 W~C~kCg~~fA   64 (89)
T COG1997          54 WKCRKCGAKFA   64 (89)
T ss_pred             EEcCCCCCeec
Confidence            66666665554


No 75 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=88.14  E-value=0.36  Score=21.74  Aligned_cols=23  Identities=13%  Similarity=0.535  Sum_probs=10.8

Q ss_pred             CccccccchhhccChHHHHcchh
Q psy12011         30 GMFACDLCDKEYKYKRNLYSHKK   52 (94)
Q Consensus        30 k~~~c~~c~~~~~~~~~l~~h~~   52 (94)
                      .-++|+-|+..|....++..|..
T Consensus        16 ~~lrCPRC~~~FR~~K~Y~RHVN   38 (65)
T COG4049          16 EFLRCPRCGMVFRRRKDYIRHVN   38 (65)
T ss_pred             eeeeCCchhHHHHHhHHHHHHhh
Confidence            33445555555554444444443


No 76 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=87.92  E-value=0.65  Score=23.72  Aligned_cols=25  Identities=32%  Similarity=0.874  Sum_probs=23.1

Q ss_pred             eeC----CCCcccccchhHHHHHHHHhcC
Q psy12011         61 FQC----PQCSYRTKRKGNLKSHLAIRHE   85 (94)
Q Consensus        61 ~~c----~~c~~~f~~~~~l~~h~~~~~~   85 (94)
                      |.|    ..|+....+...++.|.+.+|+
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            899    9999999999999999998875


No 77 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=87.55  E-value=0.35  Score=28.00  Aligned_cols=31  Identities=19%  Similarity=0.442  Sum_probs=23.1

Q ss_pred             CCCCceeCCCCcccccchhHHHHHHHHhcCcc
Q psy12011         56 GQEPRFQCPQCSYRTKRKGNLKSHLAIRHECY   87 (94)
Q Consensus        56 ~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~   87 (94)
                      .+.. |.|..|+|.|....-+..|+..-|+++
T Consensus        74 ~~~K-~~C~lc~KlFkg~eFV~KHI~nKH~e~  104 (214)
T PF04959_consen   74 DEDK-WRCPLCGKLFKGPEFVRKHIFNKHPEK  104 (214)
T ss_dssp             SSEE-EEE-SSS-EESSHHHHHHHHHHH-HHH
T ss_pred             cCCE-ECCCCCCcccCChHHHHHHHhhcCHHH
Confidence            4455 999999999999999999998877654


No 78 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=87.49  E-value=0.74  Score=19.35  Aligned_cols=22  Identities=36%  Similarity=0.543  Sum_probs=15.3

Q ss_pred             eeCCCCcccccc----hhHHHHHHHH
Q psy12011         61 FQCPQCSYRTKR----KGNLKSHLAI   82 (94)
Q Consensus        61 ~~c~~c~~~f~~----~~~l~~h~~~   82 (94)
                      ..|..|++.+..    .++|.+|++.
T Consensus        17 a~C~~C~~~~~~~~~~ts~l~~HL~~   42 (45)
T PF02892_consen   17 AKCKYCGKVIKYSSGGTSNLKRHLKK   42 (45)
T ss_dssp             EEETTTTEE-----SSTHHHHHHHHH
T ss_pred             EEeCCCCeEEeeCCCcHHHHHHhhhh
Confidence            789999987765    4788888854


No 79 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=85.84  E-value=0.41  Score=28.51  Aligned_cols=77  Identities=16%  Similarity=0.321  Sum_probs=37.5

Q ss_pred             CCCCceeecCCCCccccchhccCC------CCCCccccccchhh-----------ccChHHHHcchhhhcCCCCceeCCC
Q psy12011          3 SQNLQVHFCGLFPESFLTWSNLKP------NLNGMFACDLCDKE-----------YKYKRNLYSHKKDECGQEPRFQCPQ   65 (94)
Q Consensus         3 ~~~~~~~~c~~c~~~~~~~~~l~~------~~~k~~~c~~c~~~-----------~~~~~~l~~h~~~~~~~~~~~~c~~   65 (94)
                      ..|-++|.|..|....-....+.|      .....|+|..|++.           |........-.. ....++ +.|+.
T Consensus       137 ~hGGrif~CsfC~~flCEDDQFEHQAsCQvLe~E~~KC~SCNrlGq~sCLRCK~cfCddHvrrKg~k-y~k~k~-~PCPK  214 (314)
T PF06524_consen  137 DHGGRIFKCSFCDNFLCEDDQFEHQASCQVLESETFKCQSCNRLGQYSCLRCKICFCDDHVRRKGFK-YEKGKP-IPCPK  214 (314)
T ss_pred             cCCCeEEEeecCCCeeeccchhhhhhhhhhhhcccccccccccccchhhhheeeeehhhhhhhcccc-cccCCC-CCCCC
Confidence            356778888888764444444443      22234555555543           222211111111 112255 78888


Q ss_pred             CcccccchhHHHHHHH
Q psy12011         66 CSYRTKRKGNLKSHLA   81 (94)
Q Consensus        66 c~~~f~~~~~l~~h~~   81 (94)
                      |+........|..-.|
T Consensus       215 Cg~et~eTkdLSmStR  230 (314)
T PF06524_consen  215 CGYETQETKDLSMSTR  230 (314)
T ss_pred             CCCcccccccceeeee
Confidence            8876555544443333


No 80 
>PHA00626 hypothetical protein
Probab=85.76  E-value=0.66  Score=20.93  Aligned_cols=11  Identities=18%  Similarity=0.428  Sum_probs=5.0

Q ss_pred             ccccccchhhc
Q psy12011         31 MFACDLCDKEY   41 (94)
Q Consensus        31 ~~~c~~c~~~~   41 (94)
                      .|.|..||..|
T Consensus        23 rYkCkdCGY~f   33 (59)
T PHA00626         23 DYVCCDCGYND   33 (59)
T ss_pred             ceEcCCCCCee
Confidence            34455554333


No 81 
>KOG2893|consensus
Probab=85.50  E-value=0.2  Score=29.42  Aligned_cols=28  Identities=29%  Similarity=0.796  Sum_probs=14.8

Q ss_pred             chhhccChHHHHcchhhhcCCCCceeCCCCccc
Q psy12011         37 CDKEYKYKRNLYSHKKDECGQEPRFQCPQCSYR   69 (94)
Q Consensus        37 c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~   69 (94)
                      |++.|..+..|.+|++    .+. |+|..|-+-
T Consensus        16 cnrefddekiliqhqk----akh-fkchichkk   43 (341)
T KOG2893|consen   16 CNREFDDEKILIQHQK----AKH-FKCHICHKK   43 (341)
T ss_pred             cccccchhhhhhhhhh----hcc-ceeeeehhh
Confidence            5556666655555544    233 555555543


No 82 
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=85.03  E-value=0.82  Score=18.63  Aligned_cols=29  Identities=21%  Similarity=0.225  Sum_probs=15.6

Q ss_pred             eecCCCCccccchhccCCCCCCccccccchhh
Q psy12011          9 HFCGLFPESFLTWSNLKPNLNGMFACDLCDKE   40 (94)
Q Consensus         9 ~~c~~c~~~~~~~~~l~~~~~k~~~c~~c~~~   40 (94)
                      ..|+.||+.|....+   .-...-.|+.||..
T Consensus         2 r~C~~Cg~~Yh~~~~---pP~~~~~Cd~cg~~   30 (36)
T PF05191_consen    2 RICPKCGRIYHIEFN---PPKVEGVCDNCGGE   30 (36)
T ss_dssp             EEETTTTEEEETTTB-----SSTTBCTTTTEB
T ss_pred             cCcCCCCCccccccC---CCCCCCccCCCCCe
Confidence            467778877655443   22223456666653


No 83 
>KOG2893|consensus
Probab=84.98  E-value=0.2  Score=29.40  Aligned_cols=42  Identities=21%  Similarity=0.295  Sum_probs=32.4

Q ss_pred             ecCCCCccccchhccC-CCCCCccccccchhhccChHHHHcch
Q psy12011         10 FCGLFPESFLTWSNLK-PNLNGMFACDLCDKEYKYKRNLYSHK   51 (94)
Q Consensus        10 ~c~~c~~~~~~~~~l~-~~~~k~~~c~~c~~~~~~~~~l~~h~   51 (94)
                      +|=+|++.|-+..-|. |...|.|+|.+|.+.+-.--.|..|-
T Consensus        12 wcwycnrefddekiliqhqkakhfkchichkkl~sgpglsihc   54 (341)
T KOG2893|consen   12 WCWYCNREFDDEKILIQHQKAKHFKCHICHKKLFSGPGLSIHC   54 (341)
T ss_pred             eeeecccccchhhhhhhhhhhccceeeeehhhhccCCCceeeh
Confidence            4778999999988877 78889999999988765544455553


No 84 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=84.34  E-value=0.82  Score=24.25  Aligned_cols=31  Identities=6%  Similarity=0.129  Sum_probs=21.5

Q ss_pred             eecCCCCccccchhccCCCCCCccccccchhhccChH
Q psy12011          9 HFCGLFPESFLTWSNLKPNLNGMFACDLCDKEYKYKR   45 (94)
Q Consensus         9 ~~c~~c~~~~~~~~~l~~~~~k~~~c~~c~~~~~~~~   45 (94)
                      ..|+.||+.|....      ..|..|+.||..|....
T Consensus        10 r~Cp~cg~kFYDLn------k~p~vcP~cg~~~~~~~   40 (129)
T TIGR02300        10 RICPNTGSKFYDLN------RRPAVSPYTGEQFPPEE   40 (129)
T ss_pred             ccCCCcCccccccC------CCCccCCCcCCccCcch
Confidence            67888888876533      24667888888776653


No 85 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=84.04  E-value=0.45  Score=18.90  Aligned_cols=9  Identities=44%  Similarity=1.394  Sum_probs=4.5

Q ss_pred             eeCCCCccc
Q psy12011         61 FQCPQCSYR   69 (94)
Q Consensus        61 ~~c~~c~~~   69 (94)
                      .+|..||..
T Consensus        18 irC~~CG~R   26 (32)
T PF03604_consen   18 IRCPECGHR   26 (32)
T ss_dssp             SSBSSSS-S
T ss_pred             EECCcCCCe
Confidence            556666544


No 86 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=83.92  E-value=1.3  Score=16.56  Aligned_cols=20  Identities=35%  Similarity=0.682  Sum_probs=13.6

Q ss_pred             eeCCCCcccccchhHHHHHHH
Q psy12011         61 FQCPQCSYRTKRKGNLKSHLA   81 (94)
Q Consensus        61 ~~c~~c~~~f~~~~~l~~h~~   81 (94)
                      ..|+.|++.+ ....+..|+.
T Consensus         2 v~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        2 VQCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             CcCCCCcCcc-cHHHHHHHHH
Confidence            4678888777 4556667765


No 87 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=81.18  E-value=1.7  Score=16.04  Aligned_cols=10  Identities=10%  Similarity=-0.217  Sum_probs=6.3

Q ss_pred             ceeecCCCCc
Q psy12011          7 QVHFCGLFPE   16 (94)
Q Consensus         7 ~~~~c~~c~~   16 (94)
                      ..|.|+.||+
T Consensus        15 v~f~CPnCG~   24 (24)
T PF07754_consen   15 VPFPCPNCGF   24 (24)
T ss_pred             ceEeCCCCCC
Confidence            4577777763


No 88 
>KOG4173|consensus
Probab=79.61  E-value=0.43  Score=27.46  Aligned_cols=78  Identities=17%  Similarity=0.303  Sum_probs=50.7

Q ss_pred             ceeecCC--CCccccchhccCC--CCCCccccccchhhccChHHHHcchhhhc---------CCCCceeCCC--Cccccc
Q psy12011          7 QVHFCGL--FPESFLTWSNLKP--NLNGMFACDLCDKEYKYKRNLYSHKKDEC---------GQEPRFQCPQ--CSYRTK   71 (94)
Q Consensus         7 ~~~~c~~--c~~~~~~~~~l~~--~~~k~~~c~~c~~~~~~~~~l~~h~~~~~---------~~~~~~~c~~--c~~~f~   71 (94)
                      +.+.|+.  |.+.|....++.+  +..-...|..|.+.|.....|..|+.--+         .+.++|+|.+  |+--|.
T Consensus        78 ~~~~cqvagc~~~~d~lD~~E~hY~~~h~~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KFk  157 (253)
T KOG4173|consen   78 PAFACQVAGCCQVFDALDDYEHHYHTLHGNSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKFK  157 (253)
T ss_pred             ccccccccchHHHHhhhhhHHHhhhhcccchhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhhh
Confidence            4466776  6566666665542  11122379999999999888888765221         2356688854  777788


Q ss_pred             chhHHHHHHHHhc
Q psy12011         72 RKGNLKSHLAIRH   84 (94)
Q Consensus        72 ~~~~l~~h~~~~~   84 (94)
                      ..-....|+..-|
T Consensus       158 T~r~RkdH~I~~H  170 (253)
T KOG4173|consen  158 TSRDRKDHMIRMH  170 (253)
T ss_pred             hhhhhhhHHHHhc
Confidence            7777777776443


No 89 
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=79.57  E-value=0.71  Score=22.99  Aligned_cols=11  Identities=18%  Similarity=0.724  Sum_probs=6.5

Q ss_pred             eeCCCCccccc
Q psy12011         61 FQCPQCSYRTK   71 (94)
Q Consensus        61 ~~c~~c~~~f~   71 (94)
                      |.|..|++.|.
T Consensus        55 W~C~~C~~~~A   65 (90)
T PTZ00255         55 WRCKGCKKTVA   65 (90)
T ss_pred             EEcCCCCCEEe
Confidence            66666665554


No 90 
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=79.21  E-value=1.4  Score=19.76  Aligned_cols=30  Identities=17%  Similarity=0.160  Sum_probs=14.8

Q ss_pred             eecCCCCccccchhccCCCCCCccccccchhhc
Q psy12011          9 HFCGLFPESFLTWSNLKPNLNGMFACDLCDKEY   41 (94)
Q Consensus         9 ~~c~~c~~~~~~~~~l~~~~~k~~~c~~c~~~~   41 (94)
                      +.|+.||..+.......  ++ ...|+.||..+
T Consensus         3 ~~CP~CG~~iev~~~~~--Ge-iV~Cp~CGael   32 (54)
T TIGR01206         3 FECPDCGAEIELENPEL--GE-LVICDECGAEL   32 (54)
T ss_pred             cCCCCCCCEEecCCCcc--CC-EEeCCCCCCEE
Confidence            56666666554433222  22 33566666444


No 91 
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=78.95  E-value=1.9  Score=18.09  Aligned_cols=12  Identities=8%  Similarity=0.213  Sum_probs=9.6

Q ss_pred             ceeecCCCCccc
Q psy12011          7 QVHFCGLFPESF   18 (94)
Q Consensus         7 ~~~~c~~c~~~~   18 (94)
                      ++..|++|+..|
T Consensus        28 ~~~~CpYCg~~y   39 (40)
T PF10276_consen   28 GPVVCPYCGTRY   39 (40)
T ss_dssp             CEEEETTTTEEE
T ss_pred             CeEECCCCCCEE
Confidence            478899998776


No 92 
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=78.82  E-value=2.9  Score=18.54  Aligned_cols=15  Identities=33%  Similarity=0.789  Sum_probs=10.1

Q ss_pred             eeCCCCcccccchhH
Q psy12011         61 FQCPQCSYRTKRKGN   75 (94)
Q Consensus        61 ~~c~~c~~~f~~~~~   75 (94)
                      +.|..|+..+....+
T Consensus        29 W~C~~Cgh~w~~~v~   43 (55)
T PF14311_consen   29 WKCPKCGHEWKASVN   43 (55)
T ss_pred             EECCCCCCeeEccHh
Confidence            777777776665544


No 93 
>KOG2593|consensus
Probab=78.56  E-value=1  Score=28.76  Aligned_cols=33  Identities=21%  Similarity=0.455  Sum_probs=17.1

Q ss_pred             ceeecCCCCccccchhccC--CCCCCccccccchh
Q psy12011          7 QVHFCGLFPESFLTWSNLK--PNLNGMFACDLCDK   39 (94)
Q Consensus         7 ~~~~c~~c~~~~~~~~~l~--~~~~k~~~c~~c~~   39 (94)
                      .-|+|+.|.+.|.....++  ....-.|.|..|+.
T Consensus       127 ~~Y~Cp~C~kkyt~Lea~~L~~~~~~~F~C~~C~g  161 (436)
T KOG2593|consen  127 AGYVCPNCQKKYTSLEALQLLDNETGEFHCENCGG  161 (436)
T ss_pred             ccccCCccccchhhhHHHHhhcccCceEEEecCCC
Confidence            3466666666665555444  22234455555553


No 94 
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=77.87  E-value=1.6  Score=18.60  Aligned_cols=8  Identities=13%  Similarity=0.243  Sum_probs=4.0

Q ss_pred             eecCCCCc
Q psy12011          9 HFCGLFPE   16 (94)
Q Consensus         9 ~~c~~c~~   16 (94)
                      ++|+.||.
T Consensus        19 ~~CP~Cg~   26 (46)
T PF12760_consen   19 FVCPHCGS   26 (46)
T ss_pred             CCCCCCCC
Confidence            44555553


No 95 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=77.63  E-value=1.5  Score=19.23  Aligned_cols=11  Identities=27%  Similarity=0.863  Sum_probs=6.6

Q ss_pred             ccccccchhhc
Q psy12011         31 MFACDLCDKEY   41 (94)
Q Consensus        31 ~~~c~~c~~~~   41 (94)
                      .|.|..||+.|
T Consensus         6 ~Y~C~~Cg~~~   16 (49)
T COG1996           6 EYKCARCGREV   16 (49)
T ss_pred             EEEhhhcCCee
Confidence            45666666555


No 96 
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=77.55  E-value=0.81  Score=20.09  Aligned_cols=15  Identities=20%  Similarity=0.718  Sum_probs=7.1

Q ss_pred             CccccccchhhccCh
Q psy12011         30 GMFACDLCDKEYKYK   44 (94)
Q Consensus        30 k~~~c~~c~~~~~~~   44 (94)
                      +.+.|..||..|...
T Consensus         3 k~l~C~dCg~~FvfT   17 (49)
T PF13451_consen    3 KTLTCKDCGAEFVFT   17 (49)
T ss_pred             eeEEcccCCCeEEEe
Confidence            344455555554443


No 97 
>KOG4167|consensus
Probab=75.61  E-value=0.69  Score=31.58  Aligned_cols=24  Identities=17%  Similarity=0.425  Sum_probs=22.1

Q ss_pred             eeCCCCcccccchhHHHHHHHHhc
Q psy12011         61 FQCPQCSYRTKRKGNLKSHLAIRH   84 (94)
Q Consensus        61 ~~c~~c~~~f~~~~~l~~h~~~~~   84 (94)
                      |.|.+|++.|..--++..||++|.
T Consensus       793 FpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  793 FPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             eehHHHHHHHHHHhhhhHHHHHHH
Confidence            899999999999989999999884


No 98 
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=74.99  E-value=2.2  Score=29.18  Aligned_cols=52  Identities=31%  Similarity=0.618  Sum_probs=36.1

Q ss_pred             cCCCCccccchhccC----CCCCCcc-ccccchhhccChHHHHcchhhhcCCCCceeCCCCccc
Q psy12011         11 CGLFPESFLTWSNLK----PNLNGMF-ACDLCDKEYKYKRNLYSHKKDECGQEPRFQCPQCSYR   69 (94)
Q Consensus        11 c~~c~~~~~~~~~l~----~~~~k~~-~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~   69 (94)
                      |..||-.|+-...|.    ++.=+.| -|+.|.+.+..+.+    ++.|+  .+ ..|+.||..
T Consensus       126 CT~CGPRfTIi~alPYDR~nTsM~~F~lC~~C~~EY~dP~n----RRfHA--Qp-~aCp~CGP~  182 (750)
T COG0068         126 CTNCGPRFTIIEALPYDRENTSMADFPLCPFCDKEYKDPLN----RRFHA--QP-IACPKCGPH  182 (750)
T ss_pred             cCCCCcceeeeccCCCCcccCccccCcCCHHHHHHhcCccc----ccccc--cc-ccCcccCCC
Confidence            888998888877776    3333333 58999888877655    34443  35 899999963


No 99 
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=74.96  E-value=1.8  Score=23.23  Aligned_cols=25  Identities=24%  Similarity=0.235  Sum_probs=19.1

Q ss_pred             eeCCCCcccccchhHHHHHHHHhcCccc
Q psy12011         61 FQCPQCSYRTKRKGNLKSHLAIRHECYL   88 (94)
Q Consensus        61 ~~c~~c~~~f~~~~~l~~h~~~~~~~~~   88 (94)
                      +.|.++|+.|.+   |++|+.+|.+-.|
T Consensus        77 IicLEDGkkfKS---LKRHL~t~~gmTP  101 (148)
T COG4957          77 IICLEDGKKFKS---LKRHLTTHYGLTP  101 (148)
T ss_pred             EEEeccCcchHH---HHHHHhcccCCCH
Confidence            688888887764   5899998877654


No 100
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=74.73  E-value=0.95  Score=22.56  Aligned_cols=11  Identities=18%  Similarity=0.830  Sum_probs=6.7

Q ss_pred             eeCCCCccccc
Q psy12011         61 FQCPQCSYRTK   71 (94)
Q Consensus        61 ~~c~~c~~~f~   71 (94)
                      |.|..|++.|.
T Consensus        54 W~C~~C~~~~A   64 (90)
T PF01780_consen   54 WKCKKCGKKFA   64 (90)
T ss_dssp             EEETTTTEEEE
T ss_pred             eecCCCCCEEe
Confidence            66666666554


No 101
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=74.62  E-value=2.4  Score=23.39  Aligned_cols=36  Identities=14%  Similarity=0.255  Sum_probs=23.6

Q ss_pred             ecCCCCccccchhccC------CCCCCccccccchhhccChH
Q psy12011         10 FCGLFPESFLTWSNLK------PNLNGMFACDLCDKEYKYKR   45 (94)
Q Consensus        10 ~c~~c~~~~~~~~~l~------~~~~k~~~c~~c~~~~~~~~   45 (94)
                      .|+.|+........+.      .+-+.|.-|..||+.|+...
T Consensus        41 ~Cp~C~~~IrG~y~v~gv~~~g~~~~~PsYC~~CGkpyPWt~   82 (158)
T PF10083_consen   41 SCPNCSTPIRGDYHVEGVFGLGGHYEAPSYCHNCGKPYPWTE   82 (158)
T ss_pred             HCcCCCCCCCCceecCCeeeeCCCCCCChhHHhCCCCCchHH
Confidence            3666666555554443      35557888999998887753


No 102
>KOG1146|consensus
Probab=73.56  E-value=2.3  Score=31.16  Aligned_cols=76  Identities=16%  Similarity=0.351  Sum_probs=52.1

Q ss_pred             eecCCCCccccchhccCC-CCCCccccccchhhccChHHHHcchhhhc----------------CCCCceeCCCCccccc
Q psy12011          9 HFCGLFPESFLTWSNLKP-NLNGMFACDLCDKEYKYKRNLYSHKKDEC----------------GQEPRFQCPQCSYRTK   71 (94)
Q Consensus         9 ~~c~~c~~~~~~~~~l~~-~~~k~~~c~~c~~~~~~~~~l~~h~~~~~----------------~~~~~~~c~~c~~~f~   71 (94)
                      +.|..|++.+.....+.+ -...+|.|..|...|.....|..|++...                -...+| |..|...|.
T Consensus      1261 ~~c~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~l~~~~~k~~~~~~~~~~~~~~~l~~~d~~~~-c~~c~~~~~ 1339 (1406)
T KOG1146|consen 1261 GECGAVDELLTPSFGISTLDVTHRYLCRQCKMAFDGEAPLTAHQRKFCFAGRGSGGSMPPPLRVPDCTYH-CLACEVLLS 1339 (1406)
T ss_pred             chhhhccccccCccceeecccchhHHHHHHHhhhcchhHHHHHHHHHHhccCccccCCCCcccCcccccc-chHHHhhcc
Confidence            345566665555554442 22346888999999998888888875321                113336 999999999


Q ss_pred             chhHHHHHHHHhcC
Q psy12011         72 RKGNLKSHLAIRHE   85 (94)
Q Consensus        72 ~~~~l~~h~~~~~~   85 (94)
                      ....|..|+++.++
T Consensus      1340 ~~~alqihm~~~~~ 1353 (1406)
T KOG1146|consen 1340 GREALQIHMRSSAH 1353 (1406)
T ss_pred             hhHHHHHHHHHhhh
Confidence            99999999997543


No 103
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=73.48  E-value=1.2  Score=22.65  Aligned_cols=16  Identities=31%  Similarity=0.254  Sum_probs=12.0

Q ss_pred             eeecCCCCccccchhc
Q psy12011          8 VHFCGLFPESFLTWSN   23 (94)
Q Consensus         8 ~~~c~~c~~~~~~~~~   23 (94)
                      ||.|.-||..|..-+.
T Consensus         2 pH~CtrCG~vf~~g~~   17 (112)
T COG3364           2 PHQCTRCGEVFDDGSE   17 (112)
T ss_pred             CceecccccccccccH
Confidence            6788888888877543


No 104
>KOG3408|consensus
Probab=72.88  E-value=2.6  Score=22.26  Aligned_cols=26  Identities=27%  Similarity=0.498  Sum_probs=20.7

Q ss_pred             CCCCceeCCCCcccccchhHHHHHHHH
Q psy12011         56 GQEPRFQCPQCSYRTKRKGNLKSHLAI   82 (94)
Q Consensus        56 ~~~~~~~c~~c~~~f~~~~~l~~h~~~   82 (94)
                      |.-. |-|..|.+.|.....|..|.++
T Consensus        54 G~Gq-fyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   54 GGGQ-FYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCce-eehhhhhhhhcchHHHHHHHhc
Confidence            3344 8888999999988888888875


No 105
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=72.63  E-value=2.1  Score=21.77  Aligned_cols=38  Identities=13%  Similarity=0.216  Sum_probs=21.5

Q ss_pred             CceeecCCCCccccchhccCC-CCCCccccccchhhccC
Q psy12011          6 LQVHFCGLFPESFLTWSNLKP-NLNGMFACDLCDKEYKY   43 (94)
Q Consensus         6 ~~~~~c~~c~~~~~~~~~l~~-~~~k~~~c~~c~~~~~~   43 (94)
                      .+.|.|+.|+..-...-.++. .+.....|..||.+|..
T Consensus        20 ~k~FtCp~Cghe~vs~ctvkk~~~~g~~~Cg~CGls~e~   58 (104)
T COG4888          20 PKTFTCPRCGHEKVSSCTVKKTVNIGTAVCGNCGLSFEC   58 (104)
T ss_pred             CceEecCccCCeeeeEEEEEecCceeEEEcccCcceEEE
Confidence            456888888865444333442 22233467777766543


No 106
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=72.26  E-value=1.2  Score=22.20  Aligned_cols=11  Identities=18%  Similarity=0.773  Sum_probs=6.5

Q ss_pred             eeCCCCccccc
Q psy12011         61 FQCPQCSYRTK   71 (94)
Q Consensus        61 ~~c~~c~~~f~   71 (94)
                      |.|..|++.|.
T Consensus        54 W~C~~C~~~~A   64 (91)
T TIGR00280        54 WTCRKCGAKFA   64 (91)
T ss_pred             EEcCCCCCEEe
Confidence            66666665554


No 107
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=72.07  E-value=2.8  Score=22.35  Aligned_cols=16  Identities=13%  Similarity=0.625  Sum_probs=9.2

Q ss_pred             CCccccccchhhccCh
Q psy12011         29 NGMFACDLCDKEYKYK   44 (94)
Q Consensus        29 ~k~~~c~~c~~~~~~~   44 (94)
                      .--|.|..|++.|...
T Consensus        51 ~qRyrC~~C~~tf~~~   66 (129)
T COG3677          51 HQRYKCKSCGSTFTVE   66 (129)
T ss_pred             ccccccCCcCcceeee
Confidence            3346666666666543


No 108
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=71.63  E-value=3  Score=20.86  Aligned_cols=13  Identities=23%  Similarity=0.552  Sum_probs=6.6

Q ss_pred             ccccccchhhccC
Q psy12011         31 MFACDLCDKEYKY   43 (94)
Q Consensus        31 ~~~c~~c~~~~~~   43 (94)
                      |-+|..||..|..
T Consensus        58 Pa~CkkCGfef~~   70 (97)
T COG3357          58 PARCKKCGFEFRD   70 (97)
T ss_pred             ChhhcccCccccc
Confidence            4455556555433


No 109
>PRK04023 DNA polymerase II large subunit; Validated
Probab=69.89  E-value=7.3  Score=28.12  Aligned_cols=10  Identities=10%  Similarity=0.072  Sum_probs=6.4

Q ss_pred             eeecCCCCcc
Q psy12011          8 VHFCGLFPES   17 (94)
Q Consensus         8 ~~~c~~c~~~   17 (94)
                      ...|+.||..
T Consensus       626 ~RfCpsCG~~  635 (1121)
T PRK04023        626 RRKCPSCGKE  635 (1121)
T ss_pred             CccCCCCCCc
Confidence            4567777765


No 110
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=68.48  E-value=3.6  Score=16.04  Aligned_cols=8  Identities=38%  Similarity=1.290  Sum_probs=5.1

Q ss_pred             eeCCCCcc
Q psy12011         61 FQCPQCSY   68 (94)
Q Consensus        61 ~~c~~c~~   68 (94)
                      +.|+.|+.
T Consensus        20 ~vCp~C~~   27 (30)
T PF08274_consen   20 LVCPECGH   27 (30)
T ss_dssp             EEETTTTE
T ss_pred             EeCCcccc
Confidence            66666654


No 111
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=67.96  E-value=1.8  Score=21.11  Aligned_cols=9  Identities=22%  Similarity=0.390  Sum_probs=2.4

Q ss_pred             ceeecCCCC
Q psy12011          7 QVHFCGLFP   15 (94)
Q Consensus         7 ~~~~c~~c~   15 (94)
                      +.|.|+.|+
T Consensus        21 ~~F~CPfC~   29 (81)
T PF05129_consen   21 KVFDCPFCN   29 (81)
T ss_dssp             S----TTT-
T ss_pred             ceEcCCcCC
Confidence            456666666


No 112
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=66.25  E-value=3  Score=22.31  Aligned_cols=15  Identities=27%  Similarity=0.208  Sum_probs=12.3

Q ss_pred             eeecCCCCccccchh
Q psy12011          8 VHFCGLFPESFLTWS   22 (94)
Q Consensus         8 ~~~c~~c~~~~~~~~   22 (94)
                      ||.|..||+.|...+
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            688999999888765


No 113
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=66.18  E-value=3.9  Score=16.91  Aligned_cols=16  Identities=13%  Similarity=-0.029  Sum_probs=12.0

Q ss_pred             eeecCCCCccccchhc
Q psy12011          8 VHFCGLFPESFLTWSN   23 (94)
Q Consensus         8 ~~~c~~c~~~~~~~~~   23 (94)
                      ++.|..|++.|-....
T Consensus        12 ~f~C~~C~~~FC~~HR   27 (39)
T smart00154       12 GFKCRHCGNLFCGEHR   27 (39)
T ss_pred             CeECCccCCccccccC
Confidence            7889999888766543


No 114
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=64.32  E-value=8.1  Score=16.76  Aligned_cols=9  Identities=11%  Similarity=0.032  Sum_probs=5.0

Q ss_pred             eecCCCCcc
Q psy12011          9 HFCGLFPES   17 (94)
Q Consensus         9 ~~c~~c~~~   17 (94)
                      |+|..|+-.
T Consensus         2 y~C~~Cgyv   10 (47)
T PF00301_consen    2 YQCPVCGYV   10 (47)
T ss_dssp             EEETTTSBE
T ss_pred             cCCCCCCEE
Confidence            556666544


No 115
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=63.51  E-value=2.2  Score=21.29  Aligned_cols=11  Identities=18%  Similarity=0.824  Sum_probs=6.9

Q ss_pred             eeCCCCccccc
Q psy12011         61 FQCPQCSYRTK   71 (94)
Q Consensus        61 ~~c~~c~~~f~   71 (94)
                      |.|..|++.|.
T Consensus        55 W~C~~C~~~~A   65 (90)
T PRK03976         55 WECRKCGAKFA   65 (90)
T ss_pred             EEcCCCCCEEe
Confidence            66666666554


No 116
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=63.38  E-value=3.4  Score=19.72  Aligned_cols=37  Identities=11%  Similarity=0.244  Sum_probs=16.6

Q ss_pred             eecCCCCccccchh-ccC--CCCCCccccc--cchhhccChH
Q psy12011          9 HFCGLFPESFLTWS-NLK--PNLNGMFACD--LCDKEYKYKR   45 (94)
Q Consensus         9 ~~c~~c~~~~~~~~-~l~--~~~~k~~~c~--~c~~~~~~~~   45 (94)
                      +.|+.||....... ...  ...+.-++|.  +||..|....
T Consensus         2 m~CP~Cg~~a~irtSr~~s~~~~~~Y~qC~N~eCg~tF~t~e   43 (72)
T PRK09678          2 FHCPLCQHAAHARTSRYITDTTKERYHQCQNVNCSATFITYE   43 (72)
T ss_pred             ccCCCCCCccEEEEChhcChhhheeeeecCCCCCCCEEEEEE
Confidence            35677765432111 111  2333345565  6666665433


No 117
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=63.17  E-value=4.7  Score=16.68  Aligned_cols=15  Identities=20%  Similarity=0.403  Sum_probs=6.5

Q ss_pred             ccccchhhccChHHH
Q psy12011         33 ACDLCDKEYKYKRNL   47 (94)
Q Consensus        33 ~c~~c~~~~~~~~~l   47 (94)
                      .|..|+..+.....|
T Consensus        21 ~C~~C~G~W~d~~el   35 (41)
T PF13453_consen   21 VCPSCGGIWFDAGEL   35 (41)
T ss_pred             ECCCCCeEEccHHHH
Confidence            344444444444333


No 118
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=62.94  E-value=3.8  Score=18.17  Aligned_cols=26  Identities=12%  Similarity=0.474  Sum_probs=14.3

Q ss_pred             CCccccccchhhccChHHHHcchhhh
Q psy12011         29 NGMFACDLCDKEYKYKRNLYSHKKDE   54 (94)
Q Consensus        29 ~k~~~c~~c~~~~~~~~~l~~h~~~~   54 (94)
                      ...|+|+.|+..|-..-++-.|...|
T Consensus        19 ~~~y~C~~C~~~FC~dCD~fiHE~LH   44 (51)
T PF07975_consen   19 SSRYRCPKCKNHFCIDCDVFIHETLH   44 (51)
T ss_dssp             -EEE--TTTT--B-HHHHHTTTTTS-
T ss_pred             CCeEECCCCCCccccCcChhhhcccc
Confidence            34688889988888887777665555


No 119
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=62.41  E-value=7.3  Score=21.03  Aligned_cols=32  Identities=16%  Similarity=0.610  Sum_probs=15.5

Q ss_pred             ccccccchhhccChHHHHcchhhhcCCCCceeCCCCcccc
Q psy12011         31 MFACDLCDKEYKYKRNLYSHKKDECGQEPRFQCPQCSYRT   70 (94)
Q Consensus        31 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f   70 (94)
                      .|+|..|+..+.      .+.+.. .... |.|..|+..+
T Consensus       112 ~y~C~~C~~~~~------~~rr~~-~~~~-y~C~~C~g~l  143 (146)
T smart00731      112 PYRCTGCGQRYL------RVRRSN-NVSR-YRCGKCGGKL  143 (146)
T ss_pred             EEECCCCCCCCc------eEcccc-Ccce-EEcCCCCCEE
Confidence            466766765542      111111 1134 7777776543


No 120
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=62.30  E-value=7.3  Score=16.76  Aligned_cols=21  Identities=29%  Similarity=0.782  Sum_probs=14.8

Q ss_pred             eeCCCCcccccchhHHHHHHH
Q psy12011         61 FQCPQCSYRTKRKGNLKSHLA   81 (94)
Q Consensus        61 ~~c~~c~~~f~~~~~l~~h~~   81 (94)
                      |+|-+|.....-.+.|-.|++
T Consensus        21 ykcfqcpftc~~kshl~nhmk   41 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMK   41 (54)
T ss_pred             ceeecCCcccchHHHHHHHHH
Confidence            577777766667777777765


No 121
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=61.61  E-value=4.5  Score=18.18  Aligned_cols=14  Identities=14%  Similarity=0.261  Sum_probs=7.6

Q ss_pred             ecCCCCccccchhc
Q psy12011         10 FCGLFPESFLTWSN   23 (94)
Q Consensus        10 ~c~~c~~~~~~~~~   23 (94)
                      .|+.|++.|....+
T Consensus         7 ~C~~Cg~~~~~~dD   20 (54)
T PF14446_consen    7 KCPVCGKKFKDGDD   20 (54)
T ss_pred             cChhhCCcccCCCC
Confidence            46666666554433


No 122
>KOG0782|consensus
Probab=61.59  E-value=1.8  Score=29.07  Aligned_cols=36  Identities=17%  Similarity=0.309  Sum_probs=21.5

Q ss_pred             ecCCCCccccchhccCCCCCCccccccchhhccChH
Q psy12011         10 FCGLFPESFLTWSNLKPNLNGMFACDLCDKEYKYKR   45 (94)
Q Consensus        10 ~c~~c~~~~~~~~~l~~~~~k~~~c~~c~~~~~~~~   45 (94)
                      +|..|+|.|.++..+..-......|+.|...|..+.
T Consensus       255 kC~~CgKgFQQKf~FhsKEivAisCSWCKqayH~Kv  290 (1004)
T KOG0782|consen  255 KCNTCGKGFQQKFFFHSKEIVAISCSWCKQAYHLKV  290 (1004)
T ss_pred             ccchhhhhhhhheeeccccEEEEEehHHHHHhhcch
Confidence            477777777776654433333456777776665553


No 123
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=60.98  E-value=5.3  Score=16.68  Aligned_cols=28  Identities=14%  Similarity=0.187  Sum_probs=12.1

Q ss_pred             eecCCCCccccchhccCCCCCCccccccchhh
Q psy12011          9 HFCGLFPESFLTWSNLKPNLNGMFACDLCDKE   40 (94)
Q Consensus         9 ~~c~~c~~~~~~~~~l~~~~~k~~~c~~c~~~   40 (94)
                      +.|+.|+....    +.......+.|..||..
T Consensus         1 m~Cp~Cg~~~~----~~D~~~g~~vC~~CG~V   28 (43)
T PF08271_consen    1 MKCPNCGSKEI----VFDPERGELVCPNCGLV   28 (43)
T ss_dssp             ESBTTTSSSEE----EEETTTTEEEETTT-BB
T ss_pred             CCCcCCcCCce----EEcCCCCeEECCCCCCE
Confidence            35666665321    11223334456666543


No 124
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=60.97  E-value=6.1  Score=25.47  Aligned_cols=30  Identities=13%  Similarity=0.210  Sum_probs=18.1

Q ss_pred             ecCCCCccccchhccCCCCCCccccccchhhccChH
Q psy12011         10 FCGLFPESFLTWSNLKPNLNGMFACDLCDKEYKYKR   45 (94)
Q Consensus        10 ~c~~c~~~~~~~~~l~~~~~k~~~c~~c~~~~~~~~   45 (94)
                      +|+.||..+...      |.+-|+|..||..+....
T Consensus       352 ~Cp~Cg~~m~S~------G~~g~rC~kCg~~~~~~~  381 (421)
T COG1571         352 VCPRCGGRMKSA------GRNGFRCKKCGTRARETL  381 (421)
T ss_pred             CCCccCCchhhc------CCCCcccccccccCCccc
Confidence            477777654332      233677888877665543


No 125
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=60.49  E-value=8.7  Score=20.74  Aligned_cols=57  Identities=25%  Similarity=0.448  Sum_probs=32.9

Q ss_pred             CCceeecCCCCccccchhccCCCCCCcccc---ccchhhccChHHHHcchhhhcCCCCceeCCCCcccccchhH
Q psy12011          5 NLQVHFCGLFPESFLTWSNLKPNLNGMFAC---DLCDKEYKYKRNLYSHKKDECGQEPRFQCPQCSYRTKRKGN   75 (94)
Q Consensus         5 ~~~~~~c~~c~~~~~~~~~l~~~~~k~~~c---~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~   75 (94)
                      +.+.|.|..|..++....-|+     |-+|   .+|+.-+   ..|+++-..+    |  .|++|..+|.+++.
T Consensus        77 d~~lYeCnIC~etS~ee~FLK-----PneCCgY~iCn~Cy---a~LWK~~~~y----p--vCPvCkTSFKss~~  136 (140)
T PF05290_consen   77 DPKLYECNICKETSAEERFLK-----PNECCGYSICNACY---ANLWKFCNLY----P--VCPVCKTSFKSSSS  136 (140)
T ss_pred             CCCceeccCcccccchhhcCC-----cccccchHHHHHHH---HHHHHHcccC----C--CCCccccccccccc
Confidence            347889999988766555443     3233   3333222   3344443322    2  78899888877643


No 126
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=60.37  E-value=5.8  Score=21.45  Aligned_cols=31  Identities=26%  Similarity=0.840  Sum_probs=15.3

Q ss_pred             ccccccchhhccChHHHHcchhhhcCCCCceeCCCCcccc
Q psy12011         31 MFACDLCDKEYKYKRNLYSHKKDECGQEPRFQCPQCSYRT   70 (94)
Q Consensus        31 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f   70 (94)
                      .|.|..|+..+..      +.+.  .... +.|..|+..+
T Consensus       123 ~~~C~~C~~~~~r------~~~~--~~~~-~~C~~C~~~l  153 (157)
T PF10263_consen  123 VYRCPSCGREYKR------HRRS--KRKR-YRCGRCGGPL  153 (157)
T ss_pred             EEEcCCCCCEeee------eccc--chhh-EECCCCCCEE
Confidence            3567777655422      2222  1233 6777776443


No 127
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=59.78  E-value=4.5  Score=16.99  Aligned_cols=17  Identities=18%  Similarity=0.071  Sum_probs=9.8

Q ss_pred             ceeecCCCCccccchhc
Q psy12011          7 QVHFCGLFPESFLTWSN   23 (94)
Q Consensus         7 ~~~~c~~c~~~~~~~~~   23 (94)
                      -++.|+.|++.|-..-.
T Consensus        12 ~~~~C~~C~~~FC~~Hr   28 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLKHR   28 (43)
T ss_dssp             SHEE-TTTS-EE-TTTH
T ss_pred             CCeECCCCCcccCcccc
Confidence            47888888888765443


No 128
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=59.33  E-value=4.3  Score=22.34  Aligned_cols=29  Identities=21%  Similarity=0.568  Sum_probs=14.7

Q ss_pred             eeCCCCcccccchhHHHHHHHHhcCcccCCCCCC
Q psy12011         61 FQCPQCSYRTKRKGNLKSHLAIRHECYLDDSANC   94 (94)
Q Consensus        61 ~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~c~~C   94 (94)
                      |.|. |+..+...   ++|-..-.|+ .|.|-.|
T Consensus       118 Y~C~-C~q~~l~~---RRhn~~~~g~-~YrC~~C  146 (156)
T COG3091         118 YRCQ-CQQHYLRI---RRHNTVRRGE-VYRCGKC  146 (156)
T ss_pred             EEee-cCCccchh---hhcccccccc-eEEeccC
Confidence            6666 65544333   3444444444 5666554


No 129
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=58.78  E-value=5.8  Score=18.27  Aligned_cols=30  Identities=13%  Similarity=0.283  Sum_probs=11.7

Q ss_pred             eeecCCCCccccchhccCCCCCCccccccchhhccCh
Q psy12011          8 VHFCGLFPESFLTWSNLKPNLNGMFACDLCDKEYKYK   44 (94)
Q Consensus         8 ~~~c~~c~~~~~~~~~l~~~~~k~~~c~~c~~~~~~~   44 (94)
                      .-.|..|++.|...       .+.+.|..||..|-..
T Consensus         9 ~~~C~~C~~~F~~~-------~rrhhCr~CG~~vC~~   38 (69)
T PF01363_consen    9 ASNCMICGKKFSLF-------RRRHHCRNCGRVVCSS   38 (69)
T ss_dssp             -SB-TTT--B-BSS-------S-EEE-TTT--EEECC
T ss_pred             CCcCcCcCCcCCCc-------eeeEccCCCCCEECCc
Confidence            45577777777432       3355666666665543


No 130
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=58.39  E-value=9.5  Score=23.67  Aligned_cols=59  Identities=22%  Similarity=0.348  Sum_probs=43.9

Q ss_pred             CCccccccchhhccChHHHHcchhhhcCCCCceeCCCC--cccccchhHHHHHHHHhcCccc
Q psy12011         29 NGMFACDLCDKEYKYKRNLYSHKKDECGQEPRFQCPQC--SYRTKRKGNLKSHLAIRHECYL   88 (94)
Q Consensus        29 ~k~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c--~~~f~~~~~l~~h~~~~~~~~~   88 (94)
                      ...+.|..|...|........|...+.++++ +.|...  ...+.....+.+|.+.++....
T Consensus        31 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   91 (467)
T COG5048          31 PRPDSCPNCTDSFSRLEHLTRHIRSHTGEKP-SQCSYSGCDKSFSRPLELSRHLRTHHNNPS   91 (467)
T ss_pred             CchhhcccccccccccchhhhhcccccccCC-ccccccccccccCCcchhhhhccccccccc
Confidence            3567788888888888888888888988877 888664  4566667777777776665443


No 131
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=57.95  E-value=4.5  Score=15.56  Aligned_cols=9  Identities=33%  Similarity=1.029  Sum_probs=4.5

Q ss_pred             ccccchhhc
Q psy12011         33 ACDLCDKEY   41 (94)
Q Consensus        33 ~c~~c~~~~   41 (94)
                      .|..|++.|
T Consensus         2 sCiDC~~~F   10 (28)
T PF08790_consen    2 SCIDCSKDF   10 (28)
T ss_dssp             EETTTTEEE
T ss_pred             eeecCCCCc
Confidence            344555555


No 132
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=57.76  E-value=8.3  Score=20.02  Aligned_cols=11  Identities=18%  Similarity=0.181  Sum_probs=6.1

Q ss_pred             ccccccchhhc
Q psy12011         31 MFACDLCDKEY   41 (94)
Q Consensus        31 ~~~c~~c~~~~   41 (94)
                      ...|..|+..|
T Consensus        70 ~~~C~~Cg~~~   80 (113)
T PRK12380         70 QAWCWDCSQVV   80 (113)
T ss_pred             EEEcccCCCEE
Confidence            35566666444


No 133
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=57.36  E-value=6.8  Score=21.42  Aligned_cols=9  Identities=22%  Similarity=0.922  Sum_probs=5.1

Q ss_pred             ccccccchh
Q psy12011         31 MFACDLCDK   39 (94)
Q Consensus        31 ~~~c~~c~~   39 (94)
                      .+.|..||.
T Consensus       112 ~l~C~~Cg~  120 (146)
T PF07295_consen  112 TLVCENCGH  120 (146)
T ss_pred             eEecccCCC
Confidence            456666653


No 134
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=56.59  E-value=7.4  Score=20.15  Aligned_cols=11  Identities=27%  Similarity=0.800  Sum_probs=4.7

Q ss_pred             cccccchhhcc
Q psy12011         32 FACDLCDKEYK   42 (94)
Q Consensus        32 ~~c~~c~~~~~   42 (94)
                      ..|..||..|.
T Consensus        71 ~~C~~Cg~~~~   81 (113)
T PF01155_consen   71 ARCRDCGHEFE   81 (113)
T ss_dssp             EEETTTS-EEE
T ss_pred             EECCCCCCEEe
Confidence            34555554443


No 135
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=55.57  E-value=9.6  Score=26.52  Aligned_cols=11  Identities=18%  Similarity=0.317  Sum_probs=5.3

Q ss_pred             CCccccccchh
Q psy12011         29 NGMFACDLCDK   39 (94)
Q Consensus        29 ~k~~~c~~c~~   39 (94)
                      ..|..|+.||.
T Consensus       473 ~~p~~Cp~Cgs  483 (730)
T COG1198         473 PIPQSCPECGS  483 (730)
T ss_pred             CCCCCCCCCCC
Confidence            34455555543


No 136
>PLN02294 cytochrome c oxidase subunit Vb
Probab=55.23  E-value=7.5  Score=21.88  Aligned_cols=15  Identities=13%  Similarity=0.131  Sum_probs=9.5

Q ss_pred             CceeecCCCCccccc
Q psy12011          6 LQVHFCGLFPESFLT   20 (94)
Q Consensus         6 ~~~~~c~~c~~~~~~   20 (94)
                      .+++.|+.||..|.-
T Consensus       139 Gkp~RCpeCG~~fkL  153 (174)
T PLN02294        139 GKSFECPVCTQYFEL  153 (174)
T ss_pred             CCceeCCCCCCEEEE
Confidence            356777777766543


No 137
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=54.57  E-value=5.8  Score=17.46  Aligned_cols=12  Identities=17%  Similarity=0.144  Sum_probs=5.5

Q ss_pred             ecCCCCccccch
Q psy12011         10 FCGLFPESFLTW   21 (94)
Q Consensus        10 ~c~~c~~~~~~~   21 (94)
                      .||.|+..|...
T Consensus        22 ~CPlC~r~l~~e   33 (54)
T PF04423_consen   22 CCPLCGRPLDEE   33 (54)
T ss_dssp             E-TTT--EE-HH
T ss_pred             cCCCCCCCCCHH
Confidence            788888776543


No 138
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=54.02  E-value=4.9  Score=17.83  Aligned_cols=15  Identities=7%  Similarity=-0.064  Sum_probs=7.7

Q ss_pred             CCceeecCCCCcccc
Q psy12011          5 NLQVHFCGLFPESFL   19 (94)
Q Consensus         5 ~~~~~~c~~c~~~~~   19 (94)
                      +...++|.+|++.+.
T Consensus        32 ~~~~~rC~YCe~~~~   46 (52)
T PF02748_consen   32 EPIKLRCHYCERIIT   46 (52)
T ss_dssp             TTCEEEETTT--EEE
T ss_pred             CCCEEEeeCCCCEec
Confidence            344566777776554


No 139
>KOG4167|consensus
Probab=53.46  E-value=3.5  Score=28.50  Aligned_cols=26  Identities=27%  Similarity=0.544  Sum_probs=22.4

Q ss_pred             CccccccchhhccChHHHHcchhhhc
Q psy12011         30 GMFACDLCDKEYKYKRNLYSHKKDEC   55 (94)
Q Consensus        30 k~~~c~~c~~~~~~~~~l~~h~~~~~   55 (94)
                      .-|.|.+|++.|.--.++..||+.|.
T Consensus       791 giFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  791 GIFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             ceeehHHHHHHHHHHhhhhHHHHHHH
Confidence            35789999999988888899998885


No 140
>PF14353 CpXC:  CpXC protein
Probab=53.40  E-value=8.8  Score=20.15  Aligned_cols=19  Identities=16%  Similarity=-0.027  Sum_probs=14.6

Q ss_pred             ceeecCCCCccccchhccC
Q psy12011          7 QVHFCGLFPESFLTWSNLK   25 (94)
Q Consensus         7 ~~~~c~~c~~~~~~~~~l~   25 (94)
                      -.+.|+.||..|.-...+.
T Consensus        37 ~~~~CP~Cg~~~~~~~p~l   55 (128)
T PF14353_consen   37 FSFTCPSCGHKFRLEYPLL   55 (128)
T ss_pred             CEEECCCCCCceecCCCEE
Confidence            3588999999887666555


No 141
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=52.99  E-value=8.7  Score=21.75  Aligned_cols=9  Identities=44%  Similarity=1.350  Sum_probs=5.1

Q ss_pred             eeCCCCccc
Q psy12011         61 FQCPQCSYR   69 (94)
Q Consensus        61 ~~c~~c~~~   69 (94)
                      |.|+.||-.
T Consensus       133 F~Cp~Cg~~  141 (176)
T COG1675         133 FTCPKCGED  141 (176)
T ss_pred             CCCCCCCch
Confidence            566666643


No 142
>PF05180 zf-DNL:  DNL zinc finger;  InterPro: IPR007853 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The DNL-type zinc finger is found in Tim15, a zinc finger protein essential for protein import into mitochondria. Mitochondrial functions rely on the correct transport of resident proteins synthesized in the cytosol to mitochondria. Protein import into mitochondria is mediated by membrane protein complexes, protein translocators, in the outer and inner mitochondrial membranes, in cooperation with their assistant proteins in the cytosol, intermembrane space and matrix. Proteins destined to the mitochondrial matrix cross the outer membrane with the aid of the outer membrane translocator, the tOM40 complex, and then the inner membrane with the aid of the inner membrane translocator, the TIM23 complex, and mitochondrial motor and chaperone (MMC) proteins including mitochondrial heat- shock protein 70 (mtHsp70), and translocase in the inner mitochondrial membrane (Tim)15. Tim15 is also known as zinc finger motif (Zim)17 or mtHsp70 escort protein (Hep)1. Tim15 contains a zinc-finger motif (CXXC and CXXC) of ~100 residues, which has been named DNL after a short C-terminal motif of D(N/H)L [, , ]. The DNL-type zinc finger is an L-shaped molecule. The two CXXC motifs are located at the end of the L, and are sandwiched by two- stranded antiparallel beta-sheets. Two short alpha-helices constitute another leg of the L. The outer (convex) face of the L has a large acidic groove, which is lined with five acidic residues, whereas the inner (concave) face of the L has two positively charged residues, next to the CXXC motifs []. This entry represents the DNL-type zinc finger.; GO: 0008270 zinc ion binding; PDB: 2E2Z_A.
Probab=52.70  E-value=5.8  Score=18.61  Aligned_cols=34  Identities=29%  Similarity=0.606  Sum_probs=14.5

Q ss_pred             cccccchhhccChHHHHcchhhhcCCCCceeCCCCccc
Q psy12011         32 FACDLCDKEYKYKRNLYSHKKDECGQEPRFQCPQCSYR   69 (94)
Q Consensus        32 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~   69 (94)
                      |.|..|+..-..  .+ ..+.-+.|..- .+|+.|...
T Consensus         5 FTC~~C~~Rs~~--~~-sk~aY~~GvVi-v~C~gC~~~   38 (66)
T PF05180_consen    5 FTCNKCGTRSAK--MF-SKQAYHKGVVI-VQCPGCKNR   38 (66)
T ss_dssp             EEETTTTEEEEE--EE-EHHHHHTSEEE-EE-TTS--E
T ss_pred             EEcCCCCCccce--ee-CHHHHhCCeEE-EECCCCcce
Confidence            667777632211  11 11223445333 788888643


No 143
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=52.65  E-value=12  Score=20.09  Aligned_cols=15  Identities=13%  Similarity=0.023  Sum_probs=10.2

Q ss_pred             ceeecCCCCccccch
Q psy12011          7 QVHFCGLFPESFLTW   21 (94)
Q Consensus         7 ~~~~c~~c~~~~~~~   21 (94)
                      ..+.|..||..|...
T Consensus        69 ~~~~C~~CG~~~~~~   83 (135)
T PRK03824         69 AVLKCRNCGNEWSLK   83 (135)
T ss_pred             eEEECCCCCCEEecc
Confidence            457788888766553


No 144
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=51.90  E-value=13  Score=15.37  Aligned_cols=9  Identities=33%  Similarity=1.150  Sum_probs=4.3

Q ss_pred             eeCCCCccc
Q psy12011         61 FQCPQCSYR   69 (94)
Q Consensus        61 ~~c~~c~~~   69 (94)
                      |.|..|+..
T Consensus        29 y~C~~C~~~   37 (40)
T smart00440       29 YVCTKCGHR   37 (40)
T ss_pred             EEeCCCCCE
Confidence            455555443


No 145
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=51.50  E-value=13  Score=19.40  Aligned_cols=13  Identities=23%  Similarity=0.516  Sum_probs=7.3

Q ss_pred             ccccccchhhccC
Q psy12011         31 MFACDLCDKEYKY   43 (94)
Q Consensus        31 ~~~c~~c~~~~~~   43 (94)
                      ...|..|+..|..
T Consensus        70 ~~~C~~Cg~~~~~   82 (115)
T TIGR00100        70 ECECEDCSEEVSP   82 (115)
T ss_pred             EEEcccCCCEEec
Confidence            3566666655433


No 146
>PF08394 Arc_trans_TRASH:  Archaeal TRASH domain;  InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators. It is thought to function as a metal-sensing regulatory module []. 
Probab=51.36  E-value=5  Score=16.51  Aligned_cols=9  Identities=11%  Similarity=0.309  Sum_probs=4.2

Q ss_pred             cCCCCcccc
Q psy12011         11 CGLFPESFL   19 (94)
Q Consensus        11 c~~c~~~~~   19 (94)
                      |.+||....
T Consensus         1 Cd~CG~~I~    9 (37)
T PF08394_consen    1 CDYCGGEIT    9 (37)
T ss_pred             CCccCCccc
Confidence            445555433


No 147
>PRK04351 hypothetical protein; Provisional
Probab=51.25  E-value=14  Score=20.30  Aligned_cols=32  Identities=19%  Similarity=0.706  Sum_probs=18.2

Q ss_pred             ccccccchhhccChHHHHcchhhhcCCCCceeCCCCccccc
Q psy12011         31 MFACDLCDKEYKYKRNLYSHKKDECGQEPRFQCPQCSYRTK   71 (94)
Q Consensus        31 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~   71 (94)
                      .|+|..|+..+..      + +.+ .... |.|..|+..+.
T Consensus       112 ~Y~C~~Cg~~~~r------~-Rr~-n~~~-yrCg~C~g~L~  143 (149)
T PRK04351        112 LYECQSCGQQYLR------K-RRI-NTKR-YRCGKCRGKLK  143 (149)
T ss_pred             EEECCCCCCEeee------e-eec-CCCc-EEeCCCCcEee
Confidence            3678778755422      1 122 2255 88888876554


No 148
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=51.11  E-value=9.4  Score=15.39  Aligned_cols=16  Identities=19%  Similarity=0.233  Sum_probs=7.4

Q ss_pred             ecCCCCccccchhccC
Q psy12011         10 FCGLFPESFLTWSNLK   25 (94)
Q Consensus        10 ~c~~c~~~~~~~~~l~   25 (94)
                      .|..|++.|....-+.
T Consensus         5 ~C~eC~~~f~dSyL~~   20 (34)
T PF01286_consen    5 KCDECGKPFMDSYLLN   20 (34)
T ss_dssp             E-TTT--EES-SSCCC
T ss_pred             hHhHhCCHHHHHHHHH
Confidence            5777777777655443


No 149
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=50.96  E-value=18  Score=18.45  Aligned_cols=34  Identities=9%  Similarity=0.163  Sum_probs=15.4

Q ss_pred             ceeecCCCCccccchhccCCCCCCccccccchhhcc
Q psy12011          7 QVHFCGLFPESFLTWSNLKPNLNGMFACDLCDKEYK   42 (94)
Q Consensus         7 ~~~~c~~c~~~~~~~~~l~~~~~k~~~c~~c~~~~~   42 (94)
                      ..|.|+.|+.. ...-.+ ..+.....|..||..+.
T Consensus        20 t~f~CP~Cge~-~v~v~~-~k~~~h~~C~~CG~y~~   53 (99)
T PRK14892         20 KIFECPRCGKV-SISVKI-KKNIAIITCGNCGLYTE   53 (99)
T ss_pred             cEeECCCCCCe-Eeeeec-CCCcceEECCCCCCccC
Confidence            45667777731 111111 11333445666665443


No 150
>KOG3507|consensus
Probab=50.74  E-value=19  Score=16.47  Aligned_cols=12  Identities=33%  Similarity=0.963  Sum_probs=7.0

Q ss_pred             eeCCCCcccccc
Q psy12011         61 FQCPQCSYRTKR   72 (94)
Q Consensus        61 ~~c~~c~~~f~~   72 (94)
                      ++|.+||.....
T Consensus        38 irCReCG~RIly   49 (62)
T KOG3507|consen   38 IRCRECGYRILY   49 (62)
T ss_pred             EehhhcchHHHH
Confidence            666666655443


No 151
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=49.46  E-value=11  Score=15.36  Aligned_cols=12  Identities=8%  Similarity=0.055  Sum_probs=6.1

Q ss_pred             ceeecCCCCccc
Q psy12011          7 QVHFCGLFPESF   18 (94)
Q Consensus         7 ~~~~c~~c~~~~   18 (94)
                      +.|+|..||...
T Consensus         5 ~~YkC~~CGniV   16 (36)
T PF06397_consen    5 EFYKCEHCGNIV   16 (36)
T ss_dssp             EEEE-TTT--EE
T ss_pred             cEEEccCCCCEE
Confidence            567888887653


No 152
>PF12773 DZR:  Double zinc ribbon
Probab=49.42  E-value=17  Score=15.50  Aligned_cols=9  Identities=33%  Similarity=0.914  Sum_probs=4.9

Q ss_pred             eeCCCCccc
Q psy12011         61 FQCPQCSYR   69 (94)
Q Consensus        61 ~~c~~c~~~   69 (94)
                      ..|+.|+..
T Consensus        30 ~~C~~Cg~~   38 (50)
T PF12773_consen   30 KICPNCGAE   38 (50)
T ss_pred             CCCcCCcCC
Confidence            455666544


No 153
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=49.18  E-value=9.5  Score=17.20  Aligned_cols=15  Identities=7%  Similarity=0.284  Sum_probs=6.1

Q ss_pred             ccccccchhhccChH
Q psy12011         31 MFACDLCDKEYKYKR   45 (94)
Q Consensus        31 ~~~c~~c~~~~~~~~   45 (94)
                      |.....|+-.|...+
T Consensus        24 PV~s~~C~H~fek~a   38 (57)
T PF11789_consen   24 PVKSKKCGHTFEKEA   38 (57)
T ss_dssp             EEEESSS--EEEHHH
T ss_pred             CcCcCCCCCeecHHH
Confidence            444445555554443


No 154
>COG2879 Uncharacterized small protein [Function unknown]
Probab=49.13  E-value=21  Score=16.61  Aligned_cols=19  Identities=16%  Similarity=0.055  Sum_probs=14.0

Q ss_pred             chhHHHHHHHHhcCcccCC
Q psy12011         72 RKGNLKSHLAIRHECYLDD   90 (94)
Q Consensus        72 ~~~~l~~h~~~~~~~~~~~   90 (94)
                      .-.+.-.|++.+|+++|.-
T Consensus        24 dYdnYVehmr~~hPd~p~m   42 (65)
T COG2879          24 DYDNYVEHMRKKHPDKPPM   42 (65)
T ss_pred             cHHHHHHHHHHhCcCCCcc
Confidence            3455668999999988853


No 155
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=48.55  E-value=12  Score=16.34  Aligned_cols=27  Identities=15%  Similarity=0.221  Sum_probs=14.8

Q ss_pred             ecCCCCccccchhccCCCCCCccccccchhhccC
Q psy12011         10 FCGLFPESFLTWSNLKPNLNGMFACDLCDKEYKY   43 (94)
Q Consensus        10 ~c~~c~~~~~~~~~l~~~~~k~~~c~~c~~~~~~   43 (94)
                      .|..|++.|...       .+.+.|..||+.|-.
T Consensus         4 ~C~~C~~~F~~~-------~rk~~Cr~Cg~~~C~   30 (57)
T cd00065           4 SCMGCGKPFTLT-------RRRHHCRNCGRIFCS   30 (57)
T ss_pred             cCcccCccccCC-------ccccccCcCcCCcCh
Confidence            466666666552       224556666666544


No 156
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=48.43  E-value=8.9  Score=17.71  Aligned_cols=12  Identities=8%  Similarity=0.232  Sum_probs=8.8

Q ss_pred             eeecCCCCcccc
Q psy12011          8 VHFCGLFPESFL   19 (94)
Q Consensus         8 ~~~c~~c~~~~~   19 (94)
                      --.|++|+..|.
T Consensus        48 ev~CPYC~t~y~   59 (62)
T COG4391          48 EVVCPYCSTRYR   59 (62)
T ss_pred             cEecCccccEEE
Confidence            346899988765


No 157
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=47.72  E-value=9.1  Score=19.42  Aligned_cols=22  Identities=32%  Similarity=0.475  Sum_probs=16.2

Q ss_pred             HcchhhhcCCCCceeCCCCccccc
Q psy12011         48 YSHKKDECGQEPRFQCPQCSYRTK   71 (94)
Q Consensus        48 ~~h~~~~~~~~~~~~c~~c~~~f~   71 (94)
                      ..++..+.+ ++ .+|.+||..|.
T Consensus        69 v~W~~l~~g-~~-~rC~eCG~~fk   90 (97)
T cd00924          69 VIWMWLEKG-KP-KRCPECGHVFK   90 (97)
T ss_pred             EEEEEEeCC-Cc-eeCCCCCcEEE
Confidence            345566666 56 99999998875


No 158
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=47.09  E-value=13  Score=16.26  Aligned_cols=9  Identities=33%  Similarity=1.320  Sum_probs=5.7

Q ss_pred             eeCCCCccc
Q psy12011         61 FQCPQCSYR   69 (94)
Q Consensus        61 ~~c~~c~~~   69 (94)
                      +.|..||..
T Consensus        38 ~~C~~Cgyt   46 (50)
T PRK00432         38 WHCGKCGYT   46 (50)
T ss_pred             EECCCcCCE
Confidence            667766644


No 159
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=46.64  E-value=5.4  Score=18.08  Aligned_cols=6  Identities=33%  Similarity=1.558  Sum_probs=3.2

Q ss_pred             eeCCCC
Q psy12011         61 FQCPQC   66 (94)
Q Consensus        61 ~~c~~c   66 (94)
                      |-|..|
T Consensus        32 YmC~eC   37 (56)
T PF09963_consen   32 YMCDEC   37 (56)
T ss_pred             eeChhH
Confidence            555555


No 160
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=46.38  E-value=12  Score=20.26  Aligned_cols=16  Identities=19%  Similarity=0.530  Sum_probs=11.2

Q ss_pred             eeCCCCcccccchhHH
Q psy12011         61 FQCPQCSYRTKRKGNL   76 (94)
Q Consensus        61 ~~c~~c~~~f~~~~~l   76 (94)
                      +.|+.|++.|=..+.+
T Consensus       125 ~~C~~C~kiyW~GsH~  140 (147)
T PF01927_consen  125 WRCPGCGKIYWEGSHW  140 (147)
T ss_pred             EECCCCCCEecccccH
Confidence            7888888877554443


No 161
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=46.25  E-value=18  Score=15.46  Aligned_cols=11  Identities=36%  Similarity=0.754  Sum_probs=5.7

Q ss_pred             ccccccchhhc
Q psy12011         31 MFACDLCDKEY   41 (94)
Q Consensus        31 ~~~c~~c~~~~   41 (94)
                      .+.|+.||..+
T Consensus        20 ~~vC~~Cg~~~   30 (52)
T smart00661       20 RFVCRKCGYEE   30 (52)
T ss_pred             EEECCcCCCeE
Confidence            44555565443


No 162
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=45.01  E-value=18  Score=15.37  Aligned_cols=12  Identities=17%  Similarity=0.327  Sum_probs=6.3

Q ss_pred             ecCCCCccccch
Q psy12011         10 FCGLFPESFLTW   21 (94)
Q Consensus        10 ~c~~c~~~~~~~   21 (94)
                      .|.+|+..|...
T Consensus        10 ~C~~C~rpf~WR   21 (42)
T PF10013_consen   10 ICPVCGRPFTWR   21 (42)
T ss_pred             cCcccCCcchHH
Confidence            355555555543


No 163
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=44.38  E-value=17  Score=19.02  Aligned_cols=12  Identities=25%  Similarity=0.750  Sum_probs=6.7

Q ss_pred             ccccccchhhcc
Q psy12011         31 MFACDLCDKEYK   42 (94)
Q Consensus        31 ~~~c~~c~~~~~   42 (94)
                      ...|..||..|.
T Consensus        71 ~~~C~~Cg~~~~   82 (117)
T PRK00564         71 ELECKDCSHVFK   82 (117)
T ss_pred             EEEhhhCCCccc
Confidence            456666664443


No 164
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=44.37  E-value=26  Score=18.33  Aligned_cols=74  Identities=9%  Similarity=0.059  Sum_probs=42.5

Q ss_pred             eeecCCCCccccchhccC---C-------CCCC-------ccccccchhhccChHHHHcchhhhcCCCCceeCCCCcccc
Q psy12011          8 VHFCGLFPESFLTWSNLK---P-------NLNG-------MFACDLCDKEYKYKRNLYSHKKDECGQEPRFQCPQCSYRT   70 (94)
Q Consensus         8 ~~~c~~c~~~~~~~~~l~---~-------~~~k-------~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f   70 (94)
                      |-.|+.|+=......+|.   |       -.+.       ...|-.|...|........  ........ |.|..|...|
T Consensus        15 P~~CpiCgLtLVss~HLARSyHHLfPl~~f~ev~~~~~~~~~~C~~C~~~f~~~~~~~~--~~~~~~~~-y~C~~C~~~F   91 (112)
T TIGR00622        15 PVECPICGLTLILSTHLARSYHHLFPLKAFQEIPLEEYNGSRFCFGCQGPFPKPPVSPF--DELKDSHR-YVCAVCKNVF   91 (112)
T ss_pred             CCcCCcCCCEEeccchHHHhhhccCCCcccccccccccCCCCcccCcCCCCCCcccccc--cccccccc-eeCCCCCCcc
Confidence            567888887665555554   1       1111       1237778777765421110  00122245 9999999888


Q ss_pred             cchhHHHHHHHHhc
Q psy12011         71 KRKGNLKSHLAIRH   84 (94)
Q Consensus        71 ~~~~~l~~h~~~~~   84 (94)
                      =..-+.-.|...|.
T Consensus        92 C~dCD~fiHe~Lh~  105 (112)
T TIGR00622        92 CVDCDVFVHESLHC  105 (112)
T ss_pred             ccccchhhhhhccC
Confidence            77777667766554


No 165
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=43.95  E-value=14  Score=15.20  Aligned_cols=12  Identities=25%  Similarity=0.476  Sum_probs=7.1

Q ss_pred             eeecCCCCcccc
Q psy12011          8 VHFCGLFPESFL   19 (94)
Q Consensus         8 ~~~c~~c~~~~~   19 (94)
                      .+.|+.||..+.
T Consensus        32 ~~~C~~CGE~~~   43 (46)
T TIGR03831        32 ALVCPQCGEEYL   43 (46)
T ss_pred             ccccccCCCEee
Confidence            355777776543


No 166
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=43.86  E-value=17  Score=16.69  Aligned_cols=11  Identities=36%  Similarity=1.334  Sum_probs=7.6

Q ss_pred             eeCCCCccccc
Q psy12011         61 FQCPQCSYRTK   71 (94)
Q Consensus        61 ~~c~~c~~~f~   71 (94)
                      |.|+.||..+.
T Consensus        47 ~~C~~Cg~~~~   57 (69)
T PF07282_consen   47 FTCPNCGFEMD   57 (69)
T ss_pred             EEcCCCCCEEC
Confidence            77877776544


No 167
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=43.14  E-value=19  Score=18.74  Aligned_cols=11  Identities=18%  Similarity=0.504  Sum_probs=6.0

Q ss_pred             ccccccchhhc
Q psy12011         31 MFACDLCDKEY   41 (94)
Q Consensus        31 ~~~c~~c~~~~   41 (94)
                      ...|..|+..|
T Consensus        70 ~~~C~~Cg~~~   80 (114)
T PRK03681         70 ECWCETCQQYV   80 (114)
T ss_pred             EEEcccCCCee
Confidence            35566666443


No 169
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=42.90  E-value=13  Score=19.42  Aligned_cols=29  Identities=10%  Similarity=0.067  Sum_probs=17.1

Q ss_pred             eecCCCCccccchhccCCCCCCccccccchhhccC
Q psy12011          9 HFCGLFPESFLTWSNLKPNLNGMFACDLCDKEYKY   43 (94)
Q Consensus         9 ~~c~~c~~~~~~~~~l~~~~~k~~~c~~c~~~~~~   43 (94)
                      ..|+.|++.|.....      .|..|+.||++|..
T Consensus        10 ridPetg~KFYDLNr------dPiVsPytG~s~P~   38 (129)
T COG4530          10 RIDPETGKKFYDLNR------DPIVSPYTGKSYPR   38 (129)
T ss_pred             ccCccccchhhccCC------CccccCcccccchH
Confidence            356677777766552      35556666666633


No 170
>KOG2482|consensus
Probab=41.43  E-value=17  Score=23.04  Aligned_cols=22  Identities=27%  Similarity=0.546  Sum_probs=20.7

Q ss_pred             eeCCCCcccccchhHHHHHHHH
Q psy12011         61 FQCPQCSYRTKRKGNLKSHLAI   82 (94)
Q Consensus        61 ~~c~~c~~~f~~~~~l~~h~~~   82 (94)
                      +.|..|.+.|.-+..|+.||+.
T Consensus       196 ~~CLyCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  196 LRCLYCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             heeeeeccccCCcHHHHHHHHh
Confidence            7999999999999999999985


No 171
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=40.55  E-value=15  Score=21.81  Aligned_cols=18  Identities=17%  Similarity=0.182  Sum_probs=13.6

Q ss_pred             CCceeecCCCCccccchh
Q psy12011          5 NLQVHFCGLFPESFLTWS   22 (94)
Q Consensus         5 ~~~~~~c~~c~~~~~~~~   22 (94)
                      ..++++|+.||..|.-..
T Consensus       178 EGkpqRCpECGqVFKLVr  195 (268)
T PTZ00043        178 EGFLYRCGECDQIFMLVR  195 (268)
T ss_pred             CCCCccCCCCCcEEEEEE
Confidence            345889999998877644


No 172
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=40.43  E-value=18  Score=13.69  Aligned_cols=6  Identities=33%  Similarity=1.758  Sum_probs=2.2

Q ss_pred             eeCCCC
Q psy12011         61 FQCPQC   66 (94)
Q Consensus        61 ~~c~~c   66 (94)
                      |.|..|
T Consensus        16 Y~C~~C   21 (30)
T PF07649_consen   16 YRCSEC   21 (30)
T ss_dssp             EE-TTT
T ss_pred             EECccC
Confidence            444444


No 173
>PF10537 WAC_Acf1_DNA_bd:  ATP-utilising chromatin assembly and remodelling N-terminal;  InterPro: IPR013136 ACF (for ATP-utilising chromatin assembly and remodeling factor) is a chromatin-remodeling complex that catalyzes the ATP-dependent assembly of periodic nucleosome arrays. This reaction utilises the energy of ATP hydrolysis by ISWI, the smaller of the two subunits of ACF. Acf1, the large subunit of ACF, is essential for the full activity of the complex. The WAC (WSTF/Acf1/cbp146) domain is an ~110-residue module present at the N-termini of Acf1-related proteins in a variety of organisms. It is found in association with other domains such as the bromodomain, the PHD-type zinc finger, DDT or WAKS. The DNA-binding region of Acf1 includes the WAC domain, which is necessary for the efficient binding of ACF complex to DNA. It seems probable that the WAC domain will be involved in DNA binding in other related factors [, ].   Some proteins known to contain a WAC domain are the Drosophila melanogaster (Fruit fly) ATP-dependent chromatin assembly factor large subunit Acf1, human WSTF (Williams syndrome transcription factor), mouse cbp146, yeast imitation switch two complex protein 1 (ITC1 or YGL133w), and yeast protein YPL216w. 
Probab=40.02  E-value=36  Score=17.44  Aligned_cols=33  Identities=15%  Similarity=0.344  Sum_probs=16.9

Q ss_pred             ceeecCCCCccccchhccC----CCCCCccccccchh
Q psy12011          7 QVHFCGLFPESFLTWSNLK----PNLNGMFACDLCDK   39 (94)
Q Consensus         7 ~~~~c~~c~~~~~~~~~l~----~~~~k~~~c~~c~~   39 (94)
                      .+|.|+.-|..|.+...+.    --..+-|.|...|+
T Consensus         2 eVf~i~~T~EiF~dYe~Y~~R~~~y~~~vwtC~~TGk   38 (102)
T PF10537_consen    2 EVFYIPFTGEIFRDYEEYLKRMILYNQRVWTCEITGK   38 (102)
T ss_pred             ceEEeCCCCcccCCHHHHHHHHHHHhCCeeEEecCCC
Confidence            3566666666666555543    12334455555444


No 174
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=39.65  E-value=22  Score=13.66  Aligned_cols=7  Identities=43%  Similarity=1.606  Sum_probs=2.8

Q ss_pred             eeCCCCc
Q psy12011         61 FQCPQCS   67 (94)
Q Consensus        61 ~~c~~c~   67 (94)
                      |.|..|+
T Consensus        28 f~C~~C~   34 (39)
T smart00132       28 FKCSKCG   34 (39)
T ss_pred             CCCcccC
Confidence            3444443


No 175
>COG1773 Rubredoxin [Energy production and conversion]
Probab=39.37  E-value=16  Score=16.46  Aligned_cols=12  Identities=8%  Similarity=0.077  Sum_probs=7.5

Q ss_pred             eeecCCCCcccc
Q psy12011          8 VHFCGLFPESFL   19 (94)
Q Consensus         8 ~~~c~~c~~~~~   19 (94)
                      .|+|..||-.|.
T Consensus         3 ~~~C~~CG~vYd   14 (55)
T COG1773           3 RWRCSVCGYVYD   14 (55)
T ss_pred             ceEecCCceEec
Confidence            467777775544


No 176
>PRK12496 hypothetical protein; Provisional
Probab=39.21  E-value=27  Score=19.45  Aligned_cols=10  Identities=40%  Similarity=0.953  Sum_probs=5.6

Q ss_pred             cccccchhhc
Q psy12011         32 FACDLCDKEY   41 (94)
Q Consensus        32 ~~c~~c~~~~   41 (94)
                      +.|..|++.|
T Consensus       128 ~~C~gC~~~~  137 (164)
T PRK12496        128 KVCKGCKKKY  137 (164)
T ss_pred             EECCCCCccc
Confidence            4466666555


No 177
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=39.08  E-value=35  Score=14.18  Aligned_cols=23  Identities=22%  Similarity=0.391  Sum_probs=13.2

Q ss_pred             eeCCCCccccc--chhHHHHHHHHh
Q psy12011         61 FQCPQCSYRTK--RKGNLKSHLAIR   83 (94)
Q Consensus        61 ~~c~~c~~~f~--~~~~l~~h~~~~   83 (94)
                      ..|+.||-.+.  ...+-..|.+-|
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~~yH   38 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHKKYH   38 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHHHHH
Confidence            57777775554  344455565544


No 178
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=37.73  E-value=7.2  Score=23.14  Aligned_cols=9  Identities=44%  Similarity=1.206  Sum_probs=6.2

Q ss_pred             eeCCCCccc
Q psy12011         61 FQCPQCSYR   69 (94)
Q Consensus        61 ~~c~~c~~~   69 (94)
                      +.|+.|+.+
T Consensus        63 vvCP~C~yA   71 (267)
T COG1655          63 VVCPICYYA   71 (267)
T ss_pred             EEcchhhHH
Confidence            578888743


No 179
>KOG2932|consensus
Probab=37.71  E-value=50  Score=20.80  Aligned_cols=73  Identities=21%  Similarity=0.382  Sum_probs=41.6

Q ss_pred             CCCceeecCCCCccccchhccC---C-------CCCCccccccchhhccChHHHHcchhhhcCCCCceeCCC---Ccccc
Q psy12011          4 QNLQVHFCGLFPESFLTWSNLK---P-------NLNGMFACDLCDKEYKYKRNLYSHKKDECGQEPRFQCPQ---CSYRT   70 (94)
Q Consensus         4 ~~~~~~~c~~c~~~~~~~~~l~---~-------~~~k~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~---c~~~f   70 (94)
                      .+.++|-|..|+....-...|.   |       ..+.--.|..|...      +++ +..-..+-- |.|..   |.++|
T Consensus        86 l~p~VHfCd~Cd~PI~IYGRmIPCkHvFCl~CAr~~~dK~Cp~C~d~------Vqr-Ieq~~~g~i-FmC~~~~GC~RTy  157 (389)
T KOG2932|consen   86 LGPRVHFCDRCDFPIAIYGRMIPCKHVFCLECARSDSDKICPLCDDR------VQR-IEQIMMGGI-FMCAAPHGCLRTY  157 (389)
T ss_pred             cCcceEeecccCCcceeeecccccchhhhhhhhhcCccccCcCcccH------HHH-HHHhcccce-EEeecchhHHHHH
Confidence            3557899999998777766665   1       11111134444322      111 111122234 77754   77888


Q ss_pred             cchhHHHHHHHHhc
Q psy12011         71 KRKGNLKSHLAIRH   84 (94)
Q Consensus        71 ~~~~~l~~h~~~~~   84 (94)
                      .+.-+|..|+-.-|
T Consensus       158 LsqrDlqAHInhrH  171 (389)
T KOG2932|consen  158 LSQRDLQAHINHRH  171 (389)
T ss_pred             hhHHHHHHHhhhhh
Confidence            88888888876433


No 180
>PRK05978 hypothetical protein; Provisional
Probab=37.20  E-value=29  Score=19.14  Aligned_cols=6  Identities=33%  Similarity=0.551  Sum_probs=2.7

Q ss_pred             cCCCCc
Q psy12011         11 CGLFPE   16 (94)
Q Consensus        11 c~~c~~   16 (94)
                      |+.||+
T Consensus        36 CP~CG~   41 (148)
T PRK05978         36 CPACGE   41 (148)
T ss_pred             CCCCCC
Confidence            444443


No 181
>PF12907 zf-met2:  Zinc-binding
Probab=37.16  E-value=17  Score=15.26  Aligned_cols=22  Identities=23%  Similarity=0.363  Sum_probs=11.0

Q ss_pred             eeCCCCccccc---chhHHHHHHHH
Q psy12011         61 FQCPQCSYRTK---RKGNLKSHLAI   82 (94)
Q Consensus        61 ~~c~~c~~~f~---~~~~l~~h~~~   82 (94)
                      +.|.+|...|.   ....|..|...
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~en   26 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAEN   26 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHc
Confidence            45556654443   33445566553


No 182
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=36.58  E-value=27  Score=13.61  Aligned_cols=13  Identities=23%  Similarity=0.143  Sum_probs=9.2

Q ss_pred             CceeecCCCCccc
Q psy12011          6 LQVHFCGLFPESF   18 (94)
Q Consensus         6 ~~~~~c~~c~~~~   18 (94)
                      .+.|+|..||...
T Consensus         5 ~~~ykC~~Cgniv   17 (34)
T TIGR00319         5 GQVYKCEVCGNIV   17 (34)
T ss_pred             CcEEEcCCCCcEE
Confidence            3478888888654


No 183
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=36.56  E-value=27  Score=13.64  Aligned_cols=12  Identities=17%  Similarity=0.276  Sum_probs=7.8

Q ss_pred             ceeecCCCCccc
Q psy12011          7 QVHFCGLFPESF   18 (94)
Q Consensus         7 ~~~~c~~c~~~~   18 (94)
                      +.|+|..||...
T Consensus         3 ~~ykC~~CGniv   14 (34)
T cd00974           3 EVYKCEICGNIV   14 (34)
T ss_pred             cEEEcCCCCcEE
Confidence            467777777554


No 184
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=36.33  E-value=24  Score=15.50  Aligned_cols=27  Identities=33%  Similarity=0.847  Sum_probs=12.8

Q ss_pred             hHHHHcchhhhcCCCCceeCCC----Cccccc
Q psy12011         44 KRNLYSHKKDECGQEPRFQCPQ----CSYRTK   71 (94)
Q Consensus        44 ~~~l~~h~~~~~~~~~~~~c~~----c~~~f~   71 (94)
                      ...|..|....-...+ ..|..    |...+.
T Consensus        23 r~~l~~H~~~~C~~~~-v~C~~~~~GC~~~~~   53 (60)
T PF02176_consen   23 RKELDDHLENECPKRP-VPCPYSPYGCKERVP   53 (60)
T ss_dssp             CCCHHHHHHTTSTTSE-EE-SS----S--EEE
T ss_pred             HHHHHHHHHccCCCCc-EECCCCCCCCCCccc
Confidence            3446666664434344 67776    654443


No 185
>KOG2071|consensus
Probab=35.90  E-value=27  Score=23.72  Aligned_cols=24  Identities=25%  Similarity=0.515  Sum_probs=20.3

Q ss_pred             eeCCCCcccccchhHHHHHHHHhc
Q psy12011         61 FQCPQCSYRTKRKGNLKSHLAIRH   84 (94)
Q Consensus        61 ~~c~~c~~~f~~~~~l~~h~~~~~   84 (94)
                      -+|..||..|........||..|-
T Consensus       419 nqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  419 NQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             chhcccccccccchhhhhHhhhhh
Confidence            799999999998888887877664


No 186
>TIGR00143 hypF [NiFe] hydrogenase maturation protein HypF. A previously described regulatory effect of HypF mutatation is attributable to loss of activity of a regulatory hydrogenase. A zinc finger-like region CXXCX(18)CXXCX(24)CXXCX(18)CXXC region further supported the regulatory hypothesis. However, more recent work (PUBMED:11375153) shows the direct effect is on the activity of expressed hydrogenases with nickel/iron centers, rather than on expression.
Probab=35.46  E-value=29  Score=24.23  Aligned_cols=53  Identities=26%  Similarity=0.532  Sum_probs=32.5

Q ss_pred             cCCCCccccchhccC----CCCCCcc-ccccchhhccChHHHHcchhhhcCCCCceeCCCCcccc
Q psy12011         11 CGLFPESFLTWSNLK----PNLNGMF-ACDLCDKEYKYKRNLYSHKKDECGQEPRFQCPQCSYRT   70 (94)
Q Consensus        11 c~~c~~~~~~~~~l~----~~~~k~~-~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f   70 (94)
                      |..||-.|.-...|.    ++.-+.+ -|+.|.+.+..+.+    .+.|.  .+ ..|..||...
T Consensus        93 Ct~CGPr~~i~~~lpydr~~t~m~~f~~C~~C~~ey~~p~~----rr~h~--~~-~~C~~Cgp~l  150 (711)
T TIGR00143        93 CTHCGPRFTIIEALPYDRENTSMADFPLCPDCAKEYKDPLD----RRFHA--QP-IACPRCGPQL  150 (711)
T ss_pred             ccCCCCCeEEeecCCCCCCCcCCCCCcCCHHHHHHhcCCcc----ccCCC--CC-ccCCCCCcEE
Confidence            778888777666665    2222222 48888877766543    23332  34 8999999654


No 187
>PF11494 Ta0938:  Ta0938;  InterPro: IPR021585  Ta0938 is a protein of unknown function however the structure has been determined. The protein has a novel fold and a putative Zn-binding motif. The structure has two different parts, one region contains a beta sheet flanked by two alpha helices and the other contains a bundle of loops which contain all cysteines in the protein. ; PDB: 2FQH_A.
Probab=35.36  E-value=24  Score=17.96  Aligned_cols=38  Identities=24%  Similarity=0.400  Sum_probs=10.6

Q ss_pred             CCceeecCCCCccccchhccCCCCCCccccccchhhcc
Q psy12011          5 NLQVHFCGLFPESFLTWSNLKPNLNGMFACDLCDKEYK   42 (94)
Q Consensus         5 ~~~~~~c~~c~~~~~~~~~l~~~~~k~~~c~~c~~~~~   42 (94)
                      |.+.-.|..||+++.....=.....--|-|..|.+.|.
T Consensus        11 g~ke~~CalCG~tWg~~y~Ev~G~rLfFCCd~ca~EF~   48 (105)
T PF11494_consen   11 GTKEMGCALCGATWGDYYEEVDGERLFFCCDDCAKEFK   48 (105)
T ss_dssp             -SGGGS-SS---S---SS-B-TT--BSSS--SSSS-TT
T ss_pred             ccccccccccCCcHHHHHHhhcCCEEEEEcHHHHHHHH
Confidence            34444566666655533321122223345566655553


No 188
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=35.15  E-value=19  Score=19.52  Aligned_cols=13  Identities=15%  Similarity=0.207  Sum_probs=7.6

Q ss_pred             ceeecCCCCcccc
Q psy12011          7 QVHFCGLFPESFL   19 (94)
Q Consensus         7 ~~~~c~~c~~~~~   19 (94)
                      ++..|+.||..|.
T Consensus       111 ~~~RCpeCG~~fk  123 (136)
T PF01215_consen  111 KPQRCPECGQVFK  123 (136)
T ss_dssp             SEEEETTTEEEEE
T ss_pred             CccCCCCCCeEEE
Confidence            4566666665543


No 189
>PF09151 DUF1936:  Domain of unknown function (DUF1936);  InterPro: IPR015234 This domain is found in a set of hypothetical archaeal proteins. Its exact function has not, as yet, been defined. ; PDB: 2QH1_B 1PVM_B.
Probab=35.00  E-value=14  Score=14.50  Aligned_cols=9  Identities=22%  Similarity=0.442  Sum_probs=3.7

Q ss_pred             eecCCCCcc
Q psy12011          9 HFCGLFPES   17 (94)
Q Consensus         9 ~~c~~c~~~   17 (94)
                      +.|+.||..
T Consensus         2 hlcpkcgvg   10 (36)
T PF09151_consen    2 HLCPKCGVG   10 (36)
T ss_dssp             -B-TTTSSS
T ss_pred             ccCCccCce
Confidence            345556543


No 190
>KOG2636|consensus
Probab=34.33  E-value=25  Score=23.10  Aligned_cols=27  Identities=22%  Similarity=0.532  Sum_probs=21.5

Q ss_pred             CCCCCccccccch-hhccChHHHHcchh
Q psy12011         26 PNLNGMFACDLCD-KEYKYKRNLYSHKK   52 (94)
Q Consensus        26 ~~~~k~~~c~~c~-~~~~~~~~l~~h~~   52 (94)
                      |.-...|.|.+|| .++..+..+.+|-.
T Consensus       396 HGL~~ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  396 HGLDIEYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             cCCCcccceeeccCccccCcHHHHHHhH
Confidence            6667789999999 67777888887754


No 191
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=34.15  E-value=45  Score=20.82  Aligned_cols=11  Identities=27%  Similarity=0.516  Sum_probs=8.0

Q ss_pred             ceeecCCCCcc
Q psy12011          7 QVHFCGLFPES   17 (94)
Q Consensus         7 ~~~~c~~c~~~   17 (94)
                      ....|++||..
T Consensus       186 ~~~~CPvCGs~  196 (309)
T PRK03564        186 QRQFCPVCGSM  196 (309)
T ss_pred             CCCCCCCCCCc
Confidence            45679999864


No 192
>PRK11823 DNA repair protein RadA; Provisional
Probab=33.89  E-value=44  Score=21.85  Aligned_cols=15  Identities=7%  Similarity=-0.077  Sum_probs=10.3

Q ss_pred             CceeecCCCCccccc
Q psy12011          6 LQVHFCGLFPESFLT   20 (94)
Q Consensus         6 ~~~~~c~~c~~~~~~   20 (94)
                      ...|+|..||-.+..
T Consensus         5 ~~~y~C~~Cg~~~~~   19 (446)
T PRK11823          5 KTAYVCQECGAESPK   19 (446)
T ss_pred             CCeEECCcCCCCCcc
Confidence            346999999865443


No 193
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=33.79  E-value=28  Score=12.46  Aligned_cols=7  Identities=14%  Similarity=0.225  Sum_probs=3.2

Q ss_pred             cCCCCcc
Q psy12011         11 CGLFPES   17 (94)
Q Consensus        11 c~~c~~~   17 (94)
                      |+.||..
T Consensus         2 Cp~CG~~    8 (23)
T PF13240_consen    2 CPNCGAE    8 (23)
T ss_pred             CcccCCC
Confidence            4444443


No 194
>PRK11032 hypothetical protein; Provisional
Probab=33.44  E-value=43  Score=18.77  Aligned_cols=8  Identities=25%  Similarity=0.995  Sum_probs=4.8

Q ss_pred             ccccccch
Q psy12011         31 MFACDLCD   38 (94)
Q Consensus        31 ~~~c~~c~   38 (94)
                      ...|..||
T Consensus       124 ~LvC~~Cg  131 (160)
T PRK11032        124 NLVCEKCH  131 (160)
T ss_pred             eEEecCCC
Confidence            45666665


No 195
>PF04641 Rtf2:  Rtf2 RING-finger
Probab=33.40  E-value=32  Score=20.65  Aligned_cols=18  Identities=11%  Similarity=0.086  Sum_probs=13.1

Q ss_pred             CCceeecCCCCccccchh
Q psy12011          5 NLQVHFCGLFPESFLTWS   22 (94)
Q Consensus         5 ~~~~~~c~~c~~~~~~~~   22 (94)
                      ....|.|+..++.|....
T Consensus       110 ~~~~~~CPvt~~~~~~~~  127 (260)
T PF04641_consen  110 SEGRFICPVTGKEFNGKH  127 (260)
T ss_pred             CCceeECCCCCcccCCce
Confidence            456799999888775443


No 196
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=32.65  E-value=23  Score=15.75  Aligned_cols=13  Identities=15%  Similarity=0.105  Sum_probs=8.8

Q ss_pred             ecCCCCccccchh
Q psy12011         10 FCGLFPESFLTWS   22 (94)
Q Consensus        10 ~c~~c~~~~~~~~   22 (94)
                      .|++||..+...-
T Consensus         2 ~CPyCge~~~~~i   14 (52)
T PF14255_consen    2 QCPYCGEPIEILI   14 (52)
T ss_pred             CCCCCCCeeEEEE
Confidence            5888888765433


No 197
>PF06689 zf-C4_ClpX:  ClpX C4-type zinc finger;  InterPro: IPR010603 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The ClpX heat shock protein of Escherichia coli is a member of the universally conserved Hsp100 family of proteins, and possesses a putative zinc finger motif of the C4 type []. This presumed zinc binding domain (ZBD) is found at the N terminus of the ClpX protein. ClpX is an ATPase which functions both as a substrate specificity component of the ClpXP protease and as a molecular chaperone. ZBD is a member of the treble clef zinc finger family, a motif known to facilitate protein-ligand, protein-DNA, and protein-protein interactions and forms a constitutive dimer that is essential for the degradation of some, but not all, ClpX substrates []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0016887 ATPase activity, 0046983 protein dimerization activity, 0006200 ATP catabolic process, 0019538 protein metabolic process; PDB: 2DS8_B 2DS6_B 2DS5_A 1OVX_A 2DS7_A.
Probab=32.43  E-value=11  Score=15.72  Aligned_cols=28  Identities=25%  Similarity=0.482  Sum_probs=10.9

Q ss_pred             ecCCCCccccchhccCCCCCCccccccc
Q psy12011         10 FCGLFPESFLTWSNLKPNLNGMFACDLC   37 (94)
Q Consensus        10 ~c~~c~~~~~~~~~l~~~~~k~~~c~~c   37 (94)
                      .|..||+.-.....|.......+-|+.|
T Consensus         3 ~CSFCgr~~~~v~~li~g~~~~~IC~~C   30 (41)
T PF06689_consen    3 RCSFCGRPESEVGRLISGPNGAYICDEC   30 (41)
T ss_dssp             B-TTT--BTTTSSSEEEES-SEEEEHHH
T ss_pred             CccCCCCCHHHHhceecCCCCcEECHHH
Confidence            4666666544444333222135555554


No 198
>KOG2785|consensus
Probab=32.32  E-value=68  Score=20.74  Aligned_cols=51  Identities=24%  Similarity=0.332  Sum_probs=33.5

Q ss_pred             ccccccchhhccChHHHHcchhhhcCC-----------------------CCceeCCCCc---ccccchhHHHHHHHH
Q psy12011         31 MFACDLCDKEYKYKRNLYSHKKDECGQ-----------------------EPRFQCPQCS---YRTKRKGNLKSHLAI   82 (94)
Q Consensus        31 ~~~c~~c~~~~~~~~~l~~h~~~~~~~-----------------------~~~~~c~~c~---~~f~~~~~l~~h~~~   82 (94)
                      |-.|..|++.+..-..-..||..++|-                       .. +.|..|.   +.|.+..+.+.||..
T Consensus       166 Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~-~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  166 PTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIG-FICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             CcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccC-ceEEEeccccCcccccHHHHHHHhh
Confidence            345666666666555555566554432                       22 6676666   889999999999975


No 199
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=32.29  E-value=45  Score=13.51  Aligned_cols=6  Identities=33%  Similarity=1.658  Sum_probs=2.5

Q ss_pred             eeCCCC
Q psy12011         61 FQCPQC   66 (94)
Q Consensus        61 ~~c~~c   66 (94)
                      |.|..|
T Consensus        30 yrC~~C   35 (36)
T PF03811_consen   30 YRCKDC   35 (36)
T ss_pred             EecCcC
Confidence            444433


No 200
>KOG0978|consensus
Probab=32.26  E-value=13  Score=25.79  Aligned_cols=16  Identities=19%  Similarity=0.447  Sum_probs=11.6

Q ss_pred             eeCCCCcccccchhHH
Q psy12011         61 FQCPQCSYRTKRKGNL   76 (94)
Q Consensus        61 ~~c~~c~~~f~~~~~l   76 (94)
                      -+||.|+.+|.....+
T Consensus       679 RKCP~Cn~aFganDv~  694 (698)
T KOG0978|consen  679 RKCPKCNAAFGANDVH  694 (698)
T ss_pred             CCCCCCCCCCCccccc
Confidence            5788888888766443


No 201
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=32.12  E-value=42  Score=13.74  Aligned_cols=8  Identities=25%  Similarity=1.227  Sum_probs=3.2

Q ss_pred             ccccccch
Q psy12011         31 MFACDLCD   38 (94)
Q Consensus        31 ~~~c~~c~   38 (94)
                      .+.|..|+
T Consensus        24 ~w~C~~C~   31 (40)
T PF04810_consen   24 TWICNFCG   31 (40)
T ss_dssp             EEEETTT-
T ss_pred             EEECcCCC
Confidence            34444444


No 202
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=32.10  E-value=37  Score=20.57  Aligned_cols=11  Identities=9%  Similarity=-0.007  Sum_probs=7.8

Q ss_pred             CCceeecCCCC
Q psy12011          5 NLQVHFCGLFP   15 (94)
Q Consensus         5 ~~~~~~c~~c~   15 (94)
                      ..+.|.|..|+
T Consensus       109 ~drqFaC~~Cd  119 (278)
T PF15135_consen  109 VDRQFACSSCD  119 (278)
T ss_pred             cceeeeccccc
Confidence            34678888885


No 203
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=31.82  E-value=55  Score=21.66  Aligned_cols=14  Identities=21%  Similarity=0.639  Sum_probs=7.7

Q ss_pred             CCccccccchhhcc
Q psy12011         29 NGMFACDLCDKEYK   42 (94)
Q Consensus        29 ~k~~~c~~c~~~~~   42 (94)
                      .+.|+|..|+..+.
T Consensus       423 ~~~~~c~~c~~~yd  436 (479)
T PRK05452        423 GPRMQCSVCQWIYD  436 (479)
T ss_pred             CCeEEECCCCeEEC
Confidence            34566666664443


No 204
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=31.80  E-value=37  Score=20.81  Aligned_cols=12  Identities=25%  Similarity=0.517  Sum_probs=7.3

Q ss_pred             Cccccccchhhc
Q psy12011         30 GMFACDLCDKEY   41 (94)
Q Consensus        30 k~~~c~~c~~~~   41 (94)
                      ..|.|+.|...|
T Consensus       254 ~GyvCs~Clsi~  265 (279)
T TIGR00627       254 IGFVCSVCLSVL  265 (279)
T ss_pred             ceEECCCccCCc
Confidence            347777775444


No 205
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=31.27  E-value=52  Score=21.87  Aligned_cols=23  Identities=26%  Similarity=0.577  Sum_probs=17.4

Q ss_pred             eeCCCCcccccchhHHHHHHHHh
Q psy12011         61 FQCPQCSYRTKRKGNLKSHLAIR   83 (94)
Q Consensus        61 ~~c~~c~~~f~~~~~l~~h~~~~   83 (94)
                      +.|+.|.+-|.....+..|+..-
T Consensus        58 WiCp~CskkF~d~~~~~~H~~~e   80 (466)
T PF04780_consen   58 WICPRCSKKFSDAESCLSHMEQE   80 (466)
T ss_pred             eeCCcccceeCCHHHHHHHHHHh
Confidence            67777887788888888887643


No 206
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=30.86  E-value=28  Score=15.04  Aligned_cols=13  Identities=31%  Similarity=0.766  Sum_probs=6.9

Q ss_pred             Cccccccchhhcc
Q psy12011         30 GMFACDLCDKEYK   42 (94)
Q Consensus        30 k~~~c~~c~~~~~   42 (94)
                      .-+.|..|++.+.
T Consensus        25 ~Cf~C~~C~~~l~   37 (58)
T PF00412_consen   25 ECFKCSKCGKPLN   37 (58)
T ss_dssp             TTSBETTTTCBTT
T ss_pred             cccccCCCCCccC
Confidence            3455666665443


No 207
>PTZ00448 hypothetical protein; Provisional
Probab=30.58  E-value=40  Score=21.61  Aligned_cols=22  Identities=18%  Similarity=0.492  Sum_probs=19.2

Q ss_pred             eeCCCCcccccchhHHHHHHHH
Q psy12011         61 FQCPQCSYRTKRKGNLKSHLAI   82 (94)
Q Consensus        61 ~~c~~c~~~f~~~~~l~~h~~~   82 (94)
                      |.|..|+-.|......+.|.++
T Consensus       315 ~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        315 LLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             ccccccccccCCHHHHHHHhhh
Confidence            7899999999888888888876


No 208
>PF05741 zf-nanos:  Nanos RNA binding domain;  InterPro: IPR024161 Nanos is a highly conserved RNA-binding protein in higher eukaryotes and functions as a key regulatory protein in translational control using a 3' untranslated region during the development and maintenance of germ cells. Nanos comprises a non-conserved amino-terminus and highly conserved carboxy- terminal regions. The C-terminal region has two conserved Cys-Cys-His-Cys (CCHC)-type zinc-finger motifs that are indispensable for nanos function [, , ]. The structure of the nanos-type zinc finger is composed of two independent zinc-finger (ZF) lobes, the N-terminal ZF1 and the C-terminal ZF2, which are connected by a linker helix []. These lobes create a large cleft. Zinc ions in ZF1 and ZF2 are bound to the CCHC motif by tetrahedral coordination.; PDB: 3ALR_B.
Probab=30.54  E-value=21  Score=16.09  Aligned_cols=11  Identities=9%  Similarity=0.289  Sum_probs=3.2

Q ss_pred             ceeecCCCCcc
Q psy12011          7 QVHFCGLFPES   17 (94)
Q Consensus         7 ~~~~c~~c~~~   17 (94)
                      +.++|+.||.+
T Consensus        32 r~y~Cp~CgAt   42 (55)
T PF05741_consen   32 RKYVCPICGAT   42 (55)
T ss_dssp             GG---TTT---
T ss_pred             hcCcCCCCcCc
Confidence            45667777653


No 209
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=30.49  E-value=36  Score=13.54  Aligned_cols=22  Identities=23%  Similarity=0.581  Sum_probs=13.3

Q ss_pred             ceeCCCCcccccchhHHHHHHHH
Q psy12011         60 RFQCPQCSYRTKRKGNLKSHLAI   82 (94)
Q Consensus        60 ~~~c~~c~~~f~~~~~l~~h~~~   82 (94)
                      .+.|+.|++.+... -+..|+..
T Consensus         4 ~~~C~nC~R~v~a~-RfA~HLek   25 (33)
T PF08209_consen    4 YVECPNCGRPVAAS-RFAPHLEK   25 (33)
T ss_dssp             EEE-TTTSSEEEGG-GHHHHHHH
T ss_pred             eEECCCCcCCcchh-hhHHHHHH
Confidence            38899999876543 34556553


No 210
>TIGR03829 YokU_near_AblA uncharacterized protein, YokU family. Members of this protein family occur in various species of the genus Bacillus, always next to the gene (kamA or ablA) for lysine 2,3-aminomutase. Members have a pair of CXXC motifs, and share homology to the amino-terminal region of a family of putative transcription factors for which the C-terminal is modeled by pfam01381, a helix-turn-helix domain model. This family, however, is shorter and lacks the helix-turn-helix region. The function of this protein family is unknown, but a regulatory role in compatible solute biosynthesis is suggested by local genome context.
Probab=30.28  E-value=25  Score=17.59  Aligned_cols=16  Identities=6%  Similarity=0.063  Sum_probs=11.1

Q ss_pred             eecCCCCccccchhcc
Q psy12011          9 HFCGLFPESFLTWSNL   24 (94)
Q Consensus         9 ~~c~~c~~~~~~~~~l   24 (94)
                      .+|+.||..+....-+
T Consensus        36 ~~C~~CGe~y~~dev~   51 (89)
T TIGR03829        36 ISCSHCGMEYQDDTTV   51 (89)
T ss_pred             ccccCCCcEeecHHHH
Confidence            5688888877765543


No 211
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=30.25  E-value=30  Score=22.02  Aligned_cols=9  Identities=11%  Similarity=0.036  Sum_probs=4.8

Q ss_pred             eecCCCCcc
Q psy12011          9 HFCGLFPES   17 (94)
Q Consensus         9 ~~c~~c~~~   17 (94)
                      |+|..||..
T Consensus         1 ~~c~~cg~~    9 (372)
T cd01121           1 YVCSECGYV    9 (372)
T ss_pred             CCCCCCCCC
Confidence            456666543


No 212
>PHA02998 RNA polymerase subunit; Provisional
Probab=30.04  E-value=40  Score=19.34  Aligned_cols=38  Identities=18%  Similarity=0.414  Sum_probs=19.8

Q ss_pred             cccccchhhccChHHHHcchhhhcCCCCc---eeCCCCcccccch
Q psy12011         32 FACDLCDKEYKYKRNLYSHKKDECGQEPR---FQCPQCSYRTKRK   73 (94)
Q Consensus        32 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~---~~c~~c~~~f~~~   73 (94)
                      -+|+.|+..-   ..+. .+++..+++|+   |.|..||+.|...
T Consensus       144 v~CPkCg~~~---A~f~-qlQTRSADEPmT~FYkC~~CG~~wkpp  184 (195)
T PHA02998        144 TPCPNCKSKN---TTPM-MIQTRAADEPPLVRHACRDCKKHFKPP  184 (195)
T ss_pred             CCCCCCCCCc---eEEE-EEeeccCCCCceEEEEcCCCCCccCCc
Confidence            4677776321   1111 12233344443   6888888877543


No 213
>PRK12722 transcriptional activator FlhC; Provisional
Probab=29.82  E-value=52  Score=18.96  Aligned_cols=10  Identities=20%  Similarity=0.919  Sum_probs=5.2

Q ss_pred             ccccchhhcc
Q psy12011         33 ACDLCDKEYK   42 (94)
Q Consensus        33 ~c~~c~~~~~   42 (94)
                      .|..||..|.
T Consensus       136 ~C~~Cgg~fv  145 (187)
T PRK12722        136 SCNCCGGHFV  145 (187)
T ss_pred             cCCCCCCCee
Confidence            4555555543


No 214
>PRK00420 hypothetical protein; Validated
Probab=29.67  E-value=37  Score=17.79  Aligned_cols=8  Identities=25%  Similarity=0.617  Sum_probs=3.8

Q ss_pred             cccccchh
Q psy12011         32 FACDLCDK   39 (94)
Q Consensus        32 ~~c~~c~~   39 (94)
                      ..|+.||.
T Consensus        41 ~~Cp~Cg~   48 (112)
T PRK00420         41 VVCPVHGK   48 (112)
T ss_pred             eECCCCCC
Confidence            34555544


No 215
>KOG1842|consensus
Probab=29.42  E-value=32  Score=22.67  Aligned_cols=21  Identities=33%  Similarity=0.684  Sum_probs=10.0

Q ss_pred             eeCCCCcccccchhHHHHHHH
Q psy12011         61 FQCPQCSYRTKRKGNLKSHLA   81 (94)
Q Consensus        61 ~~c~~c~~~f~~~~~l~~h~~   81 (94)
                      |.|+.|...|.+...|..|..
T Consensus        16 flCPiC~~dl~~~~~L~~H~d   36 (505)
T KOG1842|consen   16 FLCPICLLDLPNLSALNDHLD   36 (505)
T ss_pred             ccCchHhhhhhhHHHHHHHHh
Confidence            444444444444444444443


No 216
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=29.35  E-value=59  Score=20.28  Aligned_cols=10  Identities=10%  Similarity=0.222  Sum_probs=7.2

Q ss_pred             eeecCCCCcc
Q psy12011          8 VHFCGLFPES   17 (94)
Q Consensus         8 ~~~c~~c~~~   17 (94)
                      ...|++||..
T Consensus       184 ~~~CPvCGs~  193 (305)
T TIGR01562       184 RTLCPACGSP  193 (305)
T ss_pred             CCcCCCCCCh
Confidence            3479999864


No 217
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=29.30  E-value=50  Score=17.46  Aligned_cols=14  Identities=21%  Similarity=0.268  Sum_probs=8.2

Q ss_pred             CccccccchhhccCh
Q psy12011         30 GMFACDLCDKEYKYK   44 (94)
Q Consensus        30 k~~~c~~c~~~~~~~   44 (94)
                      ....| .|+..|...
T Consensus        69 ~~~~C-~Cg~~~~~~   82 (124)
T PRK00762         69 VEIEC-ECGYEGVVD   82 (124)
T ss_pred             eeEEe-eCcCccccc
Confidence            34567 777665543


No 218
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=29.16  E-value=15  Score=16.08  Aligned_cols=13  Identities=15%  Similarity=0.320  Sum_probs=8.9

Q ss_pred             ecCCCCccccchh
Q psy12011         10 FCGLFPESFLTWS   22 (94)
Q Consensus        10 ~c~~c~~~~~~~~   22 (94)
                      .|+.|+..|....
T Consensus        14 ICpvCqRPFsWRk   26 (54)
T COG4338          14 ICPVCQRPFSWRK   26 (54)
T ss_pred             hhhhhcCchHHHH
Confidence            5778887776543


No 219
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=29.02  E-value=40  Score=22.12  Aligned_cols=23  Identities=17%  Similarity=0.426  Sum_probs=14.6

Q ss_pred             ceeecCCCCccccchhccCCCCCCccccccch
Q psy12011          7 QVHFCGLFPESFLTWSNLKPNLNGMFACDLCD   38 (94)
Q Consensus         7 ~~~~c~~c~~~~~~~~~l~~~~~k~~~c~~c~   38 (94)
                      ..|+|..||-.+...         .++|+.|+
T Consensus         6 ~~y~C~~Cg~~~~~~---------~g~Cp~C~   28 (454)
T TIGR00416         6 SKFVCQHCGADSPKW---------QGKCPACH   28 (454)
T ss_pred             CeEECCcCCCCCccc---------cEECcCCC
Confidence            369999998654332         24666664


No 220
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=28.90  E-value=46  Score=17.87  Aligned_cols=15  Identities=13%  Similarity=0.459  Sum_probs=9.2

Q ss_pred             CccccccchhhccCh
Q psy12011         30 GMFACDLCDKEYKYK   44 (94)
Q Consensus        30 k~~~c~~c~~~~~~~   44 (94)
                      -|.-|..||+.|+..
T Consensus        67 ~psfchncgs~fpwt   81 (160)
T COG4306          67 PPSFCHNCGSRFPWT   81 (160)
T ss_pred             CcchhhcCCCCCCcH
Confidence            455567777766553


No 221
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=28.87  E-value=20  Score=18.57  Aligned_cols=21  Identities=19%  Similarity=0.309  Sum_probs=17.6

Q ss_pred             eeCCCCcccccchhHHHHHHH
Q psy12011         61 FQCPQCSYRTKRKGNLKSHLA   81 (94)
Q Consensus        61 ~~c~~c~~~f~~~~~l~~h~~   81 (94)
                      +=|.+|.+.|...-.|..|++
T Consensus        56 hYCieCaryf~t~~aL~~Hkk   76 (126)
T COG5112          56 HYCIECARYFITEKALMEHKK   76 (126)
T ss_pred             eeeehhHHHHHHHHHHHHHhc
Confidence            678889999988888888875


No 222
>KOG0562|consensus
Probab=28.79  E-value=52  Score=18.69  Aligned_cols=24  Identities=25%  Similarity=0.364  Sum_probs=20.0

Q ss_pred             eeCCCCcccccchhHHHHHHHHhc
Q psy12011         61 FQCPQCSYRTKRKGNLKSHLAIRH   84 (94)
Q Consensus        61 ~~c~~c~~~f~~~~~l~~h~~~~~   84 (94)
                      ..|-.|+..-...+.|+.|++.+.
T Consensus       154 LrC~~Cq~~~~~~~kLK~Hl~~~~  177 (184)
T KOG0562|consen  154 LRCWRCQTFGPHFPKLKAHLREEY  177 (184)
T ss_pred             eeehhhhhcccccHHHHHHHHHHH
Confidence            899999955568899999999764


No 223
>PF02150 RNA_POL_M_15KD:  RNA polymerases M/15 Kd subunit;  InterPro: IPR001529 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. In archaebacteria, there is generally a single form of RNA polymerase which also consist of an oligomeric assemblage of 10 to 13 polypeptides. It has recently been shown [], [] that small subunits of about 15 kDa, found in polymerase types I and II, are highly conserved. These proteins contain a probable zinc finger in their N-terminal region and a C-terminal zinc ribbon domain (see IPR001222 from INTERPRO).; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 3H0G_I 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I ....
Probab=28.72  E-value=17  Score=14.53  Aligned_cols=8  Identities=50%  Similarity=1.057  Sum_probs=3.5

Q ss_pred             ccccchhh
Q psy12011         33 ACDLCDKE   40 (94)
Q Consensus        33 ~c~~c~~~   40 (94)
                      .|..|+..
T Consensus        22 ~C~~C~Y~   29 (35)
T PF02150_consen   22 ACRTCGYE   29 (35)
T ss_dssp             EESSSS-E
T ss_pred             CCCCCCCc
Confidence            45555533


No 224
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=28.42  E-value=25  Score=17.06  Aligned_cols=28  Identities=14%  Similarity=0.267  Sum_probs=13.4

Q ss_pred             eecCCCCccccchhccCCCCCCcc-ccccchh
Q psy12011          9 HFCGLFPESFLTWSNLKPNLNGMF-ACDLCDK   39 (94)
Q Consensus         9 ~~c~~c~~~~~~~~~l~~~~~k~~-~c~~c~~   39 (94)
                      |+|..|+..|....   +-.+.|+ .|++|+.
T Consensus        13 Y~c~~cg~~~dvvq---~~~ddplt~ce~c~a   41 (82)
T COG2331          13 YECTECGNRFDVVQ---AMTDDPLTTCEECGA   41 (82)
T ss_pred             EeecccchHHHHHH---hcccCccccChhhCh
Confidence            56666665543322   2223332 4666654


No 225
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=27.69  E-value=28  Score=14.47  Aligned_cols=9  Identities=11%  Similarity=-0.009  Sum_probs=5.8

Q ss_pred             eeecCCCCc
Q psy12011          8 VHFCGLFPE   16 (94)
Q Consensus         8 ~~~c~~c~~   16 (94)
                      +..|+.||.
T Consensus         2 ~~~Cp~Cg~   10 (47)
T PF14690_consen    2 PPRCPHCGS   10 (47)
T ss_pred             CccCCCcCC
Confidence            456777774


No 226
>COG4847 Uncharacterized protein conserved in archaea [Function unknown]
Probab=27.68  E-value=24  Score=17.87  Aligned_cols=30  Identities=10%  Similarity=0.213  Sum_probs=16.2

Q ss_pred             CCceeecCCCCccccchhccC--CCCCCcccc
Q psy12011          5 NLQVHFCGLFPESFLTWSNLK--PNLNGMFAC   34 (94)
Q Consensus         5 ~~~~~~c~~c~~~~~~~~~l~--~~~~k~~~c   34 (94)
                      +-+.|.|..|+..........  .-|...|.|
T Consensus         3 ~lkewkC~VCg~~iieGqkFTF~~kGsVH~eC   34 (103)
T COG4847           3 GLKEWKCYVCGGTIIEGQKFTFTKKGSVHYEC   34 (103)
T ss_pred             ccceeeEeeeCCEeeeccEEEEeeCCcchHHH
Confidence            446788888886544332222  234445555


No 227
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=27.60  E-value=53  Score=12.97  Aligned_cols=7  Identities=14%  Similarity=0.225  Sum_probs=3.1

Q ss_pred             eecCCCC
Q psy12011          9 HFCGLFP   15 (94)
Q Consensus         9 ~~c~~c~   15 (94)
                      ..|..|+
T Consensus         4 ~~C~~C~   10 (33)
T PF08792_consen    4 KKCSKCG   10 (33)
T ss_pred             eEcCCCC
Confidence            3444444


No 228
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=27.56  E-value=27  Score=17.94  Aligned_cols=12  Identities=17%  Similarity=0.426  Sum_probs=7.5

Q ss_pred             Cccccccchhhc
Q psy12011         30 GMFACDLCDKEY   41 (94)
Q Consensus        30 k~~~c~~c~~~~   41 (94)
                      ||-.|+-||..-
T Consensus         1 ~p~~CpYCg~~~   12 (102)
T PF11672_consen    1 KPIICPYCGGPA   12 (102)
T ss_pred             CCcccCCCCCee
Confidence            455677777543


No 229
>KOG3214|consensus
Probab=27.25  E-value=43  Score=17.21  Aligned_cols=11  Identities=18%  Similarity=1.072  Sum_probs=6.0

Q ss_pred             ccccchhhccC
Q psy12011         33 ACDLCDKEYKY   43 (94)
Q Consensus        33 ~c~~c~~~~~~   43 (94)
                      .|.+|+.+|..
T Consensus        49 sC~iC~esFqt   59 (109)
T KOG3214|consen   49 SCRICEESFQT   59 (109)
T ss_pred             eeeehhhhhcc
Confidence            45556555544


No 230
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=26.76  E-value=33  Score=14.02  Aligned_cols=11  Identities=9%  Similarity=0.181  Sum_probs=7.4

Q ss_pred             eeecCCCCccc
Q psy12011          8 VHFCGLFPESF   18 (94)
Q Consensus         8 ~~~c~~c~~~~   18 (94)
                      .|+|..|+..|
T Consensus        28 fy~C~~C~~~w   38 (39)
T PF01096_consen   28 FYVCCNCGHRW   38 (39)
T ss_dssp             EEEESSSTEEE
T ss_pred             EEEeCCCCCee
Confidence            47777777654


No 231
>PRK01343 zinc-binding protein; Provisional
Probab=26.56  E-value=57  Score=14.88  Aligned_cols=13  Identities=8%  Similarity=-0.028  Sum_probs=8.8

Q ss_pred             ceeecCCCCcccc
Q psy12011          7 QVHFCGLFPESFL   19 (94)
Q Consensus         7 ~~~~c~~c~~~~~   19 (94)
                      ..-.|+.|++.+.
T Consensus         8 p~~~CP~C~k~~~   20 (57)
T PRK01343          8 PTRPCPECGKPST   20 (57)
T ss_pred             CCCcCCCCCCcCc
Confidence            3456888888754


No 232
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones]
Probab=26.36  E-value=71  Score=21.13  Aligned_cols=16  Identities=13%  Similarity=0.185  Sum_probs=11.1

Q ss_pred             ceeecCCCCccccchh
Q psy12011          7 QVHFCGLFPESFLTWS   22 (94)
Q Consensus         7 ~~~~c~~c~~~~~~~~   22 (94)
                      ..|.|..||-.+....
T Consensus         6 t~f~C~~CG~~s~KW~   21 (456)
T COG1066           6 TAFVCQECGYVSPKWL   21 (456)
T ss_pred             cEEEcccCCCCCcccc
Confidence            5699999986644433


No 233
>PRK12860 transcriptional activator FlhC; Provisional
Probab=25.88  E-value=82  Score=18.25  Aligned_cols=9  Identities=22%  Similarity=0.825  Sum_probs=4.4

Q ss_pred             ccccchhhc
Q psy12011         33 ACDLCDKEY   41 (94)
Q Consensus        33 ~c~~c~~~~   41 (94)
                      .|..||..|
T Consensus       136 ~C~~Cgg~f  144 (189)
T PRK12860        136 RCCRCGGKF  144 (189)
T ss_pred             cCCCCCCCe
Confidence            455555444


No 234
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=25.84  E-value=56  Score=21.80  Aligned_cols=12  Identities=17%  Similarity=0.213  Sum_probs=6.9

Q ss_pred             CCCccccccchh
Q psy12011         28 LNGMFACDLCDK   39 (94)
Q Consensus        28 ~~k~~~c~~c~~   39 (94)
                      ...+..|+.|+.
T Consensus       250 ~~~~~~Cp~C~s  261 (505)
T TIGR00595       250 EPIPKTCPQCGS  261 (505)
T ss_pred             CCCCCCCCCCCC
Confidence            334566777664


No 235
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=25.83  E-value=56  Score=17.18  Aligned_cols=8  Identities=25%  Similarity=0.771  Sum_probs=3.9

Q ss_pred             ccccccch
Q psy12011         31 MFACDLCD   38 (94)
Q Consensus        31 ~~~c~~c~   38 (94)
                      ..+|+.|+
T Consensus        69 ~V~CP~C~   76 (114)
T PF11023_consen   69 QVECPNCG   76 (114)
T ss_pred             eeECCCCC
Confidence            34455554


No 236
>KOG4124|consensus
Probab=25.80  E-value=23  Score=22.58  Aligned_cols=19  Identities=16%  Similarity=0.282  Sum_probs=12.2

Q ss_pred             ceeecCC--CCccccchhccC
Q psy12011          7 QVHFCGL--FPESFLTWSNLK   25 (94)
Q Consensus         7 ~~~~c~~--c~~~~~~~~~l~   25 (94)
                      +++.|++  |++.+...-.|+
T Consensus       348 ~~~~~~vp~~~~~~~n~ng~~  368 (442)
T KOG4124|consen  348 KPYKCPVPNCDKAYKNQNGLK  368 (442)
T ss_pred             CCCCCCCCcchhhcccCccee
Confidence            5667765  777766655555


No 237
>KOG4477|consensus
Probab=25.80  E-value=36  Score=19.59  Aligned_cols=10  Identities=10%  Similarity=0.145  Sum_probs=5.0

Q ss_pred             CCceeecCCC
Q psy12011          5 NLQVHFCGLF   14 (94)
Q Consensus         5 ~~~~~~c~~c   14 (94)
                      ++..|-|..|
T Consensus        21 Deg~WdCsvC   30 (228)
T KOG4477|consen   21 DEGKWDCSVC   30 (228)
T ss_pred             ccCceeeeee
Confidence            3444555555


No 238
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=25.37  E-value=16  Score=15.60  Aligned_cols=6  Identities=17%  Similarity=0.312  Sum_probs=2.8

Q ss_pred             Cccccc
Q psy12011         66 CSYRTK   71 (94)
Q Consensus        66 c~~~f~   71 (94)
                      ||..|.
T Consensus        33 Cg~tfv   38 (47)
T PF04606_consen   33 CGHTFV   38 (47)
T ss_pred             CCCEEE
Confidence            554443


No 239
>PF13639 zf-RING_2:  Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A ....
Probab=24.71  E-value=68  Score=13.06  Aligned_cols=27  Identities=22%  Similarity=0.444  Sum_probs=13.8

Q ss_pred             eeCCCCcccccchhHHHHHHHHhcCcccCCCCCC
Q psy12011         61 FQCPQCSYRTKRKGNLKSHLAIRHECYLDDSANC   94 (94)
Q Consensus        61 ~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~c~~C   94 (94)
                      +..+ |+..|-..- +...++..     ..|+.|
T Consensus        17 ~~l~-C~H~fh~~C-i~~~~~~~-----~~CP~C   43 (44)
T PF13639_consen   17 VKLP-CGHVFHRSC-IKEWLKRN-----NSCPVC   43 (44)
T ss_dssp             EEET-TSEEEEHHH-HHHHHHHS-----SB-TTT
T ss_pred             EEcc-CCCeeCHHH-HHHHHHhC-----CcCCcc
Confidence            4444 777776654 34444432     266665


No 240
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=24.65  E-value=32  Score=15.17  Aligned_cols=32  Identities=25%  Similarity=0.478  Sum_probs=16.2

Q ss_pred             ccccchhhccChHHHHcchhhhcCCCCceeCCCCccc
Q psy12011         33 ACDLCDKEYKYKRNLYSHKKDECGQEPRFQCPQCSYR   69 (94)
Q Consensus        33 ~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~   69 (94)
                      .|..|+-....  ...  .....++.- ..|+.||+.
T Consensus        24 ~C~gC~~~l~~--~~~--~~i~~~~~i-~~Cp~CgRi   55 (56)
T PF02591_consen   24 TCSGCHMELPP--QEL--NEIRKGDEI-VFCPNCGRI   55 (56)
T ss_pred             ccCCCCEEcCH--HHH--HHHHcCCCe-EECcCCCcc
Confidence            56666533322  222  123334445 788888764


No 241
>PF12156 ATPase-cat_bd:  Putative metal-binding domain of cation transport ATPase;  InterPro: IPR021993  This domain is found in bacteria, and is approximately 90 amino acids in length. It is found associated with PF00403 from PFAM, PF00122 from PFAM, PF00702 from PFAM. The cysteine-rich nature and composition suggest this might be a cation-binding domain; most members are annotated as being cation transport ATPases. 
Probab=24.46  E-value=49  Score=16.32  Aligned_cols=33  Identities=15%  Similarity=0.241  Sum_probs=22.3

Q ss_pred             ecCCCCccccchhccC---CCCCCccccccchhhcc
Q psy12011         10 FCGLFPESFLTWSNLK---PNLNGMFACDLCDKEYK   42 (94)
Q Consensus        10 ~c~~c~~~~~~~~~l~---~~~~k~~~c~~c~~~~~   42 (94)
                      .|-+||..+.....+.   ...++.|-|..|...+.
T Consensus         2 ~C~HCg~~~p~~~~~~~~~~g~~~~FCC~GC~~V~~   37 (88)
T PF12156_consen    2 KCYHCGLPVPEGAKITVEIDGEERPFCCPGCQAVYQ   37 (88)
T ss_pred             CCCCCCCCCCCCCCeeeeeCCCccccccHHHHHHHH
Confidence            4778888876444444   34567889988876653


No 242
>PF14369 zf-RING_3:  zinc-finger
Probab=24.25  E-value=41  Score=13.46  Aligned_cols=10  Identities=20%  Similarity=0.398  Sum_probs=7.6

Q ss_pred             ecCCCCcccc
Q psy12011         10 FCGLFPESFL   19 (94)
Q Consensus        10 ~c~~c~~~~~   19 (94)
                      .|+.|+..|.
T Consensus        23 ~CP~C~~gFv   32 (35)
T PF14369_consen   23 ACPRCHGGFV   32 (35)
T ss_pred             CCcCCCCcEe
Confidence            4888887775


No 243
>KOG0320|consensus
Probab=24.24  E-value=23  Score=20.23  Aligned_cols=11  Identities=27%  Similarity=0.875  Sum_probs=6.9

Q ss_pred             eeCCCCccccc
Q psy12011         61 FQCPQCSYRTK   71 (94)
Q Consensus        61 ~~c~~c~~~f~   71 (94)
                      -.|+.|++-..
T Consensus       168 ~~CP~C~kkIt  178 (187)
T KOG0320|consen  168 NKCPTCRKKIT  178 (187)
T ss_pred             CCCCCcccccc
Confidence            56777776433


No 244
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=24.16  E-value=49  Score=17.26  Aligned_cols=12  Identities=25%  Similarity=0.634  Sum_probs=6.5

Q ss_pred             ccccccchhhcc
Q psy12011         31 MFACDLCDKEYK   42 (94)
Q Consensus        31 ~~~c~~c~~~~~   42 (94)
                      .+-|++|+..|.
T Consensus        19 ~~iCpeC~~EW~   30 (109)
T TIGR00686        19 QLICPSCLYEWN   30 (109)
T ss_pred             eeECcccccccc
Confidence            355666655543


No 245
>PLN02748 tRNA dimethylallyltransferase
Probab=23.70  E-value=46  Score=22.08  Aligned_cols=24  Identities=17%  Similarity=0.473  Sum_probs=16.6

Q ss_pred             Cccccccchh-hccChHHHHcchhh
Q psy12011         30 GMFACDLCDK-EYKYKRNLYSHKKD   53 (94)
Q Consensus        30 k~~~c~~c~~-~~~~~~~l~~h~~~   53 (94)
                      +.|.|+.|++ .+.....+..|+..
T Consensus       417 ~~~~Ce~C~~~~~~G~~eW~~Hlks  441 (468)
T PLN02748        417 TQYVCEACGNKVLRGAHEWEQHKQG  441 (468)
T ss_pred             ccccccCCCCcccCCHHHHHHHhcc
Confidence            5667888886 67777777766653


No 246
>KOG0717|consensus
Probab=23.68  E-value=48  Score=22.05  Aligned_cols=22  Identities=27%  Similarity=0.446  Sum_probs=18.3

Q ss_pred             eeCCCCcccccchhHHHHHHHH
Q psy12011         61 FQCPQCSYRTKRKGNLKSHLAI   82 (94)
Q Consensus        61 ~~c~~c~~~f~~~~~l~~h~~~   82 (94)
                      +-|.+|.+.|.+.-.|..|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            7889999999988888887754


No 247
>PRK14873 primosome assembly protein PriA; Provisional
Probab=23.48  E-value=75  Score=22.17  Aligned_cols=10  Identities=10%  Similarity=0.185  Sum_probs=4.7

Q ss_pred             eecCCCCccc
Q psy12011          9 HFCGLFPESF   18 (94)
Q Consensus         9 ~~c~~c~~~~   18 (94)
                      ..|+.|+-.+
T Consensus       393 ~~C~~C~~~L  402 (665)
T PRK14873        393 ARCRHCTGPL  402 (665)
T ss_pred             eECCCCCCce
Confidence            3455555443


No 248
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=23.28  E-value=40  Score=14.80  Aligned_cols=11  Identities=9%  Similarity=0.045  Sum_probs=6.0

Q ss_pred             eecCCCCcccc
Q psy12011          9 HFCGLFPESFL   19 (94)
Q Consensus         9 ~~c~~c~~~~~   19 (94)
                      |+|..||-.+.
T Consensus         2 y~C~~CgyiYd   12 (50)
T cd00730           2 YECRICGYIYD   12 (50)
T ss_pred             cCCCCCCeEEC
Confidence            55666664433


No 249
>KOG2231|consensus
Probab=23.27  E-value=90  Score=21.91  Aligned_cols=23  Identities=22%  Similarity=0.619  Sum_probs=13.3

Q ss_pred             ccccchhhccChHHHHcchhhhc
Q psy12011         33 ACDLCDKEYKYKRNLYSHKKDEC   55 (94)
Q Consensus        33 ~c~~c~~~~~~~~~l~~h~~~~~   55 (94)
                      .|..|...|.....+..|++.++
T Consensus       184 ~C~~C~~~fld~~el~rH~~~~h  206 (669)
T KOG2231|consen  184 LCKFCHERFLDDDELYRHLRFDH  206 (669)
T ss_pred             cchhhhhhhccHHHHHHhhccce
Confidence            35556666666666666655443


No 250
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=23.02  E-value=66  Score=20.65  Aligned_cols=23  Identities=17%  Similarity=0.291  Sum_probs=16.9

Q ss_pred             ccccchhhccChHHHHcchhhhc
Q psy12011         33 ACDLCDKEYKYKRNLYSHKKDEC   55 (94)
Q Consensus        33 ~c~~c~~~~~~~~~l~~h~~~~~   55 (94)
                      .|..|...|-....|..|++..+
T Consensus       222 ~C~FC~~~FYdDDEL~~HcR~~H  244 (493)
T COG5236         222 LCIFCKIYFYDDDELRRHCRLRH  244 (493)
T ss_pred             hhhhccceecChHHHHHHHHhhh
Confidence            47778877777777877777544


No 251
>PRK10220 hypothetical protein; Provisional
Probab=22.99  E-value=59  Score=17.01  Aligned_cols=12  Identities=33%  Similarity=1.024  Sum_probs=6.2

Q ss_pred             ccccccchhhcc
Q psy12011         31 MFACDLCDKEYK   42 (94)
Q Consensus        31 ~~~c~~c~~~~~   42 (94)
                      .|.|++|+.-|.
T Consensus        20 ~~vCpeC~hEW~   31 (111)
T PRK10220         20 MYICPECAHEWN   31 (111)
T ss_pred             eEECCcccCcCC
Confidence            355555554443


No 252
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=22.89  E-value=67  Score=12.83  Aligned_cols=13  Identities=8%  Similarity=-0.036  Sum_probs=8.0

Q ss_pred             CCceeecCCCCcc
Q psy12011          5 NLQVHFCGLFPES   17 (94)
Q Consensus         5 ~~~~~~c~~c~~~   17 (94)
                      +...++|+.|+..
T Consensus        19 ~r~R~vC~~Cg~I   31 (34)
T PF14803_consen   19 DRERLVCPACGFI   31 (34)
T ss_dssp             SS-EEEETTTTEE
T ss_pred             CccceECCCCCCE
Confidence            3345778888754


No 253
>COG1779 C4-type Zn-finger protein [General function prediction only]
Probab=22.65  E-value=35  Score=19.84  Aligned_cols=34  Identities=12%  Similarity=0.037  Sum_probs=18.9

Q ss_pred             eecCCCCccccchhccC---CCCCC---ccccccchhhcc
Q psy12011          9 HFCGLFPESFLTWSNLK---PNLNG---MFACDLCDKEYK   42 (94)
Q Consensus         9 ~~c~~c~~~~~~~~~l~---~~~~k---~~~c~~c~~~~~   42 (94)
                      -.||.||..+.....+-   +-++.   .+.|..||..+.
T Consensus        15 ~~CPvCg~~l~~~~~~~~IPyFG~V~i~t~~C~~CgYR~~   54 (201)
T COG1779          15 IDCPVCGGTLKAHMYLYDIPYFGEVLISTGVCERCGYRST   54 (201)
T ss_pred             ecCCcccceeeEEEeeecCCccceEEEEEEEccccCCccc
Confidence            35888887555433332   44443   346777775543


No 254
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=22.38  E-value=49  Score=14.97  Aligned_cols=12  Identities=8%  Similarity=-0.230  Sum_probs=7.3

Q ss_pred             CceeecCCCCcc
Q psy12011          6 LQVHFCGLFPES   17 (94)
Q Consensus         6 ~~~~~c~~c~~~   17 (94)
                      ...|.|+.||-.
T Consensus        12 ~v~~~Cp~cGip   23 (55)
T PF13824_consen   12 HVNFECPDCGIP   23 (55)
T ss_pred             ccCCcCCCCCCc
Confidence            345677777753


No 255
>PF11331 DUF3133:  Protein of unknown function (DUF3133);  InterPro: IPR021480  This eukaryotic family of proteins has no known function. 
Probab=22.00  E-value=46  Score=14.41  Aligned_cols=6  Identities=33%  Similarity=1.209  Sum_probs=2.4

Q ss_pred             ccccch
Q psy12011         33 ACDLCD   38 (94)
Q Consensus        33 ~c~~c~   38 (94)
                      +|..|.
T Consensus        33 rCGaCs   38 (46)
T PF11331_consen   33 RCGACS   38 (46)
T ss_pred             eCCCCc
Confidence            344443


No 256
>KOG0402|consensus
Probab=21.97  E-value=26  Score=17.34  Aligned_cols=34  Identities=18%  Similarity=0.580  Sum_probs=17.8

Q ss_pred             CCCCccccccchhhccChHHHHcchhhhcCCCCceeCCCCccccc
Q psy12011         27 NLNGMFACDLCDKEYKYKRNLYSHKKDECGQEPRFQCPQCSYRTK   71 (94)
Q Consensus        27 ~~~k~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~   71 (94)
                      +....|.|+.||+.-.-        +...|   .|.|..|.+.+.
T Consensus        32 ~Qhaky~CsfCGK~~vK--------R~AvG---iW~C~~C~kv~a   65 (92)
T KOG0402|consen   32 QQHAKYTCSFCGKKTVK--------RKAVG---IWKCGSCKKVVA   65 (92)
T ss_pred             HHhhhhhhhhcchhhhh--------hhcee---EEecCCccceec
Confidence            33446778888754211        11111   277777776554


No 257
>KOG1280|consensus
Probab=21.84  E-value=1e+02  Score=19.84  Aligned_cols=29  Identities=21%  Similarity=0.427  Sum_probs=19.2

Q ss_pred             eeCCCCcccccchhHHHHHHHHhcCcccC
Q psy12011         61 FQCPQCSYRTKRKGNLKSHLAIRHECYLD   89 (94)
Q Consensus        61 ~~c~~c~~~f~~~~~l~~h~~~~~~~~~~   89 (94)
                      |.|++|+..=..-..|..|...-|.+.++
T Consensus        80 ftCPyC~~~Gfte~~f~~Hv~s~Hpda~~  108 (381)
T KOG1280|consen   80 FTCPYCGIMGFTERQFGTHVLSQHPEAST  108 (381)
T ss_pred             ccCCcccccccchhHHHHHhhhcCcccCc
Confidence            77777776655666667777666655543


No 258
>KOG3352|consensus
Probab=21.79  E-value=34  Score=18.96  Aligned_cols=22  Identities=32%  Similarity=0.407  Sum_probs=15.2

Q ss_pred             cchhhhcCCCCceeCCCCcccccc
Q psy12011         49 SHKKDECGQEPRFQCPQCSYRTKR   72 (94)
Q Consensus        49 ~h~~~~~~~~~~~~c~~c~~~f~~   72 (94)
                      .++-.+.| +. .+|.+||..|.-
T Consensus       124 ~Wmwl~Kg-e~-~rc~eCG~~fkL  145 (153)
T KOG3352|consen  124 VWMWLEKG-ET-QRCPECGHYFKL  145 (153)
T ss_pred             EEEEEEcC-Cc-ccCCcccceEEe
Confidence            44555556 55 789999988753


No 259
>PRK05580 primosome assembly protein PriA; Validated
Probab=21.75  E-value=73  Score=22.17  Aligned_cols=13  Identities=23%  Similarity=0.209  Sum_probs=7.7

Q ss_pred             CCCccccccchhh
Q psy12011         28 LNGMFACDLCDKE   40 (94)
Q Consensus        28 ~~k~~~c~~c~~~   40 (94)
                      ...+..|+.|+..
T Consensus       418 ~~~~~~Cp~Cg~~  430 (679)
T PRK05580        418 EPIPKACPECGST  430 (679)
T ss_pred             CCCCCCCCCCcCC
Confidence            3446677777653


No 260
>PF10915 DUF2709:  Protein of unknown function (DUF2709);  InterPro: IPR024484 Members of this family appear restricted to Chlamydiales. Their function is unknown.
Probab=21.67  E-value=83  Score=18.38  Aligned_cols=20  Identities=15%  Similarity=0.243  Sum_probs=15.8

Q ss_pred             CCCceeecCCCCccccchhc
Q psy12011          4 QNLQVHFCGLFPESFLTWSN   23 (94)
Q Consensus         4 ~~~~~~~c~~c~~~~~~~~~   23 (94)
                      ...+.|.|+.-|+.|.+...
T Consensus        83 ~TkkIYICPFTGKVF~DNt~  102 (238)
T PF10915_consen   83 QTKKIYICPFTGKVFGDNTH  102 (238)
T ss_pred             ccceEEEcCCcCccccCCCC
Confidence            34688999999999987553


No 261
>PF14447 Prok-RING_4:  Prokaryotic RING finger family 4
Probab=21.27  E-value=60  Score=14.69  Aligned_cols=8  Identities=25%  Similarity=0.700  Sum_probs=3.4

Q ss_pred             cCCCCccc
Q psy12011         11 CGLFPESF   18 (94)
Q Consensus        11 c~~c~~~~   18 (94)
                      |+.|++.|
T Consensus        42 CPfC~~~~   49 (55)
T PF14447_consen   42 CPFCGTPF   49 (55)
T ss_pred             CCCCCCcc
Confidence            44444433


No 262
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=20.88  E-value=69  Score=13.10  Aligned_cols=14  Identities=21%  Similarity=0.240  Sum_probs=7.5

Q ss_pred             ecCCCCccccchhc
Q psy12011         10 FCGLFPESFLTWSN   23 (94)
Q Consensus        10 ~c~~c~~~~~~~~~   23 (94)
                      .|+-|++.|...++
T Consensus         4 ~CprC~kg~Hwa~~   17 (36)
T PF14787_consen    4 LCPRCGKGFHWASE   17 (36)
T ss_dssp             C-TTTSSSCS-TTT
T ss_pred             cCcccCCCcchhhh
Confidence            56777777665543


No 263
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=20.62  E-value=94  Score=13.18  Aligned_cols=12  Identities=8%  Similarity=0.415  Sum_probs=5.5

Q ss_pred             ceeecCCCCccc
Q psy12011          7 QVHFCGLFPESF   18 (94)
Q Consensus         7 ~~~~c~~c~~~~   18 (94)
                      ++-.|..|++..
T Consensus        10 ~~~~C~~C~~~i   21 (53)
T PF00130_consen   10 KPTYCDVCGKFI   21 (53)
T ss_dssp             STEB-TTSSSBE
T ss_pred             CCCCCcccCccc
Confidence            344555555543


No 264
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=20.40  E-value=62  Score=11.75  Aligned_cols=7  Identities=29%  Similarity=0.548  Sum_probs=3.9

Q ss_pred             ecCCCCc
Q psy12011         10 FCGLFPE   16 (94)
Q Consensus        10 ~c~~c~~   16 (94)
                      .|+.||.
T Consensus         4 ~Cp~Cg~   10 (26)
T PF13248_consen    4 FCPNCGA   10 (26)
T ss_pred             CCcccCC
Confidence            4556655


No 265
>KOG4602|consensus
Probab=20.25  E-value=41  Score=20.49  Aligned_cols=11  Identities=9%  Similarity=0.310  Sum_probs=8.6

Q ss_pred             ceeecCCCCcc
Q psy12011          7 QVHFCGLFPES   17 (94)
Q Consensus         7 ~~~~c~~c~~~   17 (94)
                      +.|+|+.||.+
T Consensus       267 R~YVCPiCGAT  277 (318)
T KOG4602|consen  267 RSYVCPICGAT  277 (318)
T ss_pred             hhhcCcccccc
Confidence            56889999864


Done!