Query         psy12012
Match_columns 79
No_of_seqs    109 out of 1417
Neff          11.5
Searched_HMMs 46136
Date          Fri Aug 16 16:25:55 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12012.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12012hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.8 9.3E-21   2E-25  100.7   2.6   70    2-73    193-263 (279)
  2 KOG2462|consensus               99.8 3.3E-20 7.1E-25   98.7   2.9   73    2-78    167-240 (279)
  3 KOG3623|consensus               99.6 7.3E-16 1.6E-20   91.2   1.1   68    5-74    904-971 (1007)
  4 KOG3576|consensus               99.4 8.9E-15 1.9E-19   75.8  -1.1   71    5-77    127-197 (267)
  5 KOG3623|consensus               99.3 8.1E-13 1.8E-17   78.7   3.1   61   18-79    888-948 (1007)
  6 KOG1074|consensus               99.2 1.1E-12 2.4E-17   78.8  -0.4   70    8-78    618-693 (958)
  7 PHA02768 hypothetical protein;  99.2 6.2E-12 1.4E-16   52.9   1.7   43   25-70      6-48  (55)
  8 KOG3576|consensus               99.2 1.9E-11 4.2E-16   63.6   3.7   75    2-77    151-236 (267)
  9 PHA00733 hypothetical protein   99.2 3.9E-11 8.5E-16   59.0   4.0   56   20-78     69-124 (128)
 10 KOG1074|consensus               99.2 4.9E-12 1.1E-16   76.1   0.4   54   24-78    353-406 (958)
 11 PF13465 zf-H2C2_2:  Zinc-finge  99.0 2.1E-10 4.6E-15   41.7   1.5   26   39-65      1-26  (26)
 12 PHA00616 hypothetical protein   98.8 3.5E-09 7.6E-14   42.7   2.0   34   24-58      1-34  (44)
 13 PHA00732 hypothetical protein   98.8 3.3E-09 7.1E-14   48.2   2.0   46   24-75      1-46  (79)
 14 PHA00616 hypothetical protein   98.7 3.7E-09 8.1E-14   42.6   1.1   27   53-79      1-27  (44)
 15 KOG3608|consensus               98.6 6.7E-09 1.4E-13   58.2  -0.2   73    5-78    189-288 (467)
 16 KOG3608|consensus               98.6 1.7E-08 3.8E-13   56.6   1.3   52   25-76    264-315 (467)
 17 PF05605 zf-Di19:  Drought indu  98.6 1.9E-07 4.2E-12   39.5   3.6   52   24-78      2-54  (54)
 18 PF13465 zf-H2C2_2:  Zinc-finge  98.5 2.5E-09 5.3E-14   38.8  -2.1   24   11-35      2-25  (26)
 19 PHA02768 hypothetical protein;  98.5   1E-07 2.2E-12   40.2   1.6   25   53-77      5-29  (55)
 20 PHA00733 hypothetical protein   98.4 2.1E-07 4.5E-12   45.9   2.2   55   21-76     37-96  (128)
 21 PF00096 zf-C2H2:  Zinc finger,  98.4 1.3E-07 2.8E-12   33.1   1.1   22   54-75      1-22  (23)
 22 KOG3993|consensus               98.3 1.9E-07 4.2E-12   53.5   0.7   54   24-77    295-380 (500)
 23 PF00096 zf-C2H2:  Zinc finger,  98.3   4E-07 8.6E-12   31.8   0.9   23   25-47      1-23  (23)
 24 PF13894 zf-C2H2_4:  C2H2-type   98.3 7.3E-07 1.6E-11   31.2   1.6   24   54-77      1-24  (24)
 25 PLN03086 PRLI-interacting fact  98.2 1.1E-06 2.5E-11   52.3   3.0   51    8-64    465-515 (567)
 26 PLN03086 PRLI-interacting fact  98.2 1.4E-06 3.1E-11   51.9   3.3   72    2-77    483-564 (567)
 27 PF13912 zf-C2H2_6:  C2H2-type   98.2   5E-07 1.1E-11   32.8   0.7   25   53-77      1-25  (27)
 28 COG5189 SFP1 Putative transcri  98.0 2.2E-06 4.9E-11   47.8   1.0   53   21-73    346-418 (423)
 29 PF13912 zf-C2H2_6:  C2H2-type   98.0 2.7E-06   6E-11   30.8   0.6   25   24-48      1-25  (27)
 30 smart00355 ZnF_C2H2 zinc finge  97.9 1.3E-05 2.9E-10   28.2   2.2   24   54-77      1-24  (26)
 31 PF13894 zf-C2H2_4:  C2H2-type   97.9 5.8E-06 1.3E-10   28.8   1.0   23   25-47      1-23  (24)
 32 PF12756 zf-C2H2_2:  C2H2 type   97.9 9.2E-06   2E-10   38.0   1.8   24   53-76     50-73  (100)
 33 PF09237 GAGA:  GAGA factor;  I  97.8 2.2E-05 4.8E-10   32.5   2.3   35   18-53     18-52  (54)
 34 KOG3993|consensus               97.6 1.7E-05 3.7E-10   45.8   0.6   53   23-76    266-318 (500)
 35 PRK04860 hypothetical protein;  97.5 4.6E-05 9.9E-10   39.1   1.4   38   24-66    119-156 (160)
 36 smart00355 ZnF_C2H2 zinc finge  97.5 7.2E-05 1.6E-09   26.2   1.5   24   25-48      1-24  (26)
 37 PHA00732 hypothetical protein   97.5 0.00011 2.4E-09   33.5   2.1   26   53-78      1-27  (79)
 38 PF13909 zf-H2C2_5:  C2H2-type   97.5 8.7E-05 1.9E-09   26.0   1.3   23   54-77      1-23  (24)
 39 PF09237 GAGA:  GAGA factor;  I  97.4 0.00014 3.1E-09   30.2   1.8   28   51-78     22-49  (54)
 40 PF12874 zf-met:  Zinc-finger o  97.3 9.8E-05 2.1E-09   26.1   0.6   21   55-75      2-22  (25)
 41 PF05605 zf-Di19:  Drought indu  97.0 0.00044 9.6E-09   29.1   1.5   45    2-48      8-53  (54)
 42 PF13913 zf-C2HC_2:  zinc-finge  96.9  0.0015 3.2E-08   23.2   2.0   21   54-75      3-23  (25)
 43 PF12171 zf-C2H2_jaz:  Zinc-fin  96.6  0.0007 1.5E-08   24.4   0.3   22   25-46      2-23  (27)
 44 smart00451 ZnF_U1 U1-like zinc  95.6    0.01 2.2E-07   22.4   1.4   22   53-74      3-24  (35)
 45 COG5189 SFP1 Putative transcri  95.4  0.0036 7.9E-08   35.6  -0.1   24   22-45    396-419 (423)
 46 KOG2893|consensus               95.2  0.0043 9.3E-08   34.0  -0.4   45   22-72      9-53  (341)
 47 PF09538 FYDLN_acid:  Protein o  95.0   0.016 3.5E-07   28.0   1.4   33   21-66      7-39  (108)
 48 KOG1146|consensus               95.0   0.023 5.1E-07   37.8   2.3   64   12-75    453-540 (1406)
 49 cd00350 rubredoxin_like Rubred  94.7   0.017 3.6E-07   21.8   0.7   24   25-61      2-25  (33)
 50 COG4049 Uncharacterized protei  94.6    0.03 6.4E-07   23.8   1.5   30   20-49     13-42  (65)
 51 COG5048 FOG: Zn-finger [Genera  94.3  0.0069 1.5E-07   34.8  -0.9   55   23-78    288-348 (467)
 52 COG1592 Rubrerythrin [Energy p  93.9   0.034 7.3E-07   28.9   1.1   24   24-61    134-157 (166)
 53 PF12756 zf-C2H2_2:  C2H2 type   93.9   0.032 6.9E-07   25.9   1.0   24   24-47     50-73  (100)
 54 PRK04860 hypothetical protein;  93.7   0.012 2.5E-07   30.4  -0.7   29    8-37    128-156 (160)
 55 PF09986 DUF2225:  Uncharacteri  92.1   0.024 5.3E-07   30.6  -1.0   45   22-66      3-61  (214)
 56 cd00729 rubredoxin_SM Rubredox  91.9   0.079 1.7E-06   20.2   0.6   25   24-61      2-26  (34)
 57 TIGR02300 FYDLN_acid conserved  91.5    0.13 2.8E-06   25.6   1.3   32   26-69     11-42  (129)
 58 KOG2186|consensus               91.2    0.15 3.2E-06   28.4   1.4   45   25-73      4-48  (276)
 59 smart00659 RPOLCX RNA polymera  90.8    0.13 2.8E-06   20.8   0.8   26   25-62      3-28  (44)
 60 PRK00464 nrdR transcriptional   88.9   0.077 1.7E-06   27.3  -0.7   12   54-65     29-40  (154)
 61 PF12013 DUF3505:  Protein of u  88.5    0.42 9.2E-06   23.0   1.7   25   54-78     81-109 (109)
 62 TIGR00373 conserved hypothetic  88.4    0.23   5E-06   25.6   0.8   35   20-64    105-139 (158)
 63 PRK06266 transcription initiat  88.2    0.25 5.5E-06   26.0   0.9   35   21-65    114-148 (178)
 64 smart00834 CxxC_CXXC_SSSS Puta  88.1    0.18 3.9E-06   19.6   0.2   30   24-61      5-34  (41)
 65 TIGR02098 MJ0042_CXXC MJ0042 f  87.8    0.26 5.5E-06   18.9   0.6   34   25-64      3-36  (38)
 66 PF09723 Zn-ribbon_8:  Zinc rib  87.6    0.15 3.3E-06   20.3  -0.1   29   25-61      6-34  (42)
 67 PF05443 ROS_MUCR:  ROS/MUCR tr  87.3    0.32 6.9E-06   24.5   0.9   23   24-49     72-94  (132)
 68 TIGR02605 CxxC_CxxC_SSSS putat  87.2    0.17 3.6E-06   20.9  -0.1   29   25-61      6-34  (52)
 69 smart00531 TFIIE Transcription  86.6    0.41 8.8E-06   24.4   1.1   38   21-63     96-133 (147)
 70 PF04959 ARS2:  Arsenite-resist  86.3    0.23 4.9E-06   27.0   0.1   28   51-78     75-102 (214)
 71 PF13719 zinc_ribbon_5:  zinc-r  86.1    0.39 8.4E-06   18.5   0.7   33   26-64      4-36  (37)
 72 PF13717 zinc_ribbon_4:  zinc-r  86.0    0.35 7.6E-06   18.6   0.5   32   26-63      4-35  (36)
 73 COG2888 Predicted Zn-ribbon RN  85.7    0.48   1E-05   20.5   0.9   31   24-60     27-57  (61)
 74 COG1996 RPC10 DNA-directed RNA  85.2    0.44 9.6E-06   19.8   0.6   28   24-62      6-33  (49)
 75 PF15269 zf-C2H2_7:  Zinc-finge  85.0    0.66 1.4E-05   18.9   1.1   21   54-74     21-41  (54)
 76 smart00614 ZnF_BED BED zinc fi  85.0     1.1 2.3E-05   18.4   1.8    7   68-74     38-44  (50)
 77 PRK00398 rpoP DNA-directed RNA  84.5    0.25 5.4E-06   20.0  -0.2   30   24-64      3-32  (46)
 78 COG1997 RPL43A Ribosomal prote  83.9    0.31 6.7E-06   22.7  -0.1   33   22-65     33-65  (89)
 79 COG5048 FOG: Zn-finger [Genera  83.9    0.47   1E-05   27.4   0.6   51    5-57    299-355 (467)
 80 COG2331 Uncharacterized protei  82.3    0.61 1.3E-05   21.2   0.5   32   23-62     11-42  (82)
 81 KOG2593|consensus               81.0     1.1 2.3E-05   27.1   1.3   40   18-61    122-161 (436)
 82 PF10571 UPF0547:  Uncharacteri  80.9     1.1 2.5E-05   15.9   0.9   10   55-64     16-25  (26)
 83 COG4957 Predicted transcriptio  80.2       1 2.2E-05   22.8   0.9   21   55-78     78-98  (148)
 84 smart00734 ZnF_Rad18 Rad18-lik  80.1     2.2 4.7E-05   15.1   1.6   19   55-74      3-21  (26)
 85 KOG4167|consensus               79.8    0.97 2.1E-05   29.2   0.9   26   23-48    791-816 (907)
 86 TIGR01206 lysW lysine biosynth  79.8    0.51 1.1E-05   20.0  -0.1   30   25-63      3-32  (54)
 87 PF03604 DNA_RNApol_7kD:  DNA d  79.8       1 2.2E-05   16.9   0.7   10   53-62     17-26  (32)
 88 PF12907 zf-met2:  Zinc-binding  78.1     1.4   3E-05   17.5   0.8   25   25-49      2-29  (40)
 89 PRK14890 putative Zn-ribbon RN  77.5     1.7 3.7E-05   18.8   1.1   32   24-61     25-56  (59)
 90 PHA00626 hypothetical protein   77.1     1.3 2.9E-05   18.9   0.7   16   52-67     22-37  (59)
 91 PF07754 DUF1610:  Domain of un  76.1     1.4 3.1E-05   15.4   0.6    8   53-60     16-23  (24)
 92 KOG4167|consensus               75.8    0.37   8E-06   30.9  -1.5   24   53-76    792-815 (907)
 93 cd00730 rubredoxin Rubredoxin;  74.6     1.1 2.3E-05   18.7   0.1   13   25-37      2-14  (50)
 94 KOG3408|consensus               74.3     1.4   3E-05   21.9   0.5   24   52-75     56-79  (129)
 95 PF07503 zf-HYPF:  HypF finger;  73.2     2.2 4.8E-05   16.3   0.8   31   27-64      2-32  (35)
 96 PRK09678 DNA-binding transcrip  72.5     1.2 2.7E-05   20.0   0.1   14   24-37     27-42  (72)
 97 PF00301 Rubredoxin:  Rubredoxi  71.4     2.5 5.4E-05   17.3   0.8   37   25-62      2-43  (47)
 98 PRK03824 hypA hydrogenase nick  70.2     1.4 3.1E-05   22.2   0.0   15   23-37     69-83  (135)
 99 PF11672 DUF3268:  Protein of u  67.8     1.9 4.1E-05   20.8   0.1   14   23-36      1-14  (102)
100 PF02892 zf-BED:  BED zinc fing  67.6     4.3 9.4E-05   15.9   1.2   11   54-64     17-27  (45)
101 smart00154 ZnF_AN1 AN1-like Zi  67.1     3.4 7.4E-05   16.1   0.8   13   53-65     12-24  (39)
102 KOG1146|consensus               67.0     4.7  0.0001   28.1   1.7   55   22-77   1282-1352(1406)
103 PF02176 zf-TRAF:  TRAF-type zi  66.3     1.8   4E-05   18.1  -0.1   40   24-64      9-53  (60)
104 COG5236 Uncharacterized conser  65.9     9.8 0.00021   22.8   2.7   47   26-74    222-272 (493)
105 PTZ00255 60S ribosomal protein  65.8     1.2 2.5E-05   21.0  -0.7   31   23-64     35-65  (90)
106 KOG1842|consensus               64.4     3.5 7.6E-05   25.2   0.8   23   24-46     15-37  (505)
107 PF07975 C1_4:  TFIIH C1-like d  64.3     2.1 4.6E-05   17.9  -0.0   26   22-47     19-44  (51)
108 KOG2482|consensus               63.9     4.6 9.9E-05   24.0   1.2   22   53-74    195-216 (423)
109 KOG2785|consensus               63.7     8.9 0.00019   23.0   2.3   51   24-74    166-241 (390)
110 PF13878 zf-C2H2_3:  zinc-finge  61.7      10 0.00023   14.9   2.0   23   54-76     14-38  (41)
111 COG1571 Predicted DNA-binding   60.1     7.4 0.00016   23.7   1.6   29   26-66    352-380 (421)
112 TIGR00280 L37a ribosomal prote  59.6     2.1 4.5E-05   20.2  -0.5   31   23-64     34-64  (91)
113 PF04423 Rad50_zn_hook:  Rad50   58.9     3.5 7.7E-05   17.1   0.2   11   55-65     22-32  (54)
114 PF09963 DUF2197:  Uncharacteri  58.9     3.1 6.8E-05   17.8  -0.0    8   24-31     31-38  (56)
115 KOG2071|consensus               58.8     7.6 0.00016   24.6   1.5   27   51-77    416-442 (579)
116 PF05191 ADK_lid:  Adenylate ki  58.6     4.9 0.00011   15.4   0.5   11   53-63     21-31  (36)
117 TIGR00244 transcriptional regu  57.2     2.3   5E-05   21.9  -0.6   12   54-65     29-40  (147)
118 PLN02294 cytochrome c oxidase   57.0     6.2 0.00013   21.0   0.8   25   40-66    130-154 (174)
119 PF07295 DUF1451:  Protein of u  56.8     3.2 6.9E-05   21.4  -0.2   32   20-62    108-139 (146)
120 KOG2636|consensus               56.2     9.6 0.00021   23.5   1.6   27   45-72    394-421 (497)
121 COG4306 Uncharacterized protei  56.0     3.4 7.3E-05   20.8  -0.2   16   51-66     66-81  (160)
122 COG4888 Uncharacterized Zn rib  55.6     1.1 2.3E-05   21.6  -1.8   38   21-63     19-56  (104)
123 PF13451 zf-trcl:  Probable zin  55.3     4.9 0.00011   16.7   0.3   15   52-66      3-17  (49)
124 PF08274 PhnA_Zn_Ribbon:  PhnA   55.0     6.2 0.00013   14.6   0.5   10   52-61     18-27  (30)
125 COG0068 HypF Hydrogenase matur  54.5      11 0.00024   24.7   1.7   49    5-62    133-182 (750)
126 PF13824 zf-Mss51:  Zinc-finger  54.4     9.6 0.00021   16.3   1.1    9   52-60     13-21  (55)
127 PRK03976 rpl37ae 50S ribosomal  54.3     2.8 6.1E-05   19.8  -0.5   31   23-64     35-65  (90)
128 COG3091 SprT Zn-dependent meta  54.2     4.6  0.0001   21.0   0.2   34   23-62    116-149 (156)
129 PF01428 zf-AN1:  AN1-like Zinc  52.7     3.8 8.3E-05   16.2  -0.2   13   52-64     12-24  (43)
130 COG1327 Predicted transcriptio  51.1     3.5 7.6E-05   21.4  -0.5   10   55-64     30-39  (156)
131 cd00924 Cyt_c_Oxidase_Vb Cytoc  51.0       9 0.00019   18.4   0.8   22   42-65     70-91  (97)
132 COG4530 Uncharacterized protei  50.1     9.3  0.0002   18.8   0.8   33   21-66      7-39  (129)
133 PF08790 zf-LYAR:  LYAR-type C2  50.0     3.6 7.9E-05   15.0  -0.4    9   26-34      2-10  (28)
134 PF04780 DUF629:  Protein of un  49.8      14 0.00031   22.9   1.7   22   54-75     58-79  (466)
135 COG3357 Predicted transcriptio  49.5     8.6 0.00019   18.2   0.6   15   51-65     56-70  (97)
136 PF12230 PRP21_like_P:  Pre-mRN  49.1     5.7 0.00012   21.8   0.0   25   24-49    168-192 (229)
137 KOG0717|consensus               48.0     9.3  0.0002   23.7   0.7   22   25-46    293-314 (508)
138 PF10013 DUF2256:  Uncharacteri  47.8      11 0.00024   15.1   0.7   12   55-66     10-21  (42)
139 PF02891 zf-MIZ:  MIZ/SP-RING z  47.5      14 0.00031   15.2   1.1   23   34-61     27-49  (50)
140 PRK12380 hydrogenase nickel in  47.5     8.2 0.00018   18.9   0.4   25   24-61     70-94  (113)
141 COG1198 PriA Primosomal protei  47.4     4.9 0.00011   26.2  -0.4   12   51-62    473-484 (730)
142 KOG0978|consensus               47.3     9.6 0.00021   24.8   0.8   19   52-70    677-695 (698)
143 KOG2231|consensus               46.7      27 0.00058   22.9   2.5   46   26-76    184-235 (669)
144 PRK05452 anaerobic nitric oxid  46.7     7.4 0.00016   24.0   0.2   41   21-62    422-467 (479)
145 TIGR00100 hypA hydrogenase nic  45.5     8.1 0.00018   18.9   0.2   25   24-61     70-94  (115)
146 PF02591 DUF164:  Putative zinc  45.4      19 0.00041   15.0   1.4   31   26-61     24-54  (56)
147 PF10083 DUF2321:  Uncharacteri  44.3     3.8 8.2E-05   21.4  -1.0   16   51-66     66-81  (158)
148 PF10276 zf-CHCC:  Zinc-finger   44.0     7.7 0.00017   15.4   0.0   12   23-34     28-39  (40)
149 PF07282 OrfB_Zn_ribbon:  Putat  43.5      12 0.00026   16.2   0.6   13   51-63     44-56  (69)
150 COG3677 Transposase and inacti  43.1      16 0.00034   18.4   1.0   16   51-66     51-66  (129)
151 PF14353 CpXC:  CpXC protein     43.1      12 0.00027   18.4   0.7   14   52-65     37-50  (128)
152 PF01155 HypA:  Hydrogenase exp  42.8     9.2  0.0002   18.7   0.2   12   25-36     71-82  (113)
153 COG1773 Rubredoxin [Energy pro  42.8      10 0.00023   16.2   0.3   11   53-63      3-13  (55)
154 PF09845 DUF2072:  Zn-ribbon co  41.7      16 0.00035   18.6   0.9   12   54-65      2-13  (131)
155 KOG4173|consensus               41.6      30 0.00066   19.2   2.0   50   26-75    108-168 (253)
156 PF11931 DUF3449:  Domain of un  39.8     9.6 0.00021   20.7   0.0   22   51-72     99-121 (196)
157 PF06397 Desulfoferrod_N:  Desu  39.7      12 0.00027   14.4   0.3   10   53-62      6-15  (36)
158 PF05741 zf-nanos:  Nanos RNA b  38.4      10 0.00022   16.2  -0.0    8   54-61     34-41  (55)
159 COG1675 TFA1 Transcription ini  38.3      23  0.0005   19.0   1.2   34   20-63    109-142 (176)
160 PF14369 zf-RING_3:  zinc-finge  38.3      18  0.0004   13.7   0.7   10   55-64     23-32  (35)
161 PF10263 SprT-like:  SprT-like   38.3     8.3 0.00018   19.6  -0.4   31   24-63    123-153 (157)
162 PF03811 Zn_Tnp_IS1:  InsA N-te  38.1     5.1 0.00011   15.4  -0.9   18   41-59     18-35  (36)
163 PF11789 zf-Nse:  Zinc-finger o  37.6      21 0.00046   15.2   0.9   32   22-58     22-53  (57)
164 TIGR00622 ssl1 transcription f  37.0      31 0.00067   17.1   1.5   49   26-77     57-105 (112)
165 PF14311 DUF4379:  Domain of un  36.6      24 0.00051   14.6   1.0   13   25-37     29-41  (55)
166 cd00065 FYVE FYVE domain; Zinc  35.4      30 0.00066   14.1   1.2    9   27-35      5-13  (57)
167 PF01927 Mut7-C:  Mut7-C RNAse   35.4      27 0.00058   17.9   1.2   47   24-70     91-141 (147)
168 PF14803 Nudix_N_2:  Nudix N-te  35.3     6.2 0.00013   15.0  -0.9    7   54-60     23-29  (34)
169 COG1655 Uncharacterized protei  34.9     6.2 0.00013   22.1  -1.2   24   23-46     18-41  (267)
170 KOG1994|consensus               34.5      17 0.00037   20.4   0.4   20   24-43    239-258 (268)
171 PF02146 SIR2:  Sir2 family;  I  34.4      20 0.00043   18.8   0.6   40   18-62     99-138 (178)
172 PF14787 zf-CCHC_5:  GAG-polypr  34.1      35 0.00075   13.2   1.1   13   55-67      4-16  (36)
173 PTZ00043 cytochrome c oxidase   34.1      26 0.00055   19.8   1.0   15   51-65    179-193 (268)
174 PF08209 Sgf11:  Sgf11 (transcr  33.8      36 0.00078   12.8   1.3   20   53-73      4-23  (33)
175 PRK11032 hypothetical protein;  33.0      17 0.00036   19.2   0.2   31   21-62    121-151 (160)
176 PF05180 zf-DNL:  DNL zinc fing  32.7     2.4 5.3E-05   18.8  -2.4   34   25-62      5-38  (66)
177 PF08271 TF_Zn_Ribbon:  TFIIB z  32.1      29 0.00062   13.6   0.8    8   55-62      2-9   (43)
178 smart00064 FYVE Protein presen  31.9      33  0.0007   14.7   1.0   12   25-36     11-22  (68)
179 KOG4124|consensus               31.5      12 0.00027   22.3  -0.4   23   22-44    396-418 (442)
180 PF01215 COX5B:  Cytochrome c o  31.3      12 0.00026   19.2  -0.4   16   22-37    110-125 (136)
181 PTZ00448 hypothetical protein;  30.9      43 0.00093   20.3   1.6   22   53-74    314-335 (373)
182 KOG0562|consensus               30.9      43 0.00093   18.0   1.5   27   51-77    151-177 (184)
183 PRK12860 transcriptional activ  30.4      27 0.00059   19.0   0.8   28   24-60    134-161 (189)
184 KOG3214|consensus               30.4      31 0.00066   16.8   0.8   12   54-65     48-59  (109)
185 PF04810 zf-Sec23_Sec24:  Sec23  30.0      22 0.00047   13.8   0.3   13   21-33     21-33  (40)
186 PRK12722 transcriptional activ  29.9      31 0.00066   18.7   0.9   29   24-61    134-162 (187)
187 PRK01343 zinc-binding protein;  29.6      44 0.00096   14.4   1.2   13   52-64      8-20  (57)
188 KOG3352|consensus               29.3      32  0.0007   18.0   0.9   22   43-66    125-146 (153)
189 COG0675 Transposase and inacti  28.5      26 0.00057   19.9   0.5   11   52-62    321-331 (364)
190 PF04606 Ogr_Delta:  Ogr/Delta-  28.1     8.9 0.00019   15.5  -1.0   11   54-64     26-38  (47)
191 PF02748 PyrI_C:  Aspartate car  28.0      26 0.00056   14.7   0.4   17   21-37     32-48  (52)
192 PRK14873 primosome assembly pr  27.8      46 0.00099   21.8   1.5   11   52-62    421-431 (665)
193 KOG4118|consensus               27.4      59  0.0013   14.5   1.4   26   24-49     38-63  (74)
194 COG5539 Predicted cysteine pro  27.2      30 0.00066   20.2   0.6   22   24-45    275-296 (306)
195 PF14690 zf-ISL3:  zinc-finger   27.2      40 0.00086   13.2   0.9    9   53-61      2-10  (47)
196 PF06524 NOA36:  NOA36 protein;  27.1      15 0.00031   21.1  -0.6   21   51-71    207-227 (314)
197 COG3364 Zn-ribbon containing p  27.1      31 0.00067   16.9   0.5   14   24-37      2-15  (112)
198 COG0846 SIR2 NAD-dependent pro  26.7      42 0.00091   19.1   1.1   40   17-61    115-154 (250)
199 TIGR03831 YgiT_finger YgiT-typ  26.3      32  0.0007   13.2   0.5   13   52-64     31-43  (46)
200 PF01286 XPA_N:  XPA protein N-  26.3      29 0.00062   13.2   0.3   11   55-65      5-15  (34)
201 cd00974 DSRD Desulforedoxin (D  26.2      36 0.00078   12.5   0.6   11   53-63      4-14  (34)
202 COG4338 Uncharacterized protei  26.2      21 0.00045   14.8  -0.1   12   55-66     14-25  (54)
203 PRK05580 primosome assembly pr  26.2      22 0.00047   23.1  -0.0   12   51-62    419-430 (679)
204 PF05766 NinG:  Bacteriophage L  26.2      32  0.0007   18.7   0.6   14   23-36      5-18  (189)
205 TIGR00319 desulf_FeS4 desulfof  25.9      36 0.00078   12.5   0.6   11   53-63      7-17  (34)
206 PLN03238 probable histone acet  25.7      59  0.0013   19.1   1.5   24   51-74     46-69  (290)
207 PF10272 Tmpp129:  Putative tra  25.6      34 0.00075   20.6   0.7   36   27-65    316-352 (358)
208 PRK09951 hypothetical protein;  25.6      32  0.0007   19.1   0.5   10    1-10      1-10  (222)
209 CHL00174 accD acetyl-CoA carbo  25.5      60  0.0013   19.1   1.6   30   26-65     40-69  (296)
210 PF14447 Prok-RING_4:  Prokaryo  25.5      51  0.0011   14.1   1.0   10   56-65     42-51  (55)
211 PF14255 Cys_rich_CPXG:  Cystei  25.4      41 0.00089   14.1   0.7    9   55-63      2-10  (52)
212 PRK04351 hypothetical protein;  25.4      21 0.00046   18.5  -0.1   33   24-65    112-144 (149)
213 KOG0782|consensus               25.2      19 0.00041   23.3  -0.4   14   54-67    254-267 (1004)
214 PF15135 UPF0515:  Uncharacteri  25.2      28 0.00061   19.9   0.3   13   53-65    155-167 (278)
215 PF08792 A2L_zn_ribbon:  A2L zi  25.0      32 0.00069   12.9   0.3   11   54-64     22-32  (33)
216 COG4391 Uncharacterized protei  25.0      45 0.00097   14.7   0.8   43   18-65     18-60  (62)
217 PF06676 DUF1178:  Protein of u  24.9      95   0.002   16.3   2.1    9   53-61     32-40  (148)
218 PF04216 FdhE:  Protein involve  24.9      23 0.00049   20.3  -0.1   10   53-62    211-220 (290)
219 COG5112 UFD2 U1-like Zn-finger  24.6      95  0.0021   15.3   1.9   27   20-46     51-77  (126)
220 KOG0402|consensus               24.5      23  0.0005   16.6  -0.1   30   24-64     36-65  (92)
221 PF13821 DUF4187:  Domain of un  24.4      29 0.00063   14.7   0.2   17   25-41     28-44  (55)
222 TIGR00595 priA primosomal prot  23.8      25 0.00054   22.0  -0.1   10   52-61    252-261 (505)
223 PF11494 Ta0938:  Ta0938;  Inte  23.4      44 0.00095   16.2   0.7   42   18-66      8-50  (105)
224 PF01096 TFIIS_C:  Transcriptio  23.3      17 0.00036   14.1  -0.6   10   25-34     29-38  (39)
225 KOG3456|consensus               23.3      40 0.00087   16.6   0.6   13   24-36    104-116 (120)
226 COG5151 SSL1 RNA polymerase II  23.1      95  0.0021   18.6   2.0   48   26-76    364-411 (421)
227 PF09889 DUF2116:  Uncharacteri  22.7      33 0.00071   14.9   0.2    7   27-33      6-12  (59)
228 COG4847 Uncharacterized protei  22.6      21 0.00045   17.1  -0.4   11   23-33      5-15  (103)
229 PF09943 DUF2175:  Uncharacteri  22.6      21 0.00045   17.3  -0.5   10   24-33      2-11  (101)
230 PF10122 Mu-like_Com:  Mu-like   22.4      26 0.00057   14.7  -0.1   10   53-62     24-33  (51)
231 PLN02748 tRNA dimethylallyltra  22.3      79  0.0017   19.9   1.7   23   52-74    417-440 (468)
232 COG5216 Uncharacterized conser  22.2      43 0.00093   14.6   0.5   11   54-65     23-33  (67)
233 PF01844 HNH:  HNH endonuclease  22.2      13 0.00028   14.4  -1.1   11   27-37      1-11  (47)
234 smart00586 ZnF_DBF Zinc finger  22.1      82  0.0018   13.1   1.5   22   22-46      3-24  (49)
235 PF10071 DUF2310:  Zn-ribbon-co  21.6      39 0.00085   19.4   0.4   29   24-60    220-248 (258)
236 PTZ00409 Sir2 (Silent Informat  21.4 1.1E+02  0.0024   17.6   2.1   21   18-38    131-151 (271)
237 PF10164 DUF2367:  Uncharacteri  21.3      62  0.0013   15.7   1.0   13   51-63     86-98  (98)
238 PF14354 Lar_restr_allev:  Rest  21.2      42  0.0009   14.1   0.4   12   23-34      2-13  (61)
239 TIGR03829 YokU_near_AblA uncha  21.0      83  0.0018   14.9   1.3   16   52-67     34-49  (89)
240 PF14375 Cys_rich_CWC:  Cystein  21.0      61  0.0013   13.2   0.8    7   57-63      2-8   (50)
241 KOG3362|consensus               20.9      27 0.00058   18.2  -0.3   21   53-73    129-149 (156)
242 COG1579 Zn-ribbon protein, pos  20.7      87  0.0019   17.8   1.6   12   51-62    219-230 (239)
243 PRK12496 hypothetical protein;  20.7      48   0.001   17.4   0.6   12   53-64    127-138 (164)
244 TIGR00515 accD acetyl-CoA carb  20.3      89  0.0019   18.2   1.6   31   25-65     27-57  (285)
245 PF00412 LIM:  LIM domain;  Int  20.2      14  0.0003   15.1  -1.3   10   54-63     27-36  (58)
246 PRK14138 NAD-dependent deacety  20.2 1.2E+02  0.0027   17.0   2.1   40   17-61    112-151 (244)

No 1  
>KOG2462|consensus
Probab=99.81  E-value=9.3e-21  Score=100.75  Aligned_cols=70  Identities=23%  Similarity=0.396  Sum_probs=41.2

Q ss_pred             Ccc-cccccccccccccCCCCCCccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCcccCcchHHHHH
Q psy12012          2 FGQ-FRFSESFTSWEASEPNHAGLFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRTKQKSSLKTHM   73 (79)
Q Consensus         2 ~~~-f~~~~~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~   73 (79)
                      ||+ |++.=-|+.| ++.|+|||||.|..|++.|..+++|..||++|.+ .++|+|..|+++|...+.|..|.
T Consensus       193 CGKaFSRPWLLQGH-iRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~-~K~~qC~~C~KsFsl~SyLnKH~  263 (279)
T KOG2462|consen  193 CGKAFSRPWLLQGH-IRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSD-VKKHQCPRCGKSFALKSYLNKHS  263 (279)
T ss_pred             ccccccchHHhhcc-cccccCCCCccCCcccchhcchHHHHHHHHhhcC-CccccCcchhhHHHHHHHHHHhh
Confidence            444 5544445555 5566666666666666666666666666666655 55566666666666666665554


No 2  
>KOG2462|consensus
Probab=99.80  E-value=3.3e-20  Score=98.69  Aligned_cols=73  Identities=19%  Similarity=0.419  Sum_probs=64.5

Q ss_pred             Ccc-cccccccccccccCCCCCCccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCcccCcchHHHHHHhhcC
Q psy12012          2 FGQ-FRFSESFTSWEASEPNHAGLFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRTKQKSSLKTHMAVKHS   78 (79)
Q Consensus         2 ~~~-f~~~~~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~   78 (79)
                      ||+ |++.-.|+.| ++.|+  -+..|.+||+.|.++.-|+.|++.|+| ++||.|+.|++.|..++.|..|+++|.+
T Consensus       167 C~K~YvSmpALkMH-irTH~--l~c~C~iCGKaFSRPWLLQGHiRTHTG-EKPF~C~hC~kAFADRSNLRAHmQTHS~  240 (279)
T KOG2462|consen  167 CGKVYVSMPALKMH-IRTHT--LPCECGICGKAFSRPWLLQGHIRTHTG-EKPFSCPHCGKAFADRSNLRAHMQTHSD  240 (279)
T ss_pred             CCceeeehHHHhhH-hhccC--CCcccccccccccchHHhhcccccccC-CCCccCCcccchhcchHHHHHHHHhhcC
Confidence            444 6666777777 55554  679999999999999999999999999 9999999999999999999999999976


No 3  
>KOG3623|consensus
Probab=99.56  E-value=7.3e-16  Score=91.15  Aligned_cols=68  Identities=28%  Similarity=0.555  Sum_probs=59.7

Q ss_pred             cccccccccccccCCCCCCccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCcccCcchHHHHHH
Q psy12012          5 FRFSESFTSWEASEPNHAGLFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRTKQKSSLKTHMA   74 (79)
Q Consensus         5 f~~~~~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~   74 (79)
                      |.-.++|..| ...|+|.+||.|.+|.+.|..+..|..|.+.|.| ++||.|..|++.|.++.+...||-
T Consensus       904 FqKqSSLaRH-KYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSG-EKPfQCdKClKRFSHSGSYSQHMN  971 (1007)
T KOG3623|consen  904 FQKQSSLARH-KYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSG-EKPFQCDKCLKRFSHSGSYSQHMN  971 (1007)
T ss_pred             HHhhHHHHHh-hhhhcCCCCcccchhhHhhhhhhhhhhhhhhccC-CCcchhhhhhhhcccccchHhhhc
Confidence            5556778888 7889999999999999999999999999999999 999999999999999988888863


No 4  
>KOG3576|consensus
Probab=99.43  E-value=8.9e-15  Score=75.75  Aligned_cols=71  Identities=20%  Similarity=0.450  Sum_probs=49.0

Q ss_pred             cccccccccccccCCCCCCccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCcccCcchHHHHHHhhc
Q psy12012          5 FRFSESFTSWEASEPNHAGLFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRTKQKSSLKTHMAVKH   77 (79)
Q Consensus         5 f~~~~~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~   77 (79)
                      |....-|-.| +.-|...+.+.|..||+.|...-+|.+|++.|+| .+||+|..|++.|.+..+|..|.+--+
T Consensus       127 F~lQRmlnrh-~kch~~vkr~lct~cgkgfndtfdlkrh~rthtg-vrpykc~~c~kaftqrcsleshl~kvh  197 (267)
T KOG3576|consen  127 FGLQRMLNRH-LKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTG-VRPYKCSLCEKAFTQRCSLESHLKKVH  197 (267)
T ss_pred             hhHHHHHHHH-hhhccHHHHHHHhhccCcccchhhhhhhhccccC-ccccchhhhhHHHHhhccHHHHHHHHc
Confidence            3333333444 5556666777777777777777777788887777 777888888888887777777765433


No 5  
>KOG3623|consensus
Probab=99.34  E-value=8.1e-13  Score=78.68  Aligned_cols=61  Identities=30%  Similarity=0.643  Sum_probs=57.1

Q ss_pred             CCCCCCccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCcccCcchHHHHHHhhcCC
Q psy12012         18 EPNHAGLFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRTKQKSSLKTHMAVKHSD   79 (79)
Q Consensus        18 ~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~e   79 (79)
                      ..+...+|.|..|++.|...+.|.+|.--|+| .+||+|.+|.+.|.++-.|..|+|.|.||
T Consensus       888 ~kte~gmyaCDqCDK~FqKqSSLaRHKYEHsG-qRPyqC~iCkKAFKHKHHLtEHkRLHSGE  948 (1007)
T KOG3623|consen  888 AKTEDGMYACDQCDKAFQKQSSLARHKYEHSG-QRPYQCIICKKAFKHKHHLTEHKRLHSGE  948 (1007)
T ss_pred             ccCccccchHHHHHHHHHhhHHHHHhhhhhcC-CCCcccchhhHhhhhhhhhhhhhhhccCC
Confidence            34556789999999999999999999999999 99999999999999999999999999997


No 6  
>KOG1074|consensus
Probab=99.23  E-value=1.1e-12  Score=78.75  Aligned_cols=70  Identities=19%  Similarity=0.444  Sum_probs=49.3

Q ss_pred             ccccccccccCCCCCCccccchhhhhhcchhhHHhHhhhhhcC---CCCccCC---CCCCcccCcchHHHHHHhhcC
Q psy12012          8 SESFTSWEASEPNHAGLFVCDVCDRRYKYKSGLYQHKKYECGK---EPRYQCP---QCPHRTKQKSSLKTHMAVKHS   78 (79)
Q Consensus         8 ~~~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~---~~~~~c~---~c~~~f~~~~~l~~h~~~h~~   78 (79)
                      .++|+.| .+.|+|++||+|.+||+.|..+.+|+.|+.+|...   ..++.|+   +|-+.|.+.-.|+.|+++|++
T Consensus       618 ~saLqmH-yrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn~V~lpQhIriH~~  693 (958)
T KOG1074|consen  618 PSALQMH-YRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTNAVTLPQHIRIHLG  693 (958)
T ss_pred             hhhhhhh-hhcccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhcccccccccccceEEeecC
Confidence            4566666 67777777777777777777777777777776541   2346677   777777777777777777764


No 7  
>PHA02768 hypothetical protein; Provisional
Probab=99.21  E-value=6.2e-12  Score=52.85  Aligned_cols=43  Identities=12%  Similarity=0.379  Sum_probs=38.3

Q ss_pred             cccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCcccCcchHH
Q psy12012         25 FVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRTKQKSSLK   70 (79)
Q Consensus        25 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~   70 (79)
                      |.|+.||+.|...+.|..|++.|.   ++++|..|++.|...+.|.
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~---k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN---TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC---CcccCCcccceecccceeE
Confidence            799999999999999999999985   5889999999998776653


No 8  
>KOG3576|consensus
Probab=99.21  E-value=1.9e-11  Score=63.60  Aligned_cols=75  Identities=17%  Similarity=0.410  Sum_probs=61.4

Q ss_pred             Ccc-cccccccccccccCCCCCCccccchhhhhhcchhhHHhHhhhhhcC----------CCCccCCCCCCcccCcchHH
Q psy12012          2 FGQ-FRFSESFTSWEASEPNHAGLFVCDVCDRRYKYKSGLYQHKKYECGK----------EPRYQCPQCPHRTKQKSSLK   70 (79)
Q Consensus         2 ~~~-f~~~~~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~----------~~~~~c~~c~~~f~~~~~l~   70 (79)
                      ||+ |-....|+.| .+.|+|.+||.|..|++.|+....|..|.+--+|-          .+.|.|..||.+-.......
T Consensus       151 cgkgfndtfdlkrh-~rthtgvrpykc~~c~kaftqrcsleshl~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~  229 (267)
T KOG3576|consen  151 CGKGFNDTFDLKRH-TRTHTGVRPYKCSLCEKAFTQRCSLESHLKKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYY  229 (267)
T ss_pred             ccCcccchhhhhhh-hccccCccccchhhhhHHHHhhccHHHHHHHHcCchHHHHHHHhhhheeeecccCCCCCChhHHH
Confidence            555 6666788889 89999999999999999999999999998743331          46799999998887777777


Q ss_pred             HHHHhhc
Q psy12012         71 THMAVKH   77 (79)
Q Consensus        71 ~h~~~h~   77 (79)
                      .|...|+
T Consensus       230 ~h~~~~h  236 (267)
T KOG3576|consen  230 LHLKLHH  236 (267)
T ss_pred             HHHHhcC
Confidence            7877665


No 9  
>PHA00733 hypothetical protein
Probab=99.19  E-value=3.9e-11  Score=58.99  Aligned_cols=56  Identities=27%  Similarity=0.538  Sum_probs=49.4

Q ss_pred             CCCCccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCcccCcchHHHHHHhhcC
Q psy12012         20 NHAGLFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRTKQKSSLKTHMAVKHS   78 (79)
Q Consensus        20 ~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~   78 (79)
                      .+.+||.|..|++.|.....|..|++.+   ..++.|..|++.|.....|..|+...++
T Consensus        69 ~~~kPy~C~~Cgk~Fss~s~L~~H~r~h---~~~~~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         69 KAVSPYVCPLCLMPFSSSVSLKQHIRYT---EHSKVCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             CCCCCccCCCCCCcCCCHHHHHHHHhcC---CcCccCCCCCCccCCHHHHHHHHHHhcC
Confidence            3578999999999999999999999875   3479999999999999999999887654


No 10 
>KOG1074|consensus
Probab=99.17  E-value=4.9e-12  Score=76.12  Aligned_cols=54  Identities=28%  Similarity=0.538  Sum_probs=50.3

Q ss_pred             ccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCcccCcchHHHHHHhhcC
Q psy12012         24 LFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRTKQKSSLKTHMAVKHS   78 (79)
Q Consensus        24 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~   78 (79)
                      ..+|..|.+.|...+.|+.|.+.|+| ++||+|++|+..|..+..|+.|...|+.
T Consensus       353 khkCr~CakvfgS~SaLqiHlRSHTG-ERPfqCnvCG~~FSTkGNLKvH~~rH~e  406 (958)
T KOG1074|consen  353 KHKCRFCAKVFGSDSALQIHLRSHTG-ERPFQCNVCGNRFSTKGNLKVHFQRHRE  406 (958)
T ss_pred             cchhhhhHhhcCchhhhhhhhhccCC-CCCeeecccccccccccceeeeeeeccc
Confidence            46899999999999999999999999 9999999999999999999999877754


No 11 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=99.00  E-value=2.1e-10  Score=41.68  Aligned_cols=26  Identities=31%  Similarity=0.689  Sum_probs=22.1

Q ss_pred             hHHhHhhhhhcCCCCccCCCCCCcccC
Q psy12012         39 GLYQHKKYECGKEPRYQCPQCPHRTKQ   65 (79)
Q Consensus        39 ~l~~h~~~~~~~~~~~~c~~c~~~f~~   65 (79)
                      +|..|++.|.+ ++||.|+.|++.|.+
T Consensus         1 ~l~~H~~~H~~-~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTG-EKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSS-SSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCC-CCCCCCCCCcCeeCc
Confidence            47889999988 899999999988863


No 12 
>PHA00616 hypothetical protein
Probab=98.82  E-value=3.5e-09  Score=42.65  Aligned_cols=34  Identities=12%  Similarity=0.261  Sum_probs=30.1

Q ss_pred             ccccchhhhhhcchhhHHhHhhhhhcCCCCccCCC
Q psy12012         24 LFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQ   58 (79)
Q Consensus        24 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~   58 (79)
                      ||.|..||+.|...+.|..|++.+++ +.++.|+.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg-~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHK-QNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcC-CCccceeE
Confidence            68899999999999999999999999 88887664


No 13 
>PHA00732 hypothetical protein
Probab=98.80  E-value=3.3e-09  Score=48.16  Aligned_cols=46  Identities=24%  Similarity=0.489  Sum_probs=36.6

Q ss_pred             ccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCcccCcchHHHHHHh
Q psy12012         24 LFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRTKQKSSLKTHMAV   75 (79)
Q Consensus        24 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~   75 (79)
                      ||.|..|++.|.....|..|++.++.   ++.|+.|++.|..   +..|.++
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~~---l~~H~~~   46 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYRR---LNQHFYS   46 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeCC---hhhhhcc
Confidence            57899999999999999999985322   3579999999974   5667654


No 14 
>PHA00616 hypothetical protein
Probab=98.74  E-value=3.7e-09  Score=42.57  Aligned_cols=27  Identities=26%  Similarity=0.527  Sum_probs=25.5

Q ss_pred             CccCCCCCCcccCcchHHHHHHhhcCC
Q psy12012         53 RYQCPQCPHRTKQKSSLKTHMAVKHSD   79 (79)
Q Consensus        53 ~~~c~~c~~~f~~~~~l~~h~~~h~~e   79 (79)
                      ||+|..||+.|.+.+.+..|++.|+|+
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~   27 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQ   27 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCC
Confidence            689999999999999999999999985


No 15 
>KOG3608|consensus
Probab=98.60  E-value=6.7e-09  Score=58.20  Aligned_cols=73  Identities=22%  Similarity=0.458  Sum_probs=46.0

Q ss_pred             cccccccccccccCCCCCCccccchhhhhhcchhhHHhHhhhhhc-C--------------------------CCCccCC
Q psy12012          5 FRFSESFTSWEASEPNHAGLFVCDVCDRRYKYKSGLYQHKKYECG-K--------------------------EPRYQCP   57 (79)
Q Consensus         5 f~~~~~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~-~--------------------------~~~~~c~   57 (79)
                      +.++..|+.| +..|+++|...|+.||..|..+..|..|.+..+. .                          ..-|+|+
T Consensus       189 ~~~k~~LreH-~r~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn~ykCp  267 (467)
T KOG3608|consen  189 MGNKYRLREH-IRTHSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHVNCYKCP  267 (467)
T ss_pred             hccHHHHHHH-HHhcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhhhccccc
Confidence            4556667777 6677777777777777766666666666554321 1                          1246667


Q ss_pred             CCCCcccCcchHHHHHHhhcC
Q psy12012         58 QCPHRTKQKSSLKTHMAVKHS   78 (79)
Q Consensus        58 ~c~~~f~~~~~l~~h~~~h~~   78 (79)
                      .|..+....+.|.+|++..+.
T Consensus       268 lCdmtc~~~ssL~~H~r~rHs  288 (467)
T KOG3608|consen  268 LCDMTCSSASSLTTHIRYRHS  288 (467)
T ss_pred             ccccCCCChHHHHHHHHhhhc
Confidence            777777777777777765543


No 16 
>KOG3608|consensus
Probab=98.60  E-value=1.7e-08  Score=56.60  Aligned_cols=52  Identities=29%  Similarity=0.662  Sum_probs=25.1

Q ss_pred             cccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCcccCcchHHHHHHhh
Q psy12012         25 FVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRTKQKSSLKTHMAVK   76 (79)
Q Consensus        25 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~h   76 (79)
                      |+|+.|+-.....+.|..|++..+...+||+|..|...+...+.|+.|..+|
T Consensus       264 ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~H  315 (467)
T KOG3608|consen  264 YKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVH  315 (467)
T ss_pred             ccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhc
Confidence            3444444444444444444443222245555555555555555555555544


No 17 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.55  E-value=1.9e-07  Score=39.50  Aligned_cols=52  Identities=25%  Similarity=0.523  Sum_probs=38.9

Q ss_pred             ccccchhhhhhcchhhHHhHhhh-hhcCCCCccCCCCCCcccCcchHHHHHHhhcC
Q psy12012         24 LFVCDVCDRRYKYKSGLYQHKKY-ECGKEPRYQCPQCPHRTKQKSSLKTHMAVKHS   78 (79)
Q Consensus        24 ~~~c~~c~~~~~~~~~l~~h~~~-~~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~   78 (79)
                      .|.|+.|++. .....|..|... |....+.+.|++|...+.  ..|..|+..+++
T Consensus         2 ~f~CP~C~~~-~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H~   54 (54)
T PF05605_consen    2 SFTCPYCGKG-FSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQHR   54 (54)
T ss_pred             CcCCCCCCCc-cCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhcC
Confidence            4899999995 445779999776 444245788999987654  488899988764


No 18 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.53  E-value=2.5e-09  Score=38.84  Aligned_cols=24  Identities=8%  Similarity=0.373  Sum_probs=20.4

Q ss_pred             cccccccCCCCCCccccchhhhhhc
Q psy12012         11 FTSWEASEPNHAGLFVCDVCDRRYK   35 (79)
Q Consensus        11 ~~~~~~~~~~~~~~~~c~~c~~~~~   35 (79)
                      |..| +..|++++||.|..|++.|.
T Consensus         2 l~~H-~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    2 LRRH-MRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHH-HHHHSSSSSEEESSSSEEES
T ss_pred             HHHH-hhhcCCCCCCCCCCCcCeeC
Confidence            5667 66799999999999999885


No 19 
>PHA02768 hypothetical protein; Provisional
Probab=98.46  E-value=1e-07  Score=40.22  Aligned_cols=25  Identities=28%  Similarity=0.635  Sum_probs=23.6

Q ss_pred             CccCCCCCCcccCcchHHHHHHhhc
Q psy12012         53 RYQCPQCPHRTKQKSSLKTHMAVKH   77 (79)
Q Consensus        53 ~~~c~~c~~~f~~~~~l~~h~~~h~   77 (79)
                      -|.|+.|++.|...+.|..|+++|+
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~   29 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN   29 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC
Confidence            4899999999999999999999997


No 20 
>PHA00733 hypothetical protein
Probab=98.41  E-value=2.1e-07  Score=45.95  Aligned_cols=55  Identities=18%  Similarity=0.187  Sum_probs=42.8

Q ss_pred             CCCccccchhhhhhcchhhHHhHhh-----hhhcCCCCccCCCCCCcccCcchHHHHHHhh
Q psy12012         21 HAGLFVCDVCDRRYKYKSGLYQHKK-----YECGKEPRYQCPQCPHRTKQKSSLKTHMAVK   76 (79)
Q Consensus        21 ~~~~~~c~~c~~~~~~~~~l~~h~~-----~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~h   76 (79)
                      ..+++.|.+|...+..+..|..+..     ...+ .+||.|..|++.|...+.|..|++.+
T Consensus        37 ~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~-~kPy~C~~Cgk~Fss~s~L~~H~r~h   96 (128)
T PHA00733         37 EQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKA-VSPYVCPLCLMPFSSSVSLKQHIRYT   96 (128)
T ss_pred             hhhhHHHHHHhhhccChhhhcchHHHHhhcccCC-CCCccCCCCCCcCCCHHHHHHHHhcC
Confidence            4577899999988887776665511     1223 67999999999999999999998854


No 21 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.41  E-value=1.3e-07  Score=33.13  Aligned_cols=22  Identities=45%  Similarity=0.846  Sum_probs=13.3

Q ss_pred             ccCCCCCCcccCcchHHHHHHh
Q psy12012         54 YQCPQCPHRTKQKSSLKTHMAV   75 (79)
Q Consensus        54 ~~c~~c~~~f~~~~~l~~h~~~   75 (79)
                      |.|+.|++.|.....|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            3466666666666666666654


No 22 
>KOG3993|consensus
Probab=98.30  E-value=1.9e-07  Score=53.48  Aligned_cols=54  Identities=17%  Similarity=0.544  Sum_probs=46.2

Q ss_pred             ccccchhhhhhcchhhHHhHhhhhhcC-------C-------------------------CCccCCCCCCcccCcchHHH
Q psy12012         24 LFVCDVCDRRYKYKSGLYQHKKYECGK-------E-------------------------PRYQCPQCPHRTKQKSSLKT   71 (79)
Q Consensus        24 ~~~c~~c~~~~~~~~~l~~h~~~~~~~-------~-------------------------~~~~c~~c~~~f~~~~~l~~   71 (79)
                      -|+|.+|+|-|..+.+|..|.++|...       .                         -.|.|..|++.|.....|..
T Consensus       295 EYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrK  374 (500)
T KOG3993|consen  295 EYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRK  374 (500)
T ss_pred             eecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccccCCcccCceeecHHhhhhhHHHHHHHH
Confidence            489999999999999999999988421       1                         13789999999999999999


Q ss_pred             HHHhhc
Q psy12012         72 HMAVKH   77 (79)
Q Consensus        72 h~~~h~   77 (79)
                      |+-+|+
T Consensus       375 Hqlthq  380 (500)
T KOG3993|consen  375 HQLTHQ  380 (500)
T ss_pred             hHHhhh
Confidence            988775


No 23 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.26  E-value=4e-07  Score=31.84  Aligned_cols=23  Identities=26%  Similarity=0.722  Sum_probs=20.9

Q ss_pred             cccchhhhhhcchhhHHhHhhhh
Q psy12012         25 FVCDVCDRRYKYKSGLYQHKKYE   47 (79)
Q Consensus        25 ~~c~~c~~~~~~~~~l~~h~~~~   47 (79)
                      |.|..|++.|.....|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            67999999999999999999863


No 24 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.25  E-value=7.3e-07  Score=31.21  Aligned_cols=24  Identities=42%  Similarity=0.897  Sum_probs=15.0

Q ss_pred             ccCCCCCCcccCcchHHHHHHhhc
Q psy12012         54 YQCPQCPHRTKQKSSLKTHMAVKH   77 (79)
Q Consensus        54 ~~c~~c~~~f~~~~~l~~h~~~h~   77 (79)
                      |.|+.|+..|.....|..|++.++
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            456777777777777777776653


No 25 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.24  E-value=1.1e-06  Score=52.32  Aligned_cols=51  Identities=16%  Similarity=0.262  Sum_probs=32.5

Q ss_pred             ccccccccccCCCCCCccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCccc
Q psy12012          8 SESFTSWEASEPNHAGLFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRTK   64 (79)
Q Consensus         8 ~~~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~   64 (79)
                      ...+..|.. .++  +++.|. |+..+ ....|..|+..+.+ .+++.|+.|+..|.
T Consensus       465 ~s~LekH~~-~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp-~Kpi~C~fC~~~v~  515 (567)
T PLN03086        465 QGEMEKHMK-VFH--EPLQCP-CGVVL-EKEQMVQHQASTCP-LRLITCRFCGDMVQ  515 (567)
T ss_pred             hHHHHHHHH-hcC--CCccCC-CCCCc-chhHHHhhhhccCC-CCceeCCCCCCccc
Confidence            445556632 232  667777 77544 44677777777777 77777777777664


No 26 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.23  E-value=1.4e-06  Score=51.94  Aligned_cols=72  Identities=18%  Similarity=0.326  Sum_probs=55.4

Q ss_pred             CcccccccccccccccCCCCCCccccchhhhhhcc----------hhhHHhHhhhhhcCCCCccCCCCCCcccCcchHHH
Q psy12012          2 FGQFRFSESFTSWEASEPNHAGLFVCDVCDRRYKY----------KSGLYQHKKYECGKEPRYQCPQCPHRTKQKSSLKT   71 (79)
Q Consensus         2 ~~~f~~~~~~~~~~~~~~~~~~~~~c~~c~~~~~~----------~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~   71 (79)
                      ||.+.....|..| ...+.+.+++.|..|+..+..          ...|..|.... + .+++.|..|++.+..+ .+..
T Consensus       483 Cg~~~~R~~L~~H-~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G-~rt~~C~~Cgk~Vrlr-dm~~  558 (567)
T PLN03086        483 CGVVLEKEQMVQH-QASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC-G-SRTAPCDSCGRSVMLK-EMDI  558 (567)
T ss_pred             CCCCcchhHHHhh-hhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHhc-C-CcceEccccCCeeeeh-hHHH
Confidence            5665556777788 667888999999999998852          34788898875 6 7899999999998876 4567


Q ss_pred             HHHhhc
Q psy12012         72 HMAVKH   77 (79)
Q Consensus        72 h~~~h~   77 (79)
                      |+..-|
T Consensus       559 H~~~~h  564 (567)
T PLN03086        559 HQIAVH  564 (567)
T ss_pred             HHHHhh
Confidence            765433


No 27 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.21  E-value=5e-07  Score=32.82  Aligned_cols=25  Identities=20%  Similarity=0.493  Sum_probs=14.9

Q ss_pred             CccCCCCCCcccCcchHHHHHHhhc
Q psy12012         53 RYQCPQCPHRTKQKSSLKTHMAVKH   77 (79)
Q Consensus        53 ~~~c~~c~~~f~~~~~l~~h~~~h~   77 (79)
                      |+.|..|+..|.....|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            3556666666666666666665553


No 28 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=98.00  E-value=2.2e-06  Score=47.83  Aligned_cols=53  Identities=32%  Similarity=0.641  Sum_probs=43.2

Q ss_pred             CCCccccch--hhhhhcchhhHHhHhhhhh------------------cCCCCccCCCCCCcccCcchHHHHH
Q psy12012         21 HAGLFVCDV--CDRRYKYKSGLYQHKKYEC------------------GKEPRYQCPQCPHRTKQKSSLKTHM   73 (79)
Q Consensus        21 ~~~~~~c~~--c~~~~~~~~~l~~h~~~~~------------------~~~~~~~c~~c~~~f~~~~~l~~h~   73 (79)
                      ++|||.|++  |++.+.....|+-|+.--+                  .+.+||.|++|++.+.+.-.|+.|.
T Consensus       346 d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr  418 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHR  418 (423)
T ss_pred             cCceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceecc
Confidence            459999988  9999999999998876311                  1148999999999999998887773


No 29 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.96  E-value=2.7e-06  Score=30.79  Aligned_cols=25  Identities=36%  Similarity=0.812  Sum_probs=22.7

Q ss_pred             ccccchhhhhhcchhhHHhHhhhhh
Q psy12012         24 LFVCDVCDRRYKYKSGLYQHKKYEC   48 (79)
Q Consensus        24 ~~~c~~c~~~~~~~~~l~~h~~~~~   48 (79)
                      ||.|..|++.|.....|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            5899999999999999999998764


No 30 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.93  E-value=1.3e-05  Score=28.21  Aligned_cols=24  Identities=46%  Similarity=0.873  Sum_probs=14.9

Q ss_pred             ccCCCCCCcccCcchHHHHHHhhc
Q psy12012         54 YQCPQCPHRTKQKSSLKTHMAVKH   77 (79)
Q Consensus        54 ~~c~~c~~~f~~~~~l~~h~~~h~   77 (79)
                      +.|..|++.|.....|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            356666666666666666666543


No 31 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.89  E-value=5.8e-06  Score=28.77  Aligned_cols=23  Identities=35%  Similarity=0.792  Sum_probs=19.1

Q ss_pred             cccchhhhhhcchhhHHhHhhhh
Q psy12012         25 FVCDVCDRRYKYKSGLYQHKKYE   47 (79)
Q Consensus        25 ~~c~~c~~~~~~~~~l~~h~~~~   47 (79)
                      |.|+.|+..|.....|..|+..+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            57999999999999999999875


No 32 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.88  E-value=9.2e-06  Score=38.01  Aligned_cols=24  Identities=29%  Similarity=0.789  Sum_probs=20.5

Q ss_pred             CccCCCCCCcccCcchHHHHHHhh
Q psy12012         53 RYQCPQCPHRTKQKSSLKTHMAVK   76 (79)
Q Consensus        53 ~~~c~~c~~~f~~~~~l~~h~~~h   76 (79)
                      .+.|..|+..|.....|..|++.+
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             CCCCCccCCCCcCHHHHHHHHcCc
Confidence            588999999999999999999864


No 33 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.84  E-value=2.2e-05  Score=32.51  Aligned_cols=35  Identities=11%  Similarity=0.208  Sum_probs=20.4

Q ss_pred             CCCCCCccccchhhhhhcchhhHHhHhhhhhcCCCC
Q psy12012         18 EPNHAGLFVCDVCDRRYKYKSGLYQHKKYECGKEPR   53 (79)
Q Consensus        18 ~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~   53 (79)
                      ....+.|-+|++|+..+.+..+|.+|+.+.++ .+|
T Consensus        18 ~~~S~~PatCP~C~a~~~~srnLrRHle~~H~-~k~   52 (54)
T PF09237_consen   18 KSQSEQPATCPICGAVIRQSRNLRRHLEIRHF-KKP   52 (54)
T ss_dssp             CCTTS--EE-TTT--EESSHHHHHHHHHHHTT-TS-
T ss_pred             hhccCCCCCCCcchhhccchhhHHHHHHHHhc-ccC
Confidence            34456677888888888888888888877666 443


No 34 
>KOG3993|consensus
Probab=97.62  E-value=1.7e-05  Score=45.84  Aligned_cols=53  Identities=25%  Similarity=0.561  Sum_probs=45.6

Q ss_pred             CccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCcccCcchHHHHHHhh
Q psy12012         23 GLFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRTKQKSSLKTHMAVK   76 (79)
Q Consensus        23 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~h   76 (79)
                      ..|.|..|...|...=.|.+|...-+- ...|+|++|++.|+-...|..|.|=|
T Consensus       266 GdyiCqLCK~kYeD~F~LAQHrC~RIV-~vEYrCPEC~KVFsCPANLASHRRWH  318 (500)
T KOG3993|consen  266 GDYICQLCKEKYEDAFALAQHRCPRIV-HVEYRCPECDKVFSCPANLASHRRWH  318 (500)
T ss_pred             HHHHHHHHHHhhhhHHHHhhccCCeeE-EeeecCCcccccccCchhhhhhhccc
Confidence            358999999999988899999876555 56799999999999999999997754


No 35 
>PRK04860 hypothetical protein; Provisional
Probab=97.54  E-value=4.6e-05  Score=39.08  Aligned_cols=38  Identities=24%  Similarity=0.572  Sum_probs=32.3

Q ss_pred             ccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCcccCc
Q psy12012         24 LFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRTKQK   66 (79)
Q Consensus        24 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~   66 (79)
                      +|.|. |+.   ....+..|.+++.+ +++|.|..|+..|...
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g-~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRG-EAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcC-CccEECCCCCceeEEe
Confidence            68997 986   56678999999999 8899999999887654


No 36 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.52  E-value=7.2e-05  Score=26.22  Aligned_cols=24  Identities=29%  Similarity=0.636  Sum_probs=20.9

Q ss_pred             cccchhhhhhcchhhHHhHhhhhh
Q psy12012         25 FVCDVCDRRYKYKSGLYQHKKYEC   48 (79)
Q Consensus        25 ~~c~~c~~~~~~~~~l~~h~~~~~   48 (79)
                      +.|..|++.|.....+..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            579999999999999999998653


No 37 
>PHA00732 hypothetical protein
Probab=97.48  E-value=0.00011  Score=33.48  Aligned_cols=26  Identities=27%  Similarity=0.473  Sum_probs=22.6

Q ss_pred             CccCCCCCCcccCcchHHHHHHh-hcC
Q psy12012         53 RYQCPQCPHRTKQKSSLKTHMAV-KHS   78 (79)
Q Consensus        53 ~~~c~~c~~~f~~~~~l~~h~~~-h~~   78 (79)
                      ||.|..|++.|...+.|..|++. |.+
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~   27 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL   27 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC
Confidence            58899999999999999999984 543


No 38 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.46  E-value=8.7e-05  Score=26.00  Aligned_cols=23  Identities=48%  Similarity=0.985  Sum_probs=12.8

Q ss_pred             ccCCCCCCcccCcchHHHHHHhhc
Q psy12012         54 YQCPQCPHRTKQKSSLKTHMAVKH   77 (79)
Q Consensus        54 ~~c~~c~~~f~~~~~l~~h~~~h~   77 (79)
                      |.|+.|+.... ...|..|++.++
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            35666665555 556666666654


No 39 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.41  E-value=0.00014  Score=30.17  Aligned_cols=28  Identities=29%  Similarity=0.649  Sum_probs=21.1

Q ss_pred             CCCccCCCCCCcccCcchHHHHHHhhcC
Q psy12012         51 EPRYQCPQCPHRTKQKSSLKTHMAVKHS   78 (79)
Q Consensus        51 ~~~~~c~~c~~~f~~~~~l~~h~~~h~~   78 (79)
                      +.|-.|++|+..+.+...|.+|+.++|+
T Consensus        22 ~~PatCP~C~a~~~~srnLrRHle~~H~   49 (54)
T PF09237_consen   22 EQPATCPICGAVIRQSRNLRRHLEIRHF   49 (54)
T ss_dssp             S--EE-TTT--EESSHHHHHHHHHHHTT
T ss_pred             CCCCCCCcchhhccchhhHHHHHHHHhc
Confidence            6789999999999999999999988875


No 40 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.29  E-value=9.8e-05  Score=26.05  Aligned_cols=21  Identities=24%  Similarity=0.548  Sum_probs=12.2

Q ss_pred             cCCCCCCcccCcchHHHHHHh
Q psy12012         55 QCPQCPHRTKQKSSLKTHMAV   75 (79)
Q Consensus        55 ~c~~c~~~f~~~~~l~~h~~~   75 (79)
                      .|.+|...|.....+..|++.
T Consensus         2 ~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    2 YCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCcCCHHHHHHHHCc
Confidence            455666666666666666543


No 41 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.04  E-value=0.00044  Score=29.15  Aligned_cols=45  Identities=20%  Similarity=0.282  Sum_probs=32.8

Q ss_pred             CcccccccccccccccCCCCC-CccccchhhhhhcchhhHHhHhhhhh
Q psy12012          2 FGQFRFSESFTSWEASEPNHA-GLFVCDVCDRRYKYKSGLYQHKKYEC   48 (79)
Q Consensus         2 ~~~f~~~~~~~~~~~~~~~~~-~~~~c~~c~~~~~~~~~l~~h~~~~~   48 (79)
                      ||+......|..|....|..+ +.+.|++|...+.  .+|..|+...+
T Consensus         8 C~~~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    8 CGKGFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             CCCccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            566555678888877777654 6799999987654  47888887654


No 42 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=96.86  E-value=0.0015  Score=23.23  Aligned_cols=21  Identities=24%  Similarity=0.624  Sum_probs=13.5

Q ss_pred             ccCCCCCCcccCcchHHHHHHh
Q psy12012         54 YQCPQCPHRTKQKSSLKTHMAV   75 (79)
Q Consensus        54 ~~c~~c~~~f~~~~~l~~h~~~   75 (79)
                      ..|+.|++.| ..+.|..|+.+
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~~   23 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEKI   23 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHHh
Confidence            4577787777 44566667543


No 43 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.59  E-value=0.0007  Score=24.37  Aligned_cols=22  Identities=41%  Similarity=0.821  Sum_probs=14.3

Q ss_pred             cccchhhhhhcchhhHHhHhhh
Q psy12012         25 FVCDVCDRRYKYKSGLYQHKKY   46 (79)
Q Consensus        25 ~~c~~c~~~~~~~~~l~~h~~~   46 (79)
                      |.|..|++.|.....+..|+..
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            4566677777776666666653


No 44 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=95.58  E-value=0.01  Score=22.38  Aligned_cols=22  Identities=18%  Similarity=0.493  Sum_probs=14.0

Q ss_pred             CccCCCCCCcccCcchHHHHHH
Q psy12012         53 RYQCPQCPHRTKQKSSLKTHMA   74 (79)
Q Consensus        53 ~~~c~~c~~~f~~~~~l~~h~~   74 (79)
                      ++.|..|...|.....+..|..
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHC
Confidence            4567777777776666666643


No 45 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=95.45  E-value=0.0036  Score=35.58  Aligned_cols=24  Identities=46%  Similarity=0.940  Sum_probs=21.0

Q ss_pred             CCccccchhhhhhcchhhHHhHhh
Q psy12012         22 AGLFVCDVCDRRYKYKSGLYQHKK   45 (79)
Q Consensus        22 ~~~~~c~~c~~~~~~~~~l~~h~~   45 (79)
                      .|||+|++|++.+.....|+-|+.
T Consensus       396 ~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         396 DKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             CCceeccccchhhccCccceeccc
Confidence            489999999999999888887765


No 46 
>KOG2893|consensus
Probab=95.16  E-value=0.0043  Score=33.97  Aligned_cols=45  Identities=24%  Similarity=0.485  Sum_probs=33.6

Q ss_pred             CCccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCcccCcchHHHH
Q psy12012         22 AGLFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRTKQKSSLKTH   72 (79)
Q Consensus        22 ~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h   72 (79)
                      .|+ .|=+|++.|.....|.+|++.     +-|+|-+|-+.+-.-..|..|
T Consensus         9 ~kp-wcwycnrefddekiliqhqka-----khfkchichkkl~sgpglsih   53 (341)
T KOG2893|consen    9 DKP-WCWYCNREFDDEKILIQHQKA-----KHFKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             CCc-eeeecccccchhhhhhhhhhh-----ccceeeeehhhhccCCCceee
Confidence            456 477899999999999999884     568999998665444445444


No 47 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=95.04  E-value=0.016  Score=28.00  Aligned_cols=33  Identities=18%  Similarity=0.490  Sum_probs=23.7

Q ss_pred             CCCccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCcccCc
Q psy12012         21 HAGLFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRTKQK   66 (79)
Q Consensus        21 ~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~   66 (79)
                      |.|. .|+.||..|--   |.         ..|..|+.||..|.-.
T Consensus         7 GtKR-~Cp~CG~kFYD---Ln---------k~PivCP~CG~~~~~~   39 (108)
T PF09538_consen    7 GTKR-TCPSCGAKFYD---LN---------KDPIVCPKCGTEFPPE   39 (108)
T ss_pred             CCcc-cCCCCcchhcc---CC---------CCCccCCCCCCccCcc
Confidence            4444 79999988743   32         5678899999887665


No 48 
>KOG1146|consensus
Probab=94.99  E-value=0.023  Score=37.81  Aligned_cols=64  Identities=19%  Similarity=0.324  Sum_probs=49.0

Q ss_pred             ccccccCCCCCCccccchhhhhhcchhhHHhHhhhhhc------------------------CCCCccCCCCCCcccCcc
Q psy12012         12 TSWEASEPNHAGLFVCDVCDRRYKYKSGLYQHKKYECG------------------------KEPRYQCPQCPHRTKQKS   67 (79)
Q Consensus        12 ~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~------------------------~~~~~~c~~c~~~f~~~~   67 (79)
                      -.+....+.-.+.+.|+.|+-.|.....|..||+.-+.                        ..++|.|..|...+....
T Consensus       453 ~~~t~~L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng  532 (1406)
T KOG1146|consen  453 EGQTVVLHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNG  532 (1406)
T ss_pred             ccceeeeecccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCcccceeeeeeeecch
Confidence            33334455556889999999999999999999997110                        035788999999999988


Q ss_pred             hHHHHHHh
Q psy12012         68 SLKTHMAV   75 (79)
Q Consensus        68 ~l~~h~~~   75 (79)
                      .|..|+..
T Consensus       533 ~LsihlqS  540 (1406)
T KOG1146|consen  533 NLSIHLQS  540 (1406)
T ss_pred             HHHHHHHH
Confidence            88888764


No 49 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=94.65  E-value=0.017  Score=21.84  Aligned_cols=24  Identities=38%  Similarity=0.942  Sum_probs=15.4

Q ss_pred             cccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCC
Q psy12012         25 FVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPH   61 (79)
Q Consensus        25 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   61 (79)
                      |.|.+||..+...             ..++.|++|+.
T Consensus         2 ~~C~~CGy~y~~~-------------~~~~~CP~Cg~   25 (33)
T cd00350           2 YVCPVCGYIYDGE-------------EAPWVCPVCGA   25 (33)
T ss_pred             EECCCCCCEECCC-------------cCCCcCcCCCC
Confidence            5677887554332             24678888875


No 50 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=94.65  E-value=0.03  Score=23.78  Aligned_cols=30  Identities=13%  Similarity=0.409  Sum_probs=25.4

Q ss_pred             CCCCccccchhhhhhcchhhHHhHhhhhhc
Q psy12012         20 NHAGLFVCDVCDRRYKYKSGLYQHKKYECG   49 (79)
Q Consensus        20 ~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~   49 (79)
                      .|+.-+.|+.|+..|....++.+|..-.++
T Consensus        13 DGE~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          13 DGEEFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             CCceeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            467788999999999999999999876554


No 51 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=94.34  E-value=0.0069  Score=34.83  Aligned_cols=55  Identities=24%  Similarity=0.464  Sum_probs=40.4

Q ss_pred             CccccchhhhhhcchhhHHhHhh--hhhcCC--CCccCC--CCCCcccCcchHHHHHHhhcC
Q psy12012         23 GLFVCDVCDRRYKYKSGLYQHKK--YECGKE--PRYQCP--QCPHRTKQKSSLKTHMAVKHS   78 (79)
Q Consensus        23 ~~~~c~~c~~~~~~~~~l~~h~~--~~~~~~--~~~~c~--~c~~~f~~~~~l~~h~~~h~~   78 (79)
                      .++.|..|...+.....+..|.+  .|.+ +  +++.|+  .|+..|.....+..|...|++
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~-~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~  348 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSG-ESLKPFSCPYSLCGKLFSRNDALKRHILLHTS  348 (467)
T ss_pred             cCCCCccccCCcccccccccccccccccc-ccCCceeeeccCCCccccccccccCCcccccC
Confidence            35677778778888888888888  6777 6  778887  688888777777766665543


No 52 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=93.88  E-value=0.034  Score=28.93  Aligned_cols=24  Identities=38%  Similarity=0.820  Sum_probs=18.6

Q ss_pred             ccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCC
Q psy12012         24 LFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPH   61 (79)
Q Consensus        24 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   61 (79)
                      .|+|.+||..+             .+ +.|-.||+|+.
T Consensus       134 ~~vC~vCGy~~-------------~g-e~P~~CPiCga  157 (166)
T COG1592         134 VWVCPVCGYTH-------------EG-EAPEVCPICGA  157 (166)
T ss_pred             EEEcCCCCCcc-------------cC-CCCCcCCCCCC
Confidence            79999997542             35 67889999983


No 53 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=93.87  E-value=0.032  Score=25.88  Aligned_cols=24  Identities=21%  Similarity=0.676  Sum_probs=21.2

Q ss_pred             ccccchhhhhhcchhhHHhHhhhh
Q psy12012         24 LFVCDVCDRRYKYKSGLYQHKKYE   47 (79)
Q Consensus        24 ~~~c~~c~~~~~~~~~l~~h~~~~   47 (79)
                      .+.|..|++.|.....|..|++.+
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             CCCCCccCCCCcCHHHHHHHHcCc
Confidence            589999999999999999999975


No 54 
>PRK04860 hypothetical protein; Provisional
Probab=93.70  E-value=0.012  Score=30.43  Aligned_cols=29  Identities=10%  Similarity=0.295  Sum_probs=23.0

Q ss_pred             ccccccccccCCCCCCccccchhhhhhcch
Q psy12012          8 SESFTSWEASEPNHAGLFVCDVCDRRYKYK   37 (79)
Q Consensus         8 ~~~~~~~~~~~~~~~~~~~c~~c~~~~~~~   37 (79)
                      ..+++.| ...++++++|.|..|+..|...
T Consensus       128 ~~~~rrH-~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        128 QLTVRRH-NRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             eCHHHHH-HHHhcCCccEECCCCCceeEEe
Confidence            4455667 7788899999999999887654


No 55 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=92.06  E-value=0.024  Score=30.57  Aligned_cols=45  Identities=18%  Similarity=0.352  Sum_probs=27.8

Q ss_pred             CCccccchhhhhhcchhhHHhHhhhhh---c------CCC-----CccCCCCCCcccCc
Q psy12012         22 AGLFVCDVCDRRYKYKSGLYQHKKYEC---G------KEP-----RYQCPQCPHRTKQK   66 (79)
Q Consensus        22 ~~~~~c~~c~~~~~~~~~l~~h~~~~~---~------~~~-----~~~c~~c~~~f~~~   66 (79)
                      .+..+|++|++.|....-.....+.-.   .      ...     ...|+.||.++...
T Consensus         3 ~k~~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             CCceECCCCCCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCCCccccc
Confidence            356789999999988754443333210   0      012     26799999876543


No 56 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=91.85  E-value=0.079  Score=20.16  Aligned_cols=25  Identities=32%  Similarity=0.729  Sum_probs=16.3

Q ss_pred             ccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCC
Q psy12012         24 LFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPH   61 (79)
Q Consensus        24 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   61 (79)
                      .|.|.+||..+...             ..|..|++|+.
T Consensus         2 ~~~C~~CG~i~~g~-------------~~p~~CP~Cg~   26 (34)
T cd00729           2 VWVCPVCGYIHEGE-------------EAPEKCPICGA   26 (34)
T ss_pred             eEECCCCCCEeECC-------------cCCCcCcCCCC
Confidence            47788887554321             34678999875


No 57 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=91.52  E-value=0.13  Score=25.61  Aligned_cols=32  Identities=13%  Similarity=0.218  Sum_probs=21.9

Q ss_pred             ccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCcccCcchH
Q psy12012         26 VCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRTKQKSSL   69 (79)
Q Consensus        26 ~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l   69 (79)
                      .|+.||+.|.-   |.         ..|..|+.||..|.....+
T Consensus        11 ~Cp~cg~kFYD---Ln---------k~p~vcP~cg~~~~~~~~~   42 (129)
T TIGR02300        11 ICPNTGSKFYD---LN---------RRPAVSPYTGEQFPPEEAL   42 (129)
T ss_pred             cCCCcCccccc---cC---------CCCccCCCcCCccCcchhh
Confidence            78888877643   22         5678899998877655333


No 58 
>KOG2186|consensus
Probab=91.20  E-value=0.15  Score=28.37  Aligned_cols=45  Identities=24%  Similarity=0.506  Sum_probs=27.3

Q ss_pred             cccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCcccCcchHHHHH
Q psy12012         25 FVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRTKQKSSLKTHM   73 (79)
Q Consensus        25 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~   73 (79)
                      |.|.+||....-+. +..|+..-.+  .-|.|-.|+..|..- +...|.
T Consensus         4 FtCnvCgEsvKKp~-vekH~srCrn--~~fSCIDC~k~F~~~-sYknH~   48 (276)
T KOG2186|consen    4 FTCNVCGESVKKPQ-VEKHMSRCRN--AYFSCIDCGKTFERV-SYKNHT   48 (276)
T ss_pred             Eehhhhhhhccccc-hHHHHHhccC--CeeEEeecccccccc-hhhhhh
Confidence            56777776655443 6667766544  347777777777663 334453


No 59 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=90.83  E-value=0.13  Score=20.83  Aligned_cols=26  Identities=27%  Similarity=0.781  Sum_probs=17.9

Q ss_pred             cccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCc
Q psy12012         25 FVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHR   62 (79)
Q Consensus        25 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~   62 (79)
                      |.|..||..+...           . ..+..|+.||..
T Consensus         3 Y~C~~Cg~~~~~~-----------~-~~~irC~~CG~r   28 (44)
T smart00659        3 YICGECGRENEIK-----------S-KDVVRCRECGYR   28 (44)
T ss_pred             EECCCCCCEeecC-----------C-CCceECCCCCce
Confidence            7788888776543           1 345788888854


No 60 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=88.87  E-value=0.077  Score=27.32  Aligned_cols=12  Identities=25%  Similarity=0.611  Sum_probs=7.7

Q ss_pred             ccCCCCCCcccC
Q psy12012         54 YQCPQCPHRTKQ   65 (79)
Q Consensus        54 ~~c~~c~~~f~~   65 (79)
                      ++|+.|+.+|..
T Consensus        29 ~~c~~c~~~f~~   40 (154)
T PRK00464         29 RECLACGKRFTT   40 (154)
T ss_pred             eeccccCCcceE
Confidence            566667666654


No 61 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=88.51  E-value=0.42  Score=22.95  Aligned_cols=25  Identities=32%  Similarity=0.813  Sum_probs=22.3

Q ss_pred             ccC----CCCCCcccCcchHHHHHHhhcC
Q psy12012         54 YQC----PQCPHRTKQKSSLKTHMAVKHS   78 (79)
Q Consensus        54 ~~c----~~c~~~f~~~~~l~~h~~~h~~   78 (79)
                      |.|    ..|+........+..|.+.+||
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            788    8899999999999999998876


No 62 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=88.42  E-value=0.23  Score=25.65  Aligned_cols=35  Identities=17%  Similarity=0.566  Sum_probs=25.6

Q ss_pred             CCCCccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCccc
Q psy12012         20 NHAGLFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRTK   64 (79)
Q Consensus        20 ~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~   64 (79)
                      ....-|.|+.|+..|+...++.          .-|.|+.||....
T Consensus       105 ~~~~~Y~Cp~c~~r~tf~eA~~----------~~F~Cp~Cg~~L~  139 (158)
T TIGR00373       105 TNNMFFICPNMCVRFTFNEAME----------LNFTCPRCGAMLD  139 (158)
T ss_pred             cCCCeEECCCCCcEeeHHHHHH----------cCCcCCCCCCEee
Confidence            3445689999998888776663          2489999986543


No 63 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=88.22  E-value=0.25  Score=26.04  Aligned_cols=35  Identities=23%  Similarity=0.718  Sum_probs=25.3

Q ss_pred             CCCccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCcccC
Q psy12012         21 HAGLFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRTKQ   65 (79)
Q Consensus        21 ~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~   65 (79)
                      ...-|.|+.|+..|+...++.          .-|.|+.||.....
T Consensus       114 ~~~~Y~Cp~C~~rytf~eA~~----------~~F~Cp~Cg~~L~~  148 (178)
T PRK06266        114 NNMFFFCPNCHIRFTFDEAME----------YGFRCPQCGEMLEE  148 (178)
T ss_pred             CCCEEECCCCCcEEeHHHHhh----------cCCcCCCCCCCCee
Confidence            345689999998888766542          25899999976443


No 64 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=88.10  E-value=0.18  Score=19.57  Aligned_cols=30  Identities=20%  Similarity=0.698  Sum_probs=19.5

Q ss_pred             ccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCC
Q psy12012         24 LFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPH   61 (79)
Q Consensus        24 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   61 (79)
                      .|.|..||..|........        .....|+.|+.
T Consensus         5 ~y~C~~Cg~~fe~~~~~~~--------~~~~~CP~Cg~   34 (41)
T smart00834        5 EYRCEDCGHTFEVLQKISD--------DPLATCPECGG   34 (41)
T ss_pred             EEEcCCCCCEEEEEEecCC--------CCCCCCCCCCC
Confidence            3788999988766433311        23467888886


No 65 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=87.77  E-value=0.26  Score=18.95  Aligned_cols=34  Identities=15%  Similarity=0.435  Sum_probs=21.3

Q ss_pred             cccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCccc
Q psy12012         25 FVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRTK   64 (79)
Q Consensus        25 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~   64 (79)
                      ..|+.|+..|....+...     .. .....|+.|+..|.
T Consensus         3 ~~CP~C~~~~~v~~~~~~-----~~-~~~v~C~~C~~~~~   36 (38)
T TIGR02098         3 IQCPNCKTSFRVVDSQLG-----AN-GGKVRCGKCGHVWY   36 (38)
T ss_pred             EECCCCCCEEEeCHHHcC-----CC-CCEEECCCCCCEEE
Confidence            468888888777654431     11 22467898887664


No 66 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=87.62  E-value=0.15  Score=20.25  Aligned_cols=29  Identities=17%  Similarity=0.742  Sum_probs=19.3

Q ss_pred             cccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCC
Q psy12012         25 FVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPH   61 (79)
Q Consensus        25 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   61 (79)
                      |.|..||..|.....+..        ..+..|+.|+.
T Consensus         6 y~C~~Cg~~fe~~~~~~~--------~~~~~CP~Cg~   34 (42)
T PF09723_consen    6 YRCEECGHEFEVLQSISE--------DDPVPCPECGS   34 (42)
T ss_pred             EEeCCCCCEEEEEEEcCC--------CCCCcCCCCCC
Confidence            788899888766433221        24567888886


No 67 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=87.29  E-value=0.32  Score=24.50  Aligned_cols=23  Identities=26%  Similarity=0.680  Sum_probs=15.0

Q ss_pred             ccccchhhhhhcchhhHHhHhhhhhc
Q psy12012         24 LFVCDVCDRRYKYKSGLYQHKKYECG   49 (79)
Q Consensus        24 ~~~c~~c~~~~~~~~~l~~h~~~~~~   49 (79)
                      -..|-+||+.|..   |.+|.+.|+|
T Consensus        72 ~i~clecGk~~k~---LkrHL~~~~g   94 (132)
T PF05443_consen   72 YIICLECGKKFKT---LKRHLRTHHG   94 (132)
T ss_dssp             -EE-TBT--EESB---HHHHHHHTT-
T ss_pred             eeEEccCCcccch---HHHHHHHccC
Confidence            4579999999887   7889888855


No 68 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=87.23  E-value=0.17  Score=20.92  Aligned_cols=29  Identities=24%  Similarity=0.804  Sum_probs=18.7

Q ss_pred             cccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCC
Q psy12012         25 FVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPH   61 (79)
Q Consensus        25 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   61 (79)
                      |.|..|+..|.....+.       . ..+..|+.|+.
T Consensus         6 y~C~~Cg~~fe~~~~~~-------~-~~~~~CP~Cg~   34 (52)
T TIGR02605         6 YRCTACGHRFEVLQKMS-------D-DPLATCPECGG   34 (52)
T ss_pred             EEeCCCCCEeEEEEecC-------C-CCCCCCCCCCC
Confidence            78899998887642221       1 23456898885


No 69 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=86.62  E-value=0.41  Score=24.38  Aligned_cols=38  Identities=16%  Similarity=0.568  Sum_probs=25.1

Q ss_pred             CCCccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCcc
Q psy12012         21 HAGLFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRT   63 (79)
Q Consensus        21 ~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f   63 (79)
                      ...-|.|+.|+..|.....+..- .   . ...|.|+.|+...
T Consensus        96 ~~~~Y~Cp~C~~~y~~~ea~~~~-d---~-~~~f~Cp~Cg~~l  133 (147)
T smart00531       96 NNAYYKCPNCQSKYTFLEANQLL-D---M-DGTFTCPRCGEEL  133 (147)
T ss_pred             CCcEEECcCCCCEeeHHHHHHhc-C---C-CCcEECCCCCCEE
Confidence            44568999999888865444321 1   1 2239999998764


No 70 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=86.29  E-value=0.23  Score=27.03  Aligned_cols=28  Identities=29%  Similarity=0.619  Sum_probs=19.7

Q ss_pred             CCCccCCCCCCcccCcchHHHHHHhhcC
Q psy12012         51 EPRYQCPQCPHRTKQKSSLKTHMAVKHS   78 (79)
Q Consensus        51 ~~~~~c~~c~~~f~~~~~l~~h~~~h~~   78 (79)
                      +..|.|..|++.|.-......|+..-|.
T Consensus        75 ~~K~~C~lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   75 EDKWRCPLCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             SEEEEE-SSS-EESSHHHHHHHHHHH-H
T ss_pred             CCEECCCCCCcccCChHHHHHHHhhcCH
Confidence            3458899999999999888888775543


No 71 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=86.07  E-value=0.39  Score=18.54  Aligned_cols=33  Identities=24%  Similarity=0.737  Sum_probs=20.8

Q ss_pred             ccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCccc
Q psy12012         26 VCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRTK   64 (79)
Q Consensus        26 ~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~   64 (79)
                      .|+.|+..|....+-.   .  .+ .....|+.|+..|.
T Consensus         4 ~CP~C~~~f~v~~~~l---~--~~-~~~vrC~~C~~~f~   36 (37)
T PF13719_consen    4 TCPNCQTRFRVPDDKL---P--AG-GRKVRCPKCGHVFR   36 (37)
T ss_pred             ECCCCCceEEcCHHHc---c--cC-CcEEECCCCCcEee
Confidence            5888888877764321   1  12 34578888887664


No 72 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=86.05  E-value=0.35  Score=18.59  Aligned_cols=32  Identities=19%  Similarity=0.527  Sum_probs=20.2

Q ss_pred             ccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCcc
Q psy12012         26 VCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRT   63 (79)
Q Consensus        26 ~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f   63 (79)
                      .|+.|+..|.......   .  .. ....+|+.|+..|
T Consensus         4 ~Cp~C~~~y~i~d~~i---p--~~-g~~v~C~~C~~~f   35 (36)
T PF13717_consen    4 TCPNCQAKYEIDDEKI---P--PK-GRKVRCSKCGHVF   35 (36)
T ss_pred             ECCCCCCEEeCCHHHC---C--CC-CcEEECCCCCCEe
Confidence            5778887777765432   1  11 3457788888765


No 73 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=85.69  E-value=0.48  Score=20.48  Aligned_cols=31  Identities=26%  Similarity=0.626  Sum_probs=18.6

Q ss_pred             ccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCC
Q psy12012         24 LFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCP   60 (79)
Q Consensus        24 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~   60 (79)
                      .|.|+.||........-    -...  ..+|.|+.||
T Consensus        27 ~F~CPnCGe~~I~Rc~~----CRk~--g~~Y~Cp~CG   57 (61)
T COG2888          27 KFPCPNCGEVEIYRCAK----CRKL--GNPYRCPKCG   57 (61)
T ss_pred             EeeCCCCCceeeehhhh----HHHc--CCceECCCcC
Confidence            47888888554433211    1112  3589999997


No 74 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=85.15  E-value=0.44  Score=19.77  Aligned_cols=28  Identities=25%  Similarity=0.604  Sum_probs=18.4

Q ss_pred             ccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCc
Q psy12012         24 LFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHR   62 (79)
Q Consensus        24 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~   62 (79)
                      .|.|..|++.+..   +.       . .....|+.|+..
T Consensus         6 ~Y~C~~Cg~~~~~---~~-------~-~~~irCp~Cg~r   33 (49)
T COG1996           6 EYKCARCGREVEL---DQ-------E-TRGIRCPYCGSR   33 (49)
T ss_pred             EEEhhhcCCeeeh---hh-------c-cCceeCCCCCcE
Confidence            4889999988721   11       1 345788988854


No 75 
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=85.00  E-value=0.66  Score=18.85  Aligned_cols=21  Identities=48%  Similarity=0.901  Sum_probs=13.9

Q ss_pred             ccCCCCCCcccCcchHHHHHH
Q psy12012         54 YQCPQCPHRTKQKSSLKTHMA   74 (79)
Q Consensus        54 ~~c~~c~~~f~~~~~l~~h~~   74 (79)
                      |+|-+|+.+...++.|..|+.
T Consensus        21 ykcfqcpftc~~kshl~nhmk   41 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMK   41 (54)
T ss_pred             ceeecCCcccchHHHHHHHHH
Confidence            456667666666777777765


No 76 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=84.95  E-value=1.1  Score=18.40  Aligned_cols=7  Identities=29%  Similarity=0.743  Sum_probs=3.4

Q ss_pred             hHHHHHH
Q psy12012         68 SLKTHMA   74 (79)
Q Consensus        68 ~l~~h~~   74 (79)
                      .|..|+.
T Consensus        38 ~L~rHl~   44 (50)
T smart00614       38 NLRRHLR   44 (50)
T ss_pred             HHHHHHH
Confidence            4445544


No 77 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=84.50  E-value=0.25  Score=19.96  Aligned_cols=30  Identities=23%  Similarity=0.546  Sum_probs=18.1

Q ss_pred             ccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCccc
Q psy12012         24 LFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRTK   64 (79)
Q Consensus        24 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~   64 (79)
                      .|.|..||..+.....           .....|+.||..+.
T Consensus         3 ~y~C~~CG~~~~~~~~-----------~~~~~Cp~CG~~~~   32 (46)
T PRK00398          3 EYKCARCGREVELDEY-----------GTGVRCPYCGYRIL   32 (46)
T ss_pred             EEECCCCCCEEEECCC-----------CCceECCCCCCeEE
Confidence            4778888776655321           11467888876543


No 78 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=83.93  E-value=0.31  Score=22.70  Aligned_cols=33  Identities=24%  Similarity=0.616  Sum_probs=21.0

Q ss_pred             CCccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCcccC
Q psy12012         22 AGLFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRTKQ   65 (79)
Q Consensus        22 ~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~   65 (79)
                      ...|.|+.|++.        ...+...+   .+.|..|+..|.-
T Consensus        33 ~~~~~Cp~C~~~--------~VkR~a~G---IW~C~kCg~~fAG   65 (89)
T COG1997          33 RAKHVCPFCGRT--------TVKRIATG---IWKCRKCGAKFAG   65 (89)
T ss_pred             hcCCcCCCCCCc--------ceeeeccC---eEEcCCCCCeecc
Confidence            346789998755        11233333   5789999887754


No 79 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=83.93  E-value=0.47  Score=27.43  Aligned_cols=51  Identities=16%  Similarity=0.252  Sum_probs=39.5

Q ss_pred             ccccccccccccc--CCCCC--Cccccc--hhhhhhcchhhHHhHhhhhhcCCCCccCC
Q psy12012          5 FRFSESFTSWEAS--EPNHA--GLFVCD--VCDRRYKYKSGLYQHKKYECGKEPRYQCP   57 (79)
Q Consensus         5 f~~~~~~~~~~~~--~~~~~--~~~~c~--~c~~~~~~~~~l~~h~~~~~~~~~~~~c~   57 (79)
                      |.....+..| ..  .|.++  +++.|.  .|++.|.....+..|...+.. ..+..+.
T Consensus       299 ~s~~~~l~~~-~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~  355 (467)
T COG5048         299 FSRSSPLTRH-LRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTS-ISPAKEK  355 (467)
T ss_pred             cccccccccc-ccccccccccCCceeeeccCCCccccccccccCCcccccC-CCccccc
Confidence            5556666777 44  78888  999999  799999999999999998877 4444443


No 80 
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=82.26  E-value=0.61  Score=21.20  Aligned_cols=32  Identities=25%  Similarity=0.626  Sum_probs=20.9

Q ss_pred             CccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCc
Q psy12012         23 GLFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHR   62 (79)
Q Consensus        23 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~   62 (79)
                      -.|.|..|+..|.    +.+++.-    ...-.|+.|+..
T Consensus        11 Y~Y~c~~cg~~~d----vvq~~~d----dplt~ce~c~a~   42 (82)
T COG2331          11 YSYECTECGNRFD----VVQAMTD----DPLTTCEECGAR   42 (82)
T ss_pred             eEEeecccchHHH----HHHhccc----CccccChhhChH
Confidence            3588999987764    4555542    344568888754


No 81 
>KOG2593|consensus
Probab=81.01  E-value=1.1  Score=27.05  Aligned_cols=40  Identities=18%  Similarity=0.541  Sum_probs=26.0

Q ss_pred             CCCCCCccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCC
Q psy12012         18 EPNHAGLFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPH   61 (79)
Q Consensus        18 ~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   61 (79)
                      ..+...-|.|+.|.+.|..-..+.   -+... .-.|.|..|+-
T Consensus       122 d~t~~~~Y~Cp~C~kkyt~Lea~~---L~~~~-~~~F~C~~C~g  161 (436)
T KOG2593|consen  122 DDTNVAGYVCPNCQKKYTSLEALQ---LLDNE-TGEFHCENCGG  161 (436)
T ss_pred             hccccccccCCccccchhhhHHHH---hhccc-CceEEEecCCC
Confidence            345566799999999988755443   22211 23588888864


No 82 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=80.91  E-value=1.1  Score=15.90  Aligned_cols=10  Identities=30%  Similarity=0.803  Sum_probs=7.4

Q ss_pred             cCCCCCCccc
Q psy12012         55 QCPQCPHRTK   64 (79)
Q Consensus        55 ~c~~c~~~f~   64 (79)
                      .|+.||..|.
T Consensus        16 ~Cp~CG~~F~   25 (26)
T PF10571_consen   16 FCPHCGYDFE   25 (26)
T ss_pred             cCCCCCCCCc
Confidence            5788887774


No 83 
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=80.16  E-value=1  Score=22.82  Aligned_cols=21  Identities=24%  Similarity=0.380  Sum_probs=12.1

Q ss_pred             cCCCCCCcccCcchHHHHHHhhcC
Q psy12012         55 QCPQCPHRTKQKSSLKTHMAVKHS   78 (79)
Q Consensus        55 ~c~~c~~~f~~~~~l~~h~~~h~~   78 (79)
                      .|-++|+.|..   |.+|.++|.|
T Consensus        78 icLEDGkkfKS---LKRHL~t~~g   98 (148)
T COG4957          78 ICLEDGKKFKS---LKRHLTTHYG   98 (148)
T ss_pred             EEeccCcchHH---HHHHHhcccC
Confidence            35555655543   5667666654


No 84 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=80.13  E-value=2.2  Score=15.08  Aligned_cols=19  Identities=26%  Similarity=0.744  Sum_probs=10.6

Q ss_pred             cCCCCCCcccCcchHHHHHH
Q psy12012         55 QCPQCPHRTKQKSSLKTHMA   74 (79)
Q Consensus        55 ~c~~c~~~f~~~~~l~~h~~   74 (79)
                      .|++|...+ ....+..|..
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            477777666 3344455543


No 85 
>KOG4167|consensus
Probab=79.85  E-value=0.97  Score=29.17  Aligned_cols=26  Identities=23%  Similarity=0.445  Sum_probs=22.6

Q ss_pred             CccccchhhhhhcchhhHHhHhhhhh
Q psy12012         23 GLFVCDVCDRRYKYKSGLYQHKKYEC   48 (79)
Q Consensus        23 ~~~~c~~c~~~~~~~~~l~~h~~~~~   48 (79)
                      ..|.|.+|++.|..-..+..||+.|.
T Consensus       791 giFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  791 GIFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             ceeehHHHHHHHHHHhhhhHHHHHHH
Confidence            45899999999998888999998875


No 86 
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=79.83  E-value=0.51  Score=19.99  Aligned_cols=30  Identities=23%  Similarity=0.537  Sum_probs=18.0

Q ss_pred             cccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCcc
Q psy12012         25 FVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRT   63 (79)
Q Consensus        25 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f   63 (79)
                      +.|+.|+..+..+....       + + ...|+.|+..+
T Consensus         3 ~~CP~CG~~iev~~~~~-------G-e-iV~Cp~CGael   32 (54)
T TIGR01206         3 FECPDCGAEIELENPEL-------G-E-LVICDECGAEL   32 (54)
T ss_pred             cCCCCCCCEEecCCCcc-------C-C-EEeCCCCCCEE
Confidence            57888887665543221       3 2 45788887543


No 87 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=79.78  E-value=1  Score=16.90  Aligned_cols=10  Identities=50%  Similarity=1.374  Sum_probs=6.3

Q ss_pred             CccCCCCCCc
Q psy12012         53 RYQCPQCPHR   62 (79)
Q Consensus        53 ~~~c~~c~~~   62 (79)
                      +..|+.||..
T Consensus        17 ~irC~~CG~R   26 (32)
T PF03604_consen   17 PIRCPECGHR   26 (32)
T ss_dssp             TSSBSSSS-S
T ss_pred             cEECCcCCCe
Confidence            5677878754


No 88 
>PF12907 zf-met2:  Zinc-binding
Probab=78.09  E-value=1.4  Score=17.51  Aligned_cols=25  Identities=16%  Similarity=0.541  Sum_probs=17.0

Q ss_pred             cccchhhhhhcch---hhHHhHhhhhhc
Q psy12012         25 FVCDVCDRRYKYK---SGLYQHKKYECG   49 (79)
Q Consensus        25 ~~c~~c~~~~~~~---~~l~~h~~~~~~   49 (79)
                      +.|.+|...|...   ..|..|....+.
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~enKHp   29 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAENKHP   29 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHccCC
Confidence            4688888666554   458888776444


No 89 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=77.47  E-value=1.7  Score=18.78  Aligned_cols=32  Identities=25%  Similarity=0.721  Sum_probs=17.7

Q ss_pred             ccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCC
Q psy12012         24 LFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPH   61 (79)
Q Consensus        24 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   61 (79)
                      .|.|+.||......-.--   + . . ..+|.|+.||.
T Consensus        25 ~F~CPnCG~~~I~RC~~C---R-k-~-~~~Y~CP~CGF   56 (59)
T PRK14890         25 KFLCPNCGEVIIYRCEKC---R-K-Q-SNPYTCPKCGF   56 (59)
T ss_pred             EeeCCCCCCeeEeechhH---H-h-c-CCceECCCCCC
Confidence            478888886522221111   1 1 1 35799998873


No 90 
>PHA00626 hypothetical protein
Probab=77.10  E-value=1.3  Score=18.90  Aligned_cols=16  Identities=19%  Similarity=0.538  Sum_probs=12.5

Q ss_pred             CCccCCCCCCcccCcc
Q psy12012         52 PRYQCPQCPHRTKQKS   67 (79)
Q Consensus        52 ~~~~c~~c~~~f~~~~   67 (79)
                      ..|.|+.|+..|+..+
T Consensus        22 nrYkCkdCGY~ft~~~   37 (59)
T PHA00626         22 DDYVCCDCGYNDSKDA   37 (59)
T ss_pred             cceEcCCCCCeechhh
Confidence            4799999998887643


No 91 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=76.05  E-value=1.4  Score=15.43  Aligned_cols=8  Identities=38%  Similarity=1.402  Sum_probs=4.6

Q ss_pred             CccCCCCC
Q psy12012         53 RYQCPQCP   60 (79)
Q Consensus        53 ~~~c~~c~   60 (79)
                      +|.|+.||
T Consensus        16 ~f~CPnCG   23 (24)
T PF07754_consen   16 PFPCPNCG   23 (24)
T ss_pred             eEeCCCCC
Confidence            45566655


No 92 
>KOG4167|consensus
Probab=75.83  E-value=0.37  Score=30.88  Aligned_cols=24  Identities=21%  Similarity=0.407  Sum_probs=21.6

Q ss_pred             CccCCCCCCcccCcchHHHHHHhh
Q psy12012         53 RYQCPQCPHRTKQKSSLKTHMAVK   76 (79)
Q Consensus        53 ~~~c~~c~~~f~~~~~l~~h~~~h   76 (79)
                      -|-|.+|++.|-...++..||++|
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~H  815 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTH  815 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHH
Confidence            488999999999998999999887


No 93 
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=74.59  E-value=1.1  Score=18.67  Aligned_cols=13  Identities=23%  Similarity=0.761  Sum_probs=9.1

Q ss_pred             cccchhhhhhcch
Q psy12012         25 FVCDVCDRRYKYK   37 (79)
Q Consensus        25 ~~c~~c~~~~~~~   37 (79)
                      |.|..|+..+...
T Consensus         2 y~C~~CgyiYd~~   14 (50)
T cd00730           2 YECRICGYIYDPA   14 (50)
T ss_pred             cCCCCCCeEECCC
Confidence            6788888766543


No 94 
>KOG3408|consensus
Probab=74.32  E-value=1.4  Score=21.95  Aligned_cols=24  Identities=25%  Similarity=0.540  Sum_probs=19.9

Q ss_pred             CCccCCCCCCcccCcchHHHHHHh
Q psy12012         52 PRYQCPQCPHRTKQKSSLKTHMAV   75 (79)
Q Consensus        52 ~~~~c~~c~~~f~~~~~l~~h~~~   75 (79)
                      -.|.|-.|.+.|.....|..|.++
T Consensus        56 GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   56 GQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             ceeehhhhhhhhcchHHHHHHHhc
Confidence            358889999999999999988664


No 95 
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=73.23  E-value=2.2  Score=16.35  Aligned_cols=31  Identities=26%  Similarity=0.601  Sum_probs=14.7

Q ss_pred             cchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCccc
Q psy12012         27 CDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRTK   64 (79)
Q Consensus        27 c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~   64 (79)
                      |..|.+.+..+.+    .+.|   -.+..|..||..+.
T Consensus         2 C~~C~~Ey~~p~~----RR~~---~~~isC~~CGPr~~   32 (35)
T PF07503_consen    2 CDDCLKEYFDPSN----RRFH---YQFISCTNCGPRYS   32 (35)
T ss_dssp             -HHHHHHHCSTTS----TTTT----TT--BTTCC-SCC
T ss_pred             CHHHHHHHcCCCC----Cccc---CcCccCCCCCCCEE
Confidence            5666666554432    2222   24577888887654


No 96 
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=72.48  E-value=1.2  Score=20.01  Aligned_cols=14  Identities=14%  Similarity=0.448  Sum_probs=6.3

Q ss_pred             ccccc--hhhhhhcch
Q psy12012         24 LFVCD--VCDRRYKYK   37 (79)
Q Consensus        24 ~~~c~--~c~~~~~~~   37 (79)
                      .+.|.  .||..|...
T Consensus        27 Y~qC~N~eCg~tF~t~   42 (72)
T PRK09678         27 YHQCQNVNCSATFITY   42 (72)
T ss_pred             eeecCCCCCCCEEEEE
Confidence            34444  455444443


No 97 
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=71.39  E-value=2.5  Score=17.34  Aligned_cols=37  Identities=24%  Similarity=0.559  Sum_probs=15.9

Q ss_pred             cccchhhhhhcchhhHHhH-----hhhhhcCCCCccCCCCCCc
Q psy12012         25 FVCDVCDRRYKYKSGLYQH-----KKYECGKEPRYQCPQCPHR   62 (79)
Q Consensus        25 ~~c~~c~~~~~~~~~l~~h-----~~~~~~~~~~~~c~~c~~~   62 (79)
                      |.|..|+..+.....-...     ...... ..-+.|+.|+..
T Consensus         2 y~C~~CgyvYd~~~Gd~~~~i~pGt~F~~L-p~~w~CP~C~a~   43 (47)
T PF00301_consen    2 YQCPVCGYVYDPEKGDPENGIPPGTPFEDL-PDDWVCPVCGAP   43 (47)
T ss_dssp             EEETTTSBEEETTTBBGGGTB-TT--GGGS--TT-B-TTTSSB
T ss_pred             cCCCCCCEEEcCCcCCcccCcCCCCCHHHC-CCCCcCcCCCCc
Confidence            5677787655544321111     111111 234788888743


No 98 
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=70.23  E-value=1.4  Score=22.20  Aligned_cols=15  Identities=20%  Similarity=0.696  Sum_probs=11.7

Q ss_pred             Cccccchhhhhhcch
Q psy12012         23 GLFVCDVCDRRYKYK   37 (79)
Q Consensus        23 ~~~~c~~c~~~~~~~   37 (79)
                      ..+.|..||..|...
T Consensus        69 ~~~~C~~CG~~~~~~   83 (135)
T PRK03824         69 AVLKCRNCGNEWSLK   83 (135)
T ss_pred             eEEECCCCCCEEecc
Confidence            458899999877664


No 99 
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=67.85  E-value=1.9  Score=20.81  Aligned_cols=14  Identities=14%  Similarity=0.456  Sum_probs=8.8

Q ss_pred             Cccccchhhhhhcc
Q psy12012         23 GLFVCDVCDRRYKY   36 (79)
Q Consensus        23 ~~~~c~~c~~~~~~   36 (79)
                      ||-.|..||.....
T Consensus         1 ~p~~CpYCg~~~~l   14 (102)
T PF11672_consen    1 KPIICPYCGGPAEL   14 (102)
T ss_pred             CCcccCCCCCeeEE
Confidence            45678888765443


No 100
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=67.60  E-value=4.3  Score=15.93  Aligned_cols=11  Identities=27%  Similarity=0.594  Sum_probs=4.5

Q ss_pred             ccCCCCCCccc
Q psy12012         54 YQCPQCPHRTK   64 (79)
Q Consensus        54 ~~c~~c~~~f~   64 (79)
                      ..|..|+..+.
T Consensus        17 a~C~~C~~~~~   27 (45)
T PF02892_consen   17 AKCKYCGKVIK   27 (45)
T ss_dssp             EEETTTTEE--
T ss_pred             EEeCCCCeEEe
Confidence            44555554433


No 101
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=67.07  E-value=3.4  Score=16.12  Aligned_cols=13  Identities=15%  Similarity=0.521  Sum_probs=9.9

Q ss_pred             CccCCCCCCcccC
Q psy12012         53 RYQCPQCPHRTKQ   65 (79)
Q Consensus        53 ~~~c~~c~~~f~~   65 (79)
                      |+.|..|+..|-.
T Consensus        12 ~f~C~~C~~~FC~   24 (39)
T smart00154       12 GFKCRHCGNLFCG   24 (39)
T ss_pred             CeECCccCCcccc
Confidence            7888888877754


No 102
>KOG1146|consensus
Probab=66.99  E-value=4.7  Score=28.06  Aligned_cols=55  Identities=18%  Similarity=0.372  Sum_probs=40.3

Q ss_pred             CCccccchhhhhhcchhhHHhHhhhhhcC----------------CCCccCCCCCCcccCcchHHHHHHhhc
Q psy12012         22 AGLFVCDVCDRRYKYKSGLYQHKKYECGK----------------EPRYQCPQCPHRTKQKSSLKTHMAVKH   77 (79)
Q Consensus        22 ~~~~~c~~c~~~~~~~~~l~~h~~~~~~~----------------~~~~~c~~c~~~f~~~~~l~~h~~~h~   77 (79)
                      ..+|.|..|...|.....|..|++.-...                ...+ |..|...|.....|+.|+++-+
T Consensus      1282 ~~~~~~~~~~~~~~~~~~l~~~~~k~~~~~~~~~~~~~~~l~~~d~~~~-c~~c~~~~~~~~alqihm~~~~ 1352 (1406)
T KOG1146|consen 1282 THRYLCRQCKMAFDGEAPLTAHQRKFCFAGRGSGGSMPPPLRVPDCTYH-CLACEVLLSGREALQIHMRSSA 1352 (1406)
T ss_pred             chhHHHHHHHhhhcchhHHHHHHHHHHhccCccccCCCCcccCcccccc-chHHHhhcchhHHHHHHHHHhh
Confidence            34678888888888888888887532110                2235 8889889999999999988654


No 103
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=66.34  E-value=1.8  Score=18.14  Aligned_cols=40  Identities=25%  Similarity=0.504  Sum_probs=20.8

Q ss_pred             ccccch-hhhhhcchhhHHhHhhhhhcCCCCccCCC----CCCccc
Q psy12012         24 LFVCDV-CDRRYKYKSGLYQHKKYECGKEPRYQCPQ----CPHRTK   64 (79)
Q Consensus        24 ~~~c~~-c~~~~~~~~~l~~h~~~~~~~~~~~~c~~----c~~~f~   64 (79)
                      +..|+. |+..-.....|..|...... ..+..|+.    |...+.
T Consensus         9 ~v~C~~~cc~~~i~r~~l~~H~~~~C~-~~~v~C~~~~~GC~~~~~   53 (60)
T PF02176_consen    9 PVPCPNGCCNEMIPRKELDDHLENECP-KRPVPCPYSPYGCKERVP   53 (60)
T ss_dssp             EEE-TT--S-BEEECCCHHHHHHTTST-TSEEE-SS----S--EEE
T ss_pred             EeeCCCCCcccceeHHHHHHHHHccCC-CCcEECCCCCCCCCCccc
Confidence            445665 33333345568888886555 56677887    765544


No 104
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=65.89  E-value=9.8  Score=22.75  Aligned_cols=47  Identities=19%  Similarity=0.316  Sum_probs=31.5

Q ss_pred             ccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCC----CcccCcchHHHHHH
Q psy12012         26 VCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCP----HRTKQKSSLKTHMA   74 (79)
Q Consensus        26 ~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~----~~f~~~~~l~~h~~   74 (79)
                      .|..|..-|-....|..|++..+  ++-+.|...+    ..|.....|..|.+
T Consensus       222 ~C~FC~~~FYdDDEL~~HcR~~H--E~ChICD~v~p~~~QYFK~Y~~Le~HF~  272 (493)
T COG5236         222 LCIFCKIYFYDDDELRRHCRLRH--EACHICDMVGPIRYQYFKSYEDLEAHFR  272 (493)
T ss_pred             hhhhccceecChHHHHHHHHhhh--hhhhhhhccCccchhhhhCHHHHHHHhh
Confidence            69999999999999999999643  3334443332    23566666666644


No 105
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=65.83  E-value=1.2  Score=21.01  Aligned_cols=31  Identities=16%  Similarity=0.629  Sum_probs=18.6

Q ss_pred             CccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCccc
Q psy12012         23 GLFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRTK   64 (79)
Q Consensus        23 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~   64 (79)
                      ..|.|+.|++.-     +.   +...|   .+.|..|++.|.
T Consensus        35 a~y~CpfCgk~~-----vk---R~a~G---IW~C~~C~~~~A   65 (90)
T PTZ00255         35 AKYFCPFCGKHA-----VK---RQAVG---IWRCKGCKKTVA   65 (90)
T ss_pred             CCccCCCCCCCc-----ee---eeeeE---EEEcCCCCCEEe
Confidence            467888887532     22   11223   578888887664


No 106
>KOG1842|consensus
Probab=64.40  E-value=3.5  Score=25.21  Aligned_cols=23  Identities=26%  Similarity=0.417  Sum_probs=14.1

Q ss_pred             ccccchhhhhhcchhhHHhHhhh
Q psy12012         24 LFVCDVCDRRYKYKSGLYQHKKY   46 (79)
Q Consensus        24 ~~~c~~c~~~~~~~~~l~~h~~~   46 (79)
                      -+.|+.|...|..-..|..|...
T Consensus        15 gflCPiC~~dl~~~~~L~~H~d~   37 (505)
T KOG1842|consen   15 GFLCPICLLDLPNLSALNDHLDV   37 (505)
T ss_pred             cccCchHhhhhhhHHHHHHHHhh
Confidence            45666666666666666666554


No 107
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=64.27  E-value=2.1  Score=17.91  Aligned_cols=26  Identities=12%  Similarity=0.506  Sum_probs=15.2

Q ss_pred             CCccccchhhhhhcchhhHHhHhhhh
Q psy12012         22 AGLFVCDVCDRRYKYKSGLYQHKKYE   47 (79)
Q Consensus        22 ~~~~~c~~c~~~~~~~~~l~~h~~~~   47 (79)
                      ...|.|+.|...|=..-++-.|...|
T Consensus        19 ~~~y~C~~C~~~FC~dCD~fiHE~LH   44 (51)
T PF07975_consen   19 SSRYRCPKCKNHFCIDCDVFIHETLH   44 (51)
T ss_dssp             -EEE--TTTT--B-HHHHHTTTTTS-
T ss_pred             CCeEECCCCCCccccCcChhhhcccc
Confidence            45799999999999888888775543


No 108
>KOG2482|consensus
Probab=63.88  E-value=4.6  Score=23.95  Aligned_cols=22  Identities=36%  Similarity=0.708  Sum_probs=20.2

Q ss_pred             CccCCCCCCcccCcchHHHHHH
Q psy12012         53 RYQCPQCPHRTKQKSSLKTHMA   74 (79)
Q Consensus        53 ~~~c~~c~~~f~~~~~l~~h~~   74 (79)
                      .+.|-.|.+.|..+..|..|||
T Consensus       195 r~~CLyCekifrdkntLkeHMr  216 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMR  216 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHH
Confidence            4789999999999999999987


No 109
>KOG2785|consensus
Probab=63.73  E-value=8.9  Score=23.03  Aligned_cols=51  Identities=22%  Similarity=0.326  Sum_probs=37.0

Q ss_pred             ccccchhhhhhcchhhHHhHhhhhhcC----------------------CCCccCCCCC---CcccCcchHHHHHH
Q psy12012         24 LFVCDVCDRRYKYKSGLYQHKKYECGK----------------------EPRYQCPQCP---HRTKQKSSLKTHMA   74 (79)
Q Consensus        24 ~~~c~~c~~~~~~~~~l~~h~~~~~~~----------------------~~~~~c~~c~---~~f~~~~~l~~h~~   74 (79)
                      |-.|-.|++.+..-..-..||-.++|-                      ..-+.|-.|.   +.|......+.||.
T Consensus       166 Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~  241 (390)
T KOG2785|consen  166 PTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMR  241 (390)
T ss_pred             CcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHh
Confidence            556888988888777777888776542                      1235666676   78888888888876


No 110
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=61.70  E-value=10  Score=14.90  Aligned_cols=23  Identities=22%  Similarity=0.356  Sum_probs=11.0

Q ss_pred             ccCCCCCCcccC--cchHHHHHHhh
Q psy12012         54 YQCPQCPHRTKQ--KSSLKTHMAVK   76 (79)
Q Consensus        54 ~~c~~c~~~f~~--~~~l~~h~~~h   76 (79)
                      ..|+.|+..+..  ..+-..|.+-|
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~~yH   38 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHKKYH   38 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHHHHH
Confidence            456666654433  33344454433


No 111
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=60.09  E-value=7.4  Score=23.69  Aligned_cols=29  Identities=31%  Similarity=0.834  Sum_probs=17.8

Q ss_pred             ccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCcccCc
Q psy12012         26 VCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRTKQK   66 (79)
Q Consensus        26 ~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~   66 (79)
                      .|+.||.+..+           .| ..-|.|+.|+..+...
T Consensus       352 ~Cp~Cg~~m~S-----------~G-~~g~rC~kCg~~~~~~  380 (421)
T COG1571         352 VCPRCGGRMKS-----------AG-RNGFRCKKCGTRARET  380 (421)
T ss_pred             CCCccCCchhh-----------cC-CCCcccccccccCCcc
Confidence            78888765332           13 2267888888766543


No 112
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=59.63  E-value=2.1  Score=20.23  Aligned_cols=31  Identities=19%  Similarity=0.652  Sum_probs=18.5

Q ss_pred             CccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCccc
Q psy12012         23 GLFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRTK   64 (79)
Q Consensus        23 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~   64 (79)
                      ..|.|+.|++.-     +.   +...|   .+.|..|++.|.
T Consensus        34 a~y~CpfCgk~~-----vk---R~a~G---IW~C~~C~~~~A   64 (91)
T TIGR00280        34 AKYVCPFCGKKT-----VK---RGSTG---IWTCRKCGAKFA   64 (91)
T ss_pred             cCccCCCCCCCc-----eE---EEeeE---EEEcCCCCCEEe
Confidence            457888887542     21   22223   577888887664


No 113
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=58.95  E-value=3.5  Score=17.13  Aligned_cols=11  Identities=27%  Similarity=0.776  Sum_probs=5.7

Q ss_pred             cCCCCCCcccC
Q psy12012         55 QCPQCPHRTKQ   65 (79)
Q Consensus        55 ~c~~c~~~f~~   65 (79)
                      .|+.|++.|..
T Consensus        22 ~CPlC~r~l~~   32 (54)
T PF04423_consen   22 CCPLCGRPLDE   32 (54)
T ss_dssp             E-TTT--EE-H
T ss_pred             cCCCCCCCCCH
Confidence            79999988765


No 114
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=58.86  E-value=3.1  Score=17.81  Aligned_cols=8  Identities=38%  Similarity=1.319  Sum_probs=3.6

Q ss_pred             ccccchhh
Q psy12012         24 LFVCDVCD   31 (79)
Q Consensus        24 ~~~c~~c~   31 (79)
                      .|.|..|.
T Consensus        31 tYmC~eC~   38 (56)
T PF09963_consen   31 TYMCDECK   38 (56)
T ss_pred             ceeChhHH
Confidence            34444443


No 115
>KOG2071|consensus
Probab=58.77  E-value=7.6  Score=24.62  Aligned_cols=27  Identities=22%  Similarity=0.484  Sum_probs=20.4

Q ss_pred             CCCccCCCCCCcccCcchHHHHHHhhc
Q psy12012         51 EPRYQCPQCPHRTKQKSSLKTHMAVKH   77 (79)
Q Consensus        51 ~~~~~c~~c~~~f~~~~~l~~h~~~h~   77 (79)
                      ..|-.|..||..|........|+-.|.
T Consensus       416 ~~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  416 DSPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             CCcchhcccccccccchhhhhHhhhhh
Confidence            456778888888888877777776664


No 116
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=58.64  E-value=4.9  Score=15.44  Aligned_cols=11  Identities=18%  Similarity=0.425  Sum_probs=5.7

Q ss_pred             CccCCCCCCcc
Q psy12012         53 RYQCPQCPHRT   63 (79)
Q Consensus        53 ~~~c~~c~~~f   63 (79)
                      +-.|..|+..+
T Consensus        21 ~~~Cd~cg~~L   31 (36)
T PF05191_consen   21 EGVCDNCGGEL   31 (36)
T ss_dssp             TTBCTTTTEBE
T ss_pred             CCccCCCCCee
Confidence            34566665443


No 117
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=57.22  E-value=2.3  Score=21.92  Aligned_cols=12  Identities=25%  Similarity=0.672  Sum_probs=6.3

Q ss_pred             ccCCCCCCcccC
Q psy12012         54 YQCPQCPHRTKQ   65 (79)
Q Consensus        54 ~~c~~c~~~f~~   65 (79)
                      -+|..|++.|+.
T Consensus        29 ReC~~C~~RFTT   40 (147)
T TIGR00244        29 RECLECHERFTT   40 (147)
T ss_pred             ccCCccCCccce
Confidence            445555555543


No 118
>PLN02294 cytochrome c oxidase subunit Vb
Probab=56.96  E-value=6.2  Score=20.96  Aligned_cols=25  Identities=20%  Similarity=0.353  Sum_probs=16.7

Q ss_pred             HHhHhhhhhcCCCCccCCCCCCcccCc
Q psy12012         40 LYQHKKYECGKEPRYQCPQCPHRTKQK   66 (79)
Q Consensus        40 l~~h~~~~~~~~~~~~c~~c~~~f~~~   66 (79)
                      ...++..+.+  +|..|+.|+..|...
T Consensus       130 ~v~Wf~L~kG--kp~RCpeCG~~fkL~  154 (174)
T PLN02294        130 DVVWFWLEKG--KSFECPVCTQYFELE  154 (174)
T ss_pred             eeEEEEecCC--CceeCCCCCCEEEEE
Confidence            3344455444  688999999887653


No 119
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=56.78  E-value=3.2  Score=21.37  Aligned_cols=32  Identities=28%  Similarity=0.672  Sum_probs=19.6

Q ss_pred             CCCCccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCc
Q psy12012         20 NHAGLFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHR   62 (79)
Q Consensus        20 ~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~   62 (79)
                      .|.+.++|..||......         + . .....|+.|+..
T Consensus       108 ~g~G~l~C~~Cg~~~~~~---------~-~-~~l~~Cp~C~~~  139 (146)
T PF07295_consen  108 VGPGTLVCENCGHEVELT---------H-P-ERLPPCPKCGHT  139 (146)
T ss_pred             ecCceEecccCCCEEEec---------C-C-CcCCCCCCCCCC
Confidence            345679999998654321         1 1 234469999754


No 120
>KOG2636|consensus
Probab=56.25  E-value=9.6  Score=23.48  Aligned_cols=27  Identities=22%  Similarity=0.415  Sum_probs=18.8

Q ss_pred             hhhhcCCCCccCCCCC-CcccCcchHHHH
Q psy12012         45 KYECGKEPRYQCPQCP-HRTKQKSSLKTH   72 (79)
Q Consensus        45 ~~~~~~~~~~~c~~c~-~~f~~~~~l~~h   72 (79)
                      +.|.. ...|.|.+|| +++.-+..+.+|
T Consensus       394 KLHGL-~~ey~CEICGNy~Y~GrkaF~RH  421 (497)
T KOG2636|consen  394 KLHGL-DIEYNCEICGNYVYKGRKAFDRH  421 (497)
T ss_pred             hhcCC-CcccceeeccCccccCcHHHHHH
Confidence            44544 6678999998 566666667776


No 121
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=55.98  E-value=3.4  Score=20.79  Aligned_cols=16  Identities=31%  Similarity=0.540  Sum_probs=11.2

Q ss_pred             CCCccCCCCCCcccCc
Q psy12012         51 EPRYQCPQCPHRTKQK   66 (79)
Q Consensus        51 ~~~~~c~~c~~~f~~~   66 (79)
                      +.|.-|..||..|+..
T Consensus        66 e~psfchncgs~fpwt   81 (160)
T COG4306          66 EPPSFCHNCGSRFPWT   81 (160)
T ss_pred             CCcchhhcCCCCCCcH
Confidence            4566678888887653


No 122
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=55.64  E-value=1.1  Score=21.57  Aligned_cols=38  Identities=13%  Similarity=0.228  Sum_probs=21.0

Q ss_pred             CCCccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCcc
Q psy12012         21 HAGLFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRT   63 (79)
Q Consensus        21 ~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f   63 (79)
                      -++.|.|+.|+..-.....+..-..     .-...|..||.+|
T Consensus        19 L~k~FtCp~Cghe~vs~ctvkk~~~-----~g~~~Cg~CGls~   56 (104)
T COG4888          19 LPKTFTCPRCGHEKVSSCTVKKTVN-----IGTAVCGNCGLSF   56 (104)
T ss_pred             CCceEecCccCCeeeeEEEEEecCc-----eeEEEcccCcceE
Confidence            4567899999865443322221111     1235688887665


No 123
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=55.26  E-value=4.9  Score=16.70  Aligned_cols=15  Identities=13%  Similarity=0.315  Sum_probs=9.3

Q ss_pred             CCccCCCCCCcccCc
Q psy12012         52 PRYQCPQCPHRTKQK   66 (79)
Q Consensus        52 ~~~~c~~c~~~f~~~   66 (79)
                      +.+.|..||..|...
T Consensus         3 k~l~C~dCg~~FvfT   17 (49)
T PF13451_consen    3 KTLTCKDCGAEFVFT   17 (49)
T ss_pred             eeEEcccCCCeEEEe
Confidence            456677777666544


No 124
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=54.95  E-value=6.2  Score=14.56  Aligned_cols=10  Identities=40%  Similarity=1.082  Sum_probs=5.8

Q ss_pred             CCccCCCCCC
Q psy12012         52 PRYQCPQCPH   61 (79)
Q Consensus        52 ~~~~c~~c~~   61 (79)
                      ..+.|+.|+.
T Consensus        18 ~~~vCp~C~~   27 (30)
T PF08274_consen   18 ELLVCPECGH   27 (30)
T ss_dssp             SSEEETTTTE
T ss_pred             CEEeCCcccc
Confidence            3466666653


No 125
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=54.50  E-value=11  Score=24.68  Aligned_cols=49  Identities=24%  Similarity=0.567  Sum_probs=27.8

Q ss_pred             cccccccccccccCCCCCCcc-ccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCc
Q psy12012          5 FRFSESFTSWEASEPNHAGLF-VCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHR   62 (79)
Q Consensus         5 f~~~~~~~~~~~~~~~~~~~~-~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~   62 (79)
                      |+...++...  +.+|.=..| .|+.|.+.+..+.+=    +.|   ..|..|+.||..
T Consensus       133 fTIi~alPYD--R~nTsM~~F~lC~~C~~EY~dP~nR----RfH---AQp~aCp~CGP~  182 (750)
T COG0068         133 FTIIEALPYD--RENTSMADFPLCPFCDKEYKDPLNR----RFH---AQPIACPKCGPH  182 (750)
T ss_pred             eeeeccCCCC--cccCccccCcCCHHHHHHhcCcccc----ccc---cccccCcccCCC
Confidence            4444444433  233333333 488888877665432    333   357889999864


No 126
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=54.41  E-value=9.6  Score=16.27  Aligned_cols=9  Identities=33%  Similarity=1.302  Sum_probs=4.9

Q ss_pred             CCccCCCCC
Q psy12012         52 PRYQCPQCP   60 (79)
Q Consensus        52 ~~~~c~~c~   60 (79)
                      ..|.|+.||
T Consensus        13 v~~~Cp~cG   21 (55)
T PF13824_consen   13 VNFECPDCG   21 (55)
T ss_pred             cCCcCCCCC
Confidence            445555555


No 127
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=54.32  E-value=2.8  Score=19.76  Aligned_cols=31  Identities=26%  Similarity=0.651  Sum_probs=17.7

Q ss_pred             CccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCccc
Q psy12012         23 GLFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRTK   64 (79)
Q Consensus        23 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~   64 (79)
                      ..|.|+.|++.-     +.   +...|   .+.|..|++.|.
T Consensus        35 a~y~CpfCgk~~-----vk---R~a~G---IW~C~~C~~~~A   65 (90)
T PRK03976         35 AKHVCPVCGRPK-----VK---RVGTG---IWECRKCGAKFA   65 (90)
T ss_pred             cCccCCCCCCCc-----eE---EEEEE---EEEcCCCCCEEe
Confidence            457888886432     11   22223   577888877654


No 128
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=54.24  E-value=4.6  Score=21.00  Aligned_cols=34  Identities=26%  Similarity=0.727  Sum_probs=21.5

Q ss_pred             CccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCc
Q psy12012         23 GLFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHR   62 (79)
Q Consensus        23 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~   62 (79)
                      -+|.|. |+.-+..   ...|...-.| + .|.|..|+..
T Consensus       116 ~~Y~C~-C~q~~l~---~RRhn~~~~g-~-~YrC~~C~gk  149 (156)
T COG3091         116 YPYRCQ-CQQHYLR---IRRHNTVRRG-E-VYRCGKCGGK  149 (156)
T ss_pred             eeEEee-cCCccch---hhhccccccc-c-eEEeccCCce
Confidence            468888 8877655   2344444444 4 6888888754


No 129
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=52.66  E-value=3.8  Score=16.23  Aligned_cols=13  Identities=15%  Similarity=0.534  Sum_probs=7.0

Q ss_pred             CCccCCCCCCccc
Q psy12012         52 PRYQCPQCPHRTK   64 (79)
Q Consensus        52 ~~~~c~~c~~~f~   64 (79)
                      .|+.|..|+..|-
T Consensus        12 ~~~~C~~C~~~FC   24 (43)
T PF01428_consen   12 LPFKCKHCGKSFC   24 (43)
T ss_dssp             SHEE-TTTS-EE-
T ss_pred             CCeECCCCCcccC
Confidence            3677887877664


No 130
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=51.15  E-value=3.5  Score=21.40  Aligned_cols=10  Identities=30%  Similarity=0.850  Sum_probs=4.8

Q ss_pred             cCCCCCCccc
Q psy12012         55 QCPQCPHRTK   64 (79)
Q Consensus        55 ~c~~c~~~f~   64 (79)
                      .|..|+..|+
T Consensus        30 eC~~C~~RFT   39 (156)
T COG1327          30 ECLECGERFT   39 (156)
T ss_pred             cccccccccc
Confidence            4555554443


No 131
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=50.96  E-value=9  Score=18.35  Aligned_cols=22  Identities=32%  Similarity=0.483  Sum_probs=14.9

Q ss_pred             hHhhhhhcCCCCccCCCCCCcccC
Q psy12012         42 QHKKYECGKEPRYQCPQCPHRTKQ   65 (79)
Q Consensus        42 ~h~~~~~~~~~~~~c~~c~~~f~~   65 (79)
                      .++..+.+  +|..|..|+.-|..
T Consensus        70 ~W~~l~~g--~~~rC~eCG~~fkL   91 (97)
T cd00924          70 IWMWLEKG--KPKRCPECGHVFKL   91 (97)
T ss_pred             EEEEEeCC--CceeCCCCCcEEEE
Confidence            33444444  68899999988764


No 132
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=50.10  E-value=9.3  Score=18.81  Aligned_cols=33  Identities=6%  Similarity=0.013  Sum_probs=21.9

Q ss_pred             CCCccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCcccCc
Q psy12012         21 HAGLFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRTKQK   66 (79)
Q Consensus        21 ~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~   66 (79)
                      |.|. .|+.|++.|--   |.         ..|..|+.||++|+.+
T Consensus         7 GtKr-idPetg~KFYD---LN---------rdPiVsPytG~s~P~s   39 (129)
T COG4530           7 GTKR-IDPETGKKFYD---LN---------RDPIVSPYTGKSYPRS   39 (129)
T ss_pred             cccc-cCccccchhhc---cC---------CCccccCcccccchHH
Confidence            3443 67777776532   21         5688999999998543


No 133
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=49.98  E-value=3.6  Score=14.98  Aligned_cols=9  Identities=22%  Similarity=0.863  Sum_probs=5.0

Q ss_pred             ccchhhhhh
Q psy12012         26 VCDVCDRRY   34 (79)
Q Consensus        26 ~c~~c~~~~   34 (79)
                      .|.-|++.|
T Consensus         2 sCiDC~~~F   10 (28)
T PF08790_consen    2 SCIDCSKDF   10 (28)
T ss_dssp             EETTTTEEE
T ss_pred             eeecCCCCc
Confidence            455565555


No 134
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=49.83  E-value=14  Score=22.89  Aligned_cols=22  Identities=27%  Similarity=0.690  Sum_probs=17.9

Q ss_pred             ccCCCCCCcccCcchHHHHHHh
Q psy12012         54 YQCPQCPHRTKQKSSLKTHMAV   75 (79)
Q Consensus        54 ~~c~~c~~~f~~~~~l~~h~~~   75 (79)
                      +.|+.|.+.|.....+..|+..
T Consensus        58 WiCp~CskkF~d~~~~~~H~~~   79 (466)
T PF04780_consen   58 WICPRCSKKFSDAESCLSHMEQ   79 (466)
T ss_pred             eeCCcccceeCCHHHHHHHHHH
Confidence            6688888889888888888763


No 135
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=49.52  E-value=8.6  Score=18.25  Aligned_cols=15  Identities=13%  Similarity=0.437  Sum_probs=12.1

Q ss_pred             CCCccCCCCCCcccC
Q psy12012         51 EPRYQCPQCPHRTKQ   65 (79)
Q Consensus        51 ~~~~~c~~c~~~f~~   65 (79)
                      ..|-.|..||..|..
T Consensus        56 v~Pa~CkkCGfef~~   70 (97)
T COG3357          56 VRPARCKKCGFEFRD   70 (97)
T ss_pred             ecChhhcccCccccc
Confidence            357889999988865


No 136
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=49.07  E-value=5.7  Score=21.80  Aligned_cols=25  Identities=12%  Similarity=0.285  Sum_probs=0.0

Q ss_pred             ccccchhhhhhcchhhHHhHhhhhhc
Q psy12012         24 LFVCDVCDRRYKYKSGLYQHKKYECG   49 (79)
Q Consensus        24 ~~~c~~c~~~~~~~~~l~~h~~~~~~   49 (79)
                      ...|+.||..+... .+..||++...
T Consensus       168 ~~~cPitGe~IP~~-e~~eHmRi~Ll  192 (229)
T PF12230_consen  168 MIICPITGEMIPAD-EMDEHMRIELL  192 (229)
T ss_dssp             --------------------------
T ss_pred             cccccccccccccc-ccccccccccc
Confidence            35677776655443 36677776554


No 137
>KOG0717|consensus
Probab=48.04  E-value=9.3  Score=23.68  Aligned_cols=22  Identities=27%  Similarity=0.674  Sum_probs=19.6

Q ss_pred             cccchhhhhhcchhhHHhHhhh
Q psy12012         25 FVCDVCDRRYKYKSGLYQHKKY   46 (79)
Q Consensus        25 ~~c~~c~~~~~~~~~l~~h~~~   46 (79)
                      +-|.+|.++|.....+..|...
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            6799999999999999888765


No 138
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=47.83  E-value=11  Score=15.14  Aligned_cols=12  Identities=25%  Similarity=0.645  Sum_probs=8.8

Q ss_pred             cCCCCCCcccCc
Q psy12012         55 QCPQCPHRTKQK   66 (79)
Q Consensus        55 ~c~~c~~~f~~~   66 (79)
                      .|..|++.|.-.
T Consensus        10 ~C~~C~rpf~WR   21 (42)
T PF10013_consen   10 ICPVCGRPFTWR   21 (42)
T ss_pred             cCcccCCcchHH
Confidence            588888887654


No 139
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=47.53  E-value=14  Score=15.18  Aligned_cols=23  Identities=26%  Similarity=0.795  Sum_probs=9.3

Q ss_pred             hcchhhHHhHhhhhhcCCCCccCCCCCC
Q psy12012         34 YKYKSGLYQHKKYECGKEPRYQCPQCPH   61 (79)
Q Consensus        34 ~~~~~~l~~h~~~~~~~~~~~~c~~c~~   61 (79)
                      |....-|....+     ...+.|++|++
T Consensus        27 FDl~~fl~~~~~-----~~~W~CPiC~~   49 (50)
T PF02891_consen   27 FDLESFLESNQR-----TPKWKCPICNK   49 (50)
T ss_dssp             EEHHHHHHHHHH-----S---B-TTT--
T ss_pred             ECHHHHHHHhhc-----cCCeECcCCcC
Confidence            555444443333     23488999864


No 140
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=47.53  E-value=8.2  Score=18.87  Aligned_cols=25  Identities=24%  Similarity=0.494  Sum_probs=15.0

Q ss_pred             ccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCC
Q psy12012         24 LFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPH   61 (79)
Q Consensus        24 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   61 (79)
                      ...|..|+..|....             ..+.|+.|+.
T Consensus        70 ~~~C~~Cg~~~~~~~-------------~~~~CP~Cgs   94 (113)
T PRK12380         70 QAWCWDCSQVVEIHQ-------------HDAQCPHCHG   94 (113)
T ss_pred             EEEcccCCCEEecCC-------------cCccCcCCCC
Confidence            357888876554421             2345888874


No 141
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=47.37  E-value=4.9  Score=26.17  Aligned_cols=12  Identities=25%  Similarity=0.706  Sum_probs=8.7

Q ss_pred             CCCccCCCCCCc
Q psy12012         51 EPRYQCPQCPHR   62 (79)
Q Consensus        51 ~~~~~c~~c~~~   62 (79)
                      ..|..|+.|+..
T Consensus       473 ~~p~~Cp~Cgs~  484 (730)
T COG1198         473 PIPQSCPECGSE  484 (730)
T ss_pred             CCCCCCCCCCCC
Confidence            467788888754


No 142
>KOG0978|consensus
Probab=47.32  E-value=9.6  Score=24.82  Aligned_cols=19  Identities=16%  Similarity=0.487  Sum_probs=14.4

Q ss_pred             CCccCCCCCCcccCcchHH
Q psy12012         52 PRYQCPQCPHRTKQKSSLK   70 (79)
Q Consensus        52 ~~~~c~~c~~~f~~~~~l~   70 (79)
                      +.-+||.|+..|.....+.
T Consensus       677 RqRKCP~Cn~aFganDv~~  695 (698)
T KOG0978|consen  677 RQRKCPKCNAAFGANDVHR  695 (698)
T ss_pred             hcCCCCCCCCCCCcccccc
Confidence            4467999999998766543


No 143
>KOG2231|consensus
Probab=46.67  E-value=27  Score=22.85  Aligned_cols=46  Identities=22%  Similarity=0.575  Sum_probs=25.2

Q ss_pred             ccchhhhhhcchhhHHhHhhhhhcCCCCccCCCC------CCcccCcchHHHHHHhh
Q psy12012         26 VCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQC------PHRTKQKSSLKTHMAVK   76 (79)
Q Consensus        26 ~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c------~~~f~~~~~l~~h~~~h   76 (79)
                      .|..|...|.....|..|++.++-     .|..|      ...|.....|..|-+-.
T Consensus       184 ~C~~C~~~fld~~el~rH~~~~h~-----~chfC~~~~~~neyy~~~~dLe~HfR~~  235 (669)
T KOG2231|consen  184 LCKFCHERFLDDDELYRHLRFDHE-----FCHFCDYKTGQNEYYNDYDDLEEHFRKG  235 (669)
T ss_pred             cchhhhhhhccHHHHHHhhcccee-----heeecCcccccchhcccchHHHHHhhhc
Confidence            466666666666666666664322     23333      23455556666665543


No 144
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=46.66  E-value=7.4  Score=23.96  Aligned_cols=41  Identities=22%  Similarity=0.488  Sum_probs=22.8

Q ss_pred             CCCccccchhhhhhcchhhHHhHhhhhhcC-----CCCccCCCCCCc
Q psy12012         21 HAGLFVCDVCDRRYKYKSGLYQHKKYECGK-----EPRYQCPQCPHR   62 (79)
Q Consensus        21 ~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~-----~~~~~c~~c~~~   62 (79)
                      ..+.|.|..|+..+.....-... .+..|.     ...+.|+.|+..
T Consensus       422 ~~~~~~c~~c~~~yd~~~g~~~~-~~~~gt~~~~lp~~~~cp~c~~~  467 (479)
T PRK05452        422 LGPRMQCSVCQWIYDPAKGEPMQ-DVAPGTPWSEVPDNFLCPECSLG  467 (479)
T ss_pred             CCCeEEECCCCeEECCCCCCccc-CCCCCCChhhCCCCCcCcCCCCc
Confidence            34579999999777654221111 111110     124799999854


No 145
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=45.51  E-value=8.1  Score=18.94  Aligned_cols=25  Identities=24%  Similarity=0.665  Sum_probs=15.2

Q ss_pred             ccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCC
Q psy12012         24 LFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPH   61 (79)
Q Consensus        24 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   61 (79)
                      ...|..|+..|....             .-+.|+.|+.
T Consensus        70 ~~~C~~Cg~~~~~~~-------------~~~~CP~Cgs   94 (115)
T TIGR00100        70 ECECEDCSEEVSPEI-------------DLYRCPKCHG   94 (115)
T ss_pred             EEEcccCCCEEecCC-------------cCccCcCCcC
Confidence            357888876665431             1355888874


No 146
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=45.38  E-value=19  Score=15.01  Aligned_cols=31  Identities=19%  Similarity=0.446  Sum_probs=16.6

Q ss_pred             ccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCC
Q psy12012         26 VCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPH   61 (79)
Q Consensus        26 ~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   61 (79)
                      .|.-|.-..+.  ....-.  ..+ .....|+.|++
T Consensus        24 ~C~gC~~~l~~--~~~~~i--~~~-~~i~~Cp~CgR   54 (56)
T PF02591_consen   24 TCSGCHMELPP--QELNEI--RKG-DEIVFCPNCGR   54 (56)
T ss_pred             ccCCCCEEcCH--HHHHHH--HcC-CCeEECcCCCc
Confidence            67767544333  222222  223 45678999986


No 147
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=44.27  E-value=3.8  Score=21.37  Aligned_cols=16  Identities=19%  Similarity=0.314  Sum_probs=12.1

Q ss_pred             CCCccCCCCCCcccCc
Q psy12012         51 EPRYQCPQCPHRTKQK   66 (79)
Q Consensus        51 ~~~~~c~~c~~~f~~~   66 (79)
                      ..|.-|..||+.|+.-
T Consensus        66 ~~PsYC~~CGkpyPWt   81 (158)
T PF10083_consen   66 EAPSYCHNCGKPYPWT   81 (158)
T ss_pred             CCChhHHhCCCCCchH
Confidence            4677788898888764


No 148
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=43.96  E-value=7.7  Score=15.36  Aligned_cols=12  Identities=50%  Similarity=1.149  Sum_probs=7.1

Q ss_pred             Cccccchhhhhh
Q psy12012         23 GLFVCDVCDRRY   34 (79)
Q Consensus        23 ~~~~c~~c~~~~   34 (79)
                      ++-.|..|+..|
T Consensus        28 ~~~~CpYCg~~y   39 (40)
T PF10276_consen   28 GPVVCPYCGTRY   39 (40)
T ss_dssp             CEEEETTTTEEE
T ss_pred             CeEECCCCCCEE
Confidence            355677776554


No 149
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=43.48  E-value=12  Score=16.19  Aligned_cols=13  Identities=23%  Similarity=0.789  Sum_probs=9.3

Q ss_pred             CCCccCCCCCCcc
Q psy12012         51 EPRYQCPQCPHRT   63 (79)
Q Consensus        51 ~~~~~c~~c~~~f   63 (79)
                      ...+.|+.|+...
T Consensus        44 ~r~~~C~~Cg~~~   56 (69)
T PF07282_consen   44 GRVFTCPNCGFEM   56 (69)
T ss_pred             cceEEcCCCCCEE
Confidence            4568888888653


No 150
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=43.10  E-value=16  Score=18.42  Aligned_cols=16  Identities=25%  Similarity=0.675  Sum_probs=12.6

Q ss_pred             CCCccCCCCCCcccCc
Q psy12012         51 EPRYQCPQCPHRTKQK   66 (79)
Q Consensus        51 ~~~~~c~~c~~~f~~~   66 (79)
                      ...|.|+.|++.|...
T Consensus        51 ~qRyrC~~C~~tf~~~   66 (129)
T COG3677          51 HQRYKCKSCGSTFTVE   66 (129)
T ss_pred             ccccccCCcCcceeee
Confidence            4569999999988653


No 151
>PF14353 CpXC:  CpXC protein
Probab=43.09  E-value=12  Score=18.43  Aligned_cols=14  Identities=29%  Similarity=0.902  Sum_probs=10.8

Q ss_pred             CCccCCCCCCcccC
Q psy12012         52 PRYQCPQCPHRTKQ   65 (79)
Q Consensus        52 ~~~~c~~c~~~f~~   65 (79)
                      ..+.|+.||..|.-
T Consensus        37 ~~~~CP~Cg~~~~~   50 (128)
T PF14353_consen   37 FSFTCPSCGHKFRL   50 (128)
T ss_pred             CEEECCCCCCceec
Confidence            45889999987644


No 152
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=42.80  E-value=9.2  Score=18.66  Aligned_cols=12  Identities=17%  Similarity=0.551  Sum_probs=8.0

Q ss_pred             cccchhhhhhcc
Q psy12012         25 FVCDVCDRRYKY   36 (79)
Q Consensus        25 ~~c~~c~~~~~~   36 (79)
                      ..|..|+..|..
T Consensus        71 ~~C~~Cg~~~~~   82 (113)
T PF01155_consen   71 ARCRDCGHEFEP   82 (113)
T ss_dssp             EEETTTS-EEEC
T ss_pred             EECCCCCCEEec
Confidence            568888877755


No 153
>COG1773 Rubredoxin [Energy production and conversion]
Probab=42.76  E-value=10  Score=16.17  Aligned_cols=11  Identities=27%  Similarity=0.742  Sum_probs=6.0

Q ss_pred             CccCCCCCCcc
Q psy12012         53 RYQCPQCPHRT   63 (79)
Q Consensus        53 ~~~c~~c~~~f   63 (79)
                      .++|..|+..|
T Consensus         3 ~~~C~~CG~vY   13 (55)
T COG1773           3 RWRCSVCGYVY   13 (55)
T ss_pred             ceEecCCceEe
Confidence            35566665443


No 154
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=41.67  E-value=16  Score=18.58  Aligned_cols=12  Identities=25%  Similarity=0.611  Sum_probs=6.3

Q ss_pred             ccCCCCCCcccC
Q psy12012         54 YQCPQCPHRTKQ   65 (79)
Q Consensus        54 ~~c~~c~~~f~~   65 (79)
                      .+|..|++.|..
T Consensus         2 H~Ct~Cg~~f~d   13 (131)
T PF09845_consen    2 HQCTKCGRVFED   13 (131)
T ss_pred             cccCcCCCCcCC
Confidence            345555555544


No 155
>KOG4173|consensus
Probab=41.61  E-value=30  Score=19.22  Aligned_cols=50  Identities=26%  Similarity=0.410  Sum_probs=24.9

Q ss_pred             ccchhhhhhcchhhHHhHhhhhhcC---------CCCccCC--CCCCcccCcchHHHHHHh
Q psy12012         26 VCDVCDRRYKYKSGLYQHKKYECGK---------EPRYQCP--QCPHRTKQKSSLKTHMAV   75 (79)
Q Consensus        26 ~c~~c~~~~~~~~~l~~h~~~~~~~---------~~~~~c~--~c~~~f~~~~~l~~h~~~   75 (79)
                      .|.+|.+.|....-|..|+.-.+..         ..-|+|-  .|+-.|........|+..
T Consensus       108 sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KFkT~r~RkdH~I~  168 (253)
T KOG4173|consen  108 SCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKFKTSRDRKDHMIR  168 (253)
T ss_pred             hhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhhhhhhhhhhHHHH
Confidence            5666666666655555555422110         1224443  355566665555555543


No 156
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=39.85  E-value=9.6  Score=20.73  Aligned_cols=22  Identities=23%  Similarity=0.641  Sum_probs=0.0

Q ss_pred             CCCccCCCCCCc-ccCcchHHHH
Q psy12012         51 EPRYQCPQCPHR-TKQKSSLKTH   72 (79)
Q Consensus        51 ~~~~~c~~c~~~-f~~~~~l~~h   72 (79)
                      .+.|.|.+||.. +.-+..+..|
T Consensus        99 ~~ey~CEICGN~~Y~GrkaFekH  121 (196)
T PF11931_consen   99 GVEYKCEICGNQSYKGRKAFEKH  121 (196)
T ss_dssp             -----------------------
T ss_pred             CCeeeeEeCCCcceecHHHHHHh
Confidence            466888888853 3333344444


No 157
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=39.70  E-value=12  Score=14.43  Aligned_cols=10  Identities=30%  Similarity=0.899  Sum_probs=4.5

Q ss_pred             CccCCCCCCc
Q psy12012         53 RYQCPQCPHR   62 (79)
Q Consensus        53 ~~~c~~c~~~   62 (79)
                      -|+|..|+..
T Consensus         6 ~YkC~~CGni   15 (36)
T PF06397_consen    6 FYKCEHCGNI   15 (36)
T ss_dssp             EEE-TTT--E
T ss_pred             EEEccCCCCE
Confidence            4677777754


No 158
>PF05741 zf-nanos:  Nanos RNA binding domain;  InterPro: IPR024161 Nanos is a highly conserved RNA-binding protein in higher eukaryotes and functions as a key regulatory protein in translational control using a 3' untranslated region during the development and maintenance of germ cells. Nanos comprises a non-conserved amino-terminus and highly conserved carboxy- terminal regions. The C-terminal region has two conserved Cys-Cys-His-Cys (CCHC)-type zinc-finger motifs that are indispensable for nanos function [, , ]. The structure of the nanos-type zinc finger is composed of two independent zinc-finger (ZF) lobes, the N-terminal ZF1 and the C-terminal ZF2, which are connected by a linker helix []. These lobes create a large cleft. Zinc ions in ZF1 and ZF2 are bound to the CCHC motif by tetrahedral coordination.; PDB: 3ALR_B.
Probab=38.42  E-value=10  Score=16.18  Aligned_cols=8  Identities=50%  Similarity=1.356  Sum_probs=1.6

Q ss_pred             ccCCCCCC
Q psy12012         54 YQCPQCPH   61 (79)
Q Consensus        54 ~~c~~c~~   61 (79)
                      +.|++|+.
T Consensus        34 y~Cp~CgA   41 (55)
T PF05741_consen   34 YVCPICGA   41 (55)
T ss_dssp             ---TTT--
T ss_pred             CcCCCCcC
Confidence            44555543


No 159
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=38.34  E-value=23  Score=18.99  Aligned_cols=34  Identities=21%  Similarity=0.746  Sum_probs=20.1

Q ss_pred             CCCCccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCcc
Q psy12012         20 NHAGLFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRT   63 (79)
Q Consensus        20 ~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f   63 (79)
                      +...-|.|+.|...+....++.          ..|.|+.||...
T Consensus       109 ~~~~~y~C~~~~~r~sfdeA~~----------~~F~Cp~Cg~~L  142 (176)
T COG1675         109 TENNYYVCPNCHVKYSFDEAME----------LGFTCPKCGEDL  142 (176)
T ss_pred             ccCCceeCCCCCCcccHHHHHH----------hCCCCCCCCchh
Confidence            4445678877765554433221          238899998643


No 160
>PF14369 zf-RING_3:  zinc-finger
Probab=38.33  E-value=18  Score=13.69  Aligned_cols=10  Identities=30%  Similarity=0.816  Sum_probs=7.5

Q ss_pred             cCCCCCCccc
Q psy12012         55 QCPQCPHRTK   64 (79)
Q Consensus        55 ~c~~c~~~f~   64 (79)
                      .|+.|+..|.
T Consensus        23 ~CP~C~~gFv   32 (35)
T PF14369_consen   23 ACPRCHGGFV   32 (35)
T ss_pred             CCcCCCCcEe
Confidence            5888887774


No 161
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=38.30  E-value=8.3  Score=19.58  Aligned_cols=31  Identities=32%  Similarity=0.865  Sum_probs=17.7

Q ss_pred             ccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCcc
Q psy12012         24 LFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRT   63 (79)
Q Consensus        24 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f   63 (79)
                      .|.|..|+..+..      +.+.  . ...+.|..|+..+
T Consensus       123 ~~~C~~C~~~~~r------~~~~--~-~~~~~C~~C~~~l  153 (157)
T PF10263_consen  123 VYRCPSCGREYKR------HRRS--K-RKRYRCGRCGGPL  153 (157)
T ss_pred             EEEcCCCCCEeee------eccc--c-hhhEECCCCCCEE
Confidence            4678888766533      2222  1 2347788887544


No 162
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=38.13  E-value=5.1  Score=15.43  Aligned_cols=18  Identities=33%  Similarity=0.824  Sum_probs=8.3

Q ss_pred             HhHhhhhhcCCCCccCCCC
Q psy12012         41 YQHKKYECGKEPRYQCPQC   59 (79)
Q Consensus        41 ~~h~~~~~~~~~~~~c~~c   59 (79)
                      ..|-....| ...|.|..|
T Consensus        18 ~k~G~~~~G-~qryrC~~C   35 (36)
T PF03811_consen   18 KKNGKSPSG-HQRYRCKDC   35 (36)
T ss_pred             eeCCCCCCC-CEeEecCcC
Confidence            333333334 444666655


No 163
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=37.58  E-value=21  Score=15.15  Aligned_cols=32  Identities=13%  Similarity=0.249  Sum_probs=16.3

Q ss_pred             CCccccchhhhhhcchhhHHhHhhhhhcCCCCccCCC
Q psy12012         22 AGLFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQ   58 (79)
Q Consensus        22 ~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~   58 (79)
                      +.|.....|+..|.....+. ..+   . .....|+.
T Consensus        22 ~~PV~s~~C~H~fek~aI~~-~i~---~-~~~~~CPv   53 (57)
T PF11789_consen   22 EDPVKSKKCGHTFEKEAILQ-YIQ---R-NGSKRCPV   53 (57)
T ss_dssp             SSEEEESSS--EEEHHHHHH-HCT---T-TS-EE-SC
T ss_pred             hCCcCcCCCCCeecHHHHHH-HHH---h-cCCCCCCC
Confidence            45666677888887765443 321   1 34567776


No 164
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=36.97  E-value=31  Score=17.09  Aligned_cols=49  Identities=14%  Similarity=0.215  Sum_probs=28.1

Q ss_pred             ccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCcccCcchHHHHHHhhc
Q psy12012         26 VCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRTKQKSSLKTHMAVKH   77 (79)
Q Consensus        26 ~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~   77 (79)
                      .|.-|...|........-.  -.. ...|.|+.|...|-..-+.-.|...|.
T Consensus        57 ~C~~C~~~f~~~~~~~~~~--~~~-~~~y~C~~C~~~FC~dCD~fiHe~Lh~  105 (112)
T TIGR00622        57 FCFGCQGPFPKPPVSPFDE--LKD-SHRYVCAVCKNVFCVDCDVFVHESLHC  105 (112)
T ss_pred             cccCcCCCCCCcccccccc--ccc-ccceeCCCCCCccccccchhhhhhccC
Confidence            3666766665432111000  011 335888888888887777777766654


No 165
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=36.64  E-value=24  Score=14.63  Aligned_cols=13  Identities=23%  Similarity=0.738  Sum_probs=8.5

Q ss_pred             cccchhhhhhcch
Q psy12012         25 FVCDVCDRRYKYK   37 (79)
Q Consensus        25 ~~c~~c~~~~~~~   37 (79)
                      +.|..|+..+...
T Consensus        29 W~C~~Cgh~w~~~   41 (55)
T PF14311_consen   29 WKCPKCGHEWKAS   41 (55)
T ss_pred             EECCCCCCeeEcc
Confidence            6777777666553


No 166
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=35.39  E-value=30  Score=14.13  Aligned_cols=9  Identities=22%  Similarity=0.881  Sum_probs=4.0

Q ss_pred             cchhhhhhc
Q psy12012         27 CDVCDRRYK   35 (79)
Q Consensus        27 c~~c~~~~~   35 (79)
                      |..|++.|.
T Consensus         5 C~~C~~~F~   13 (57)
T cd00065           5 CMGCGKPFT   13 (57)
T ss_pred             CcccCcccc
Confidence            444444443


No 167
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=35.36  E-value=27  Score=17.85  Aligned_cols=47  Identities=15%  Similarity=0.193  Sum_probs=25.6

Q ss_pred             ccccchhhhhhcchhhHHh--Hh--hhhhcCCCCccCCCCCCcccCcchHH
Q psy12012         24 LFVCDVCDRRYKYKSGLYQ--HK--KYECGKEPRYQCPQCPHRTKQKSSLK   70 (79)
Q Consensus        24 ~~~c~~c~~~~~~~~~l~~--h~--~~~~~~~~~~~c~~c~~~f~~~~~l~   70 (79)
                      ...|..|+..+..-..-..  -.  .+......=+.|+.|++.|..-++..
T Consensus        91 ~sRC~~CN~~L~~v~~~~v~~~vp~~v~~~~~~f~~C~~C~kiyW~GsH~~  141 (147)
T PF01927_consen   91 FSRCPKCNGPLRPVSKEEVKDRVPPYVYETYDEFWRCPGCGKIYWEGSHWR  141 (147)
T ss_pred             CCccCCCCcEeeechhhccccccCccccccCCeEEECCCCCCEecccccHH
Confidence            3689999875544221111  00  01101123477999999998876654


No 168
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=35.29  E-value=6.2  Score=14.99  Aligned_cols=7  Identities=43%  Similarity=1.298  Sum_probs=3.7

Q ss_pred             ccCCCCC
Q psy12012         54 YQCPQCP   60 (79)
Q Consensus        54 ~~c~~c~   60 (79)
                      ..|+.|+
T Consensus        23 ~vC~~Cg   29 (34)
T PF14803_consen   23 LVCPACG   29 (34)
T ss_dssp             EEETTTT
T ss_pred             eECCCCC
Confidence            4455554


No 169
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=34.88  E-value=6.2  Score=22.11  Aligned_cols=24  Identities=17%  Similarity=0.364  Sum_probs=13.6

Q ss_pred             CccccchhhhhhcchhhHHhHhhh
Q psy12012         23 GLFVCDVCDRRYKYKSGLYQHKKY   46 (79)
Q Consensus        23 ~~~~c~~c~~~~~~~~~l~~h~~~   46 (79)
                      +...|++|+..|....-...-.++
T Consensus        18 k~ieCPvC~tkFkkeev~tgsiRi   41 (267)
T COG1655          18 KTIECPVCNTKFKKEEVKTGSIRI   41 (267)
T ss_pred             ceeccCcccchhhhhheeccceeE
Confidence            455677777666665544444443


No 170
>KOG1994|consensus
Probab=34.48  E-value=17  Score=20.42  Aligned_cols=20  Identities=35%  Similarity=0.838  Sum_probs=17.1

Q ss_pred             ccccchhhhhhcchhhHHhH
Q psy12012         24 LFVCDVCDRRYKYKSGLYQH   43 (79)
Q Consensus        24 ~~~c~~c~~~~~~~~~l~~h   43 (79)
                      -|-|-+||-.|....+|..|
T Consensus       239 h~YC~fCG~~y~~~edl~eh  258 (268)
T KOG1994|consen  239 HYYCFFCGIKYKDEEDLYEH  258 (268)
T ss_pred             ceEEEEeccccCCHHHHHHh
Confidence            47899999999999988866


No 171
>PF02146 SIR2:  Sir2 family;  InterPro: IPR003000 These sequences represent the Sirtuin (Sir2-related) family of NAD+-dependent deacetylases. This family of enzymes is broadly conserved from bacteria to humans. In yeast, Sir2 proteins form complexes with other proteins to silence chromatin by accessing histones and deacetylating them. Sir2 proteins have been proposed to play a role in silencing, chromosome stability and ageing []. The bacterial enzyme CobB, an homologue of Sir2, is a phosphoribosyltransferase []. An in vitro ADP ribosyltransferase activity has also been associated with human members of this family []. Sir2-like enzymes employ NAD+ as a cosubstrate in deacetylation reactions [] and catalyse a reaction in which the cleavage of NAD(+)and histone and/or protein deacetylation are coupled to the formation of O-acetyl-ADP-ribose, a novel metabolite. The dependence of the reaction on both NAD(+) and the generation of this potential second messenger offers new clues to understanding the function and regulation of nuclear, cytoplasmic and mitochondrial Sir2-like enzymes []. Silent Information Regulator protein of Saccharomyces cerevisiae (Sir2) is one of several factors critical for silencing at least three loci. Among them, it is unique because it silences the rDNA as well as the mating type loci and telomeres []. Sir2 interacts in a complex with itself and with Sir3 and Sir4, two proteins that are able to interact with nucleosomes. In addition Sir2 also interacts with ubiquitination factors and/or complexes [].  Homologues of Sir2 share a core domain including the GAG and NID motifs and a putative C4 Zinc finger. The regions containing these three conserved motifs are individually essential for Sir2 silencing function, as are the four cysteins []. In addition, the conserved residues HG next to the putative Zn finger have been shown to be essential for the ADP ribosyltransferase activity []. ; GO: 0008270 zinc ion binding, 0070403 NAD+ binding, 0006476 protein deacetylation; PDB: 1S5P_A 3PKI_E 3PKJ_F 3K35_A 1ICI_A 1M2K_A 1M2G_A 1M2N_B 1M2H_A 1M2J_A ....
Probab=34.42  E-value=20  Score=18.79  Aligned_cols=40  Identities=18%  Similarity=0.337  Sum_probs=23.2

Q ss_pred             CCCCCCccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCc
Q psy12012         18 EPNHAGLFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHR   62 (79)
Q Consensus        18 ~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~   62 (79)
                      .|..-....|..|++.+....... ..  ..  ..+..|+.|+..
T Consensus        99 lHG~l~~~~C~~C~~~~~~~~~~~-~~--~~--~~~~~C~~C~~~  138 (178)
T PF02146_consen   99 LHGSLFRLRCSKCGKEYDREDIVD-SI--DE--EEPPRCPKCGGL  138 (178)
T ss_dssp             TTEEEEEEEETTTSBEEEGHHHHH-HH--HT--TSSCBCTTTSCB
T ss_pred             HHhhhceeeecCCCccccchhhcc-cc--cc--cccccccccCcc
Confidence            444445678999998876543222 11  11  233478989853


No 172
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=34.07  E-value=35  Score=13.23  Aligned_cols=13  Identities=31%  Similarity=0.667  Sum_probs=6.6

Q ss_pred             cCCCCCCcccCcc
Q psy12012         55 QCPQCPHRTKQKS   67 (79)
Q Consensus        55 ~c~~c~~~f~~~~   67 (79)
                      .|+.|++.|...+
T Consensus         4 ~CprC~kg~Hwa~   16 (36)
T PF14787_consen    4 LCPRCGKGFHWAS   16 (36)
T ss_dssp             C-TTTSSSCS-TT
T ss_pred             cCcccCCCcchhh
Confidence            4666776665543


No 173
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=34.06  E-value=26  Score=19.77  Aligned_cols=15  Identities=20%  Similarity=0.412  Sum_probs=12.2

Q ss_pred             CCCccCCCCCCcccC
Q psy12012         51 EPRYQCPQCPHRTKQ   65 (79)
Q Consensus        51 ~~~~~c~~c~~~f~~   65 (79)
                      .++..|+.||..|..
T Consensus       179 GkpqRCpECGqVFKL  193 (268)
T PTZ00043        179 GFLYRCGECDQIFML  193 (268)
T ss_pred             CCCccCCCCCcEEEE
Confidence            468899999988765


No 174
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=33.75  E-value=36  Score=12.83  Aligned_cols=20  Identities=20%  Similarity=0.634  Sum_probs=9.8

Q ss_pred             CccCCCCCCcccCcchHHHHH
Q psy12012         53 RYQCPQCPHRTKQKSSLKTHM   73 (79)
Q Consensus        53 ~~~c~~c~~~f~~~~~l~~h~   73 (79)
                      .+.|+.|++.+... -+..|+
T Consensus         4 ~~~C~nC~R~v~a~-RfA~HL   23 (33)
T PF08209_consen    4 YVECPNCGRPVAAS-RFAPHL   23 (33)
T ss_dssp             EEE-TTTSSEEEGG-GHHHHH
T ss_pred             eEECCCCcCCcchh-hhHHHH
Confidence            35677777654432 334443


No 175
>PRK11032 hypothetical protein; Provisional
Probab=32.96  E-value=17  Score=19.18  Aligned_cols=31  Identities=29%  Similarity=0.678  Sum_probs=18.3

Q ss_pred             CCCccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCc
Q psy12012         21 HAGLFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHR   62 (79)
Q Consensus        21 ~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~   62 (79)
                      |.+..+|..||.....          ... ...-.|+.|+..
T Consensus       121 g~G~LvC~~Cg~~~~~----------~~p-~~i~pCp~C~~~  151 (160)
T PRK11032        121 GLGNLVCEKCHHHLAF----------YTP-EVLPLCPKCGHD  151 (160)
T ss_pred             ecceEEecCCCCEEEe----------cCC-CcCCCCCCCCCC
Confidence            3456889999754321          112 334468999754


No 176
>PF05180 zf-DNL:  DNL zinc finger;  InterPro: IPR007853 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The DNL-type zinc finger is found in Tim15, a zinc finger protein essential for protein import into mitochondria. Mitochondrial functions rely on the correct transport of resident proteins synthesized in the cytosol to mitochondria. Protein import into mitochondria is mediated by membrane protein complexes, protein translocators, in the outer and inner mitochondrial membranes, in cooperation with their assistant proteins in the cytosol, intermembrane space and matrix. Proteins destined to the mitochondrial matrix cross the outer membrane with the aid of the outer membrane translocator, the tOM40 complex, and then the inner membrane with the aid of the inner membrane translocator, the TIM23 complex, and mitochondrial motor and chaperone (MMC) proteins including mitochondrial heat- shock protein 70 (mtHsp70), and translocase in the inner mitochondrial membrane (Tim)15. Tim15 is also known as zinc finger motif (Zim)17 or mtHsp70 escort protein (Hep)1. Tim15 contains a zinc-finger motif (CXXC and CXXC) of ~100 residues, which has been named DNL after a short C-terminal motif of D(N/H)L [, , ]. The DNL-type zinc finger is an L-shaped molecule. The two CXXC motifs are located at the end of the L, and are sandwiched by two- stranded antiparallel beta-sheets. Two short alpha-helices constitute another leg of the L. The outer (convex) face of the L has a large acidic groove, which is lined with five acidic residues, whereas the inner (concave) face of the L has two positively charged residues, next to the CXXC motifs []. This entry represents the DNL-type zinc finger.; GO: 0008270 zinc ion binding; PDB: 2E2Z_A.
Probab=32.72  E-value=2.4  Score=18.76  Aligned_cols=34  Identities=32%  Similarity=0.721  Sum_probs=16.0

Q ss_pred             cccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCc
Q psy12012         25 FVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHR   62 (79)
Q Consensus        25 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~   62 (79)
                      |+|..|+..-..  .+ ..+.-+.| ....+|+.|...
T Consensus         5 FTC~~C~~Rs~~--~~-sk~aY~~G-vViv~C~gC~~~   38 (66)
T PF05180_consen    5 FTCNKCGTRSAK--MF-SKQAYHKG-VVIVQCPGCKNR   38 (66)
T ss_dssp             EEETTTTEEEEE--EE-EHHHHHTS-EEEEE-TTS--E
T ss_pred             EEcCCCCCccce--ee-CHHHHhCC-eEEEECCCCcce
Confidence            678888643222  11 22233445 556678888653


No 177
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=32.08  E-value=29  Score=13.57  Aligned_cols=8  Identities=38%  Similarity=1.402  Sum_probs=4.5

Q ss_pred             cCCCCCCc
Q psy12012         55 QCPQCPHR   62 (79)
Q Consensus        55 ~c~~c~~~   62 (79)
                      .|+.|+..
T Consensus         2 ~Cp~Cg~~    9 (43)
T PF08271_consen    2 KCPNCGSK    9 (43)
T ss_dssp             SBTTTSSS
T ss_pred             CCcCCcCC
Confidence            46666543


No 178
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the KOG4124|consensus
Probab=31.52  E-value=12  Score=22.35  Aligned_cols=23  Identities=39%  Similarity=0.873  Sum_probs=17.1

Q ss_pred             CCccccchhhhhhcchhhHHhHh
Q psy12012         22 AGLFVCDVCDRRYKYKSGLYQHK   44 (79)
Q Consensus        22 ~~~~~c~~c~~~~~~~~~l~~h~   44 (79)
                      .|+|+|++|.+.+.....|.-|.
T Consensus       396 nk~~r~~i~~~~~k~~~~l~~~~  418 (442)
T KOG4124|consen  396 NKPYRCEVCSKRYKNLNGLKYHR  418 (442)
T ss_pred             cCcccChhhhhhhccCCCCCcee
Confidence            57899999998887766655443


No 180
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=31.33  E-value=12  Score=19.16  Aligned_cols=16  Identities=25%  Similarity=0.501  Sum_probs=12.3

Q ss_pred             CCccccchhhhhhcch
Q psy12012         22 AGLFVCDVCDRRYKYK   37 (79)
Q Consensus        22 ~~~~~c~~c~~~~~~~   37 (79)
                      .++.+|..||.-|...
T Consensus       110 g~~~RCpeCG~~fkL~  125 (136)
T PF01215_consen  110 GKPQRCPECGQVFKLK  125 (136)
T ss_dssp             TSEEEETTTEEEEEEE
T ss_pred             CCccCCCCCCeEEEEE
Confidence            3588999999887654


No 181
>PTZ00448 hypothetical protein; Provisional
Probab=30.94  E-value=43  Score=20.30  Aligned_cols=22  Identities=18%  Similarity=0.454  Sum_probs=16.0

Q ss_pred             CccCCCCCCcccCcchHHHHHH
Q psy12012         53 RYQCPQCPHRTKQKSSLKTHMA   74 (79)
Q Consensus        53 ~~~c~~c~~~f~~~~~l~~h~~   74 (79)
                      .+.|..|+-.|........|.+
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~K  335 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYR  335 (373)
T ss_pred             CccccccccccCCHHHHHHHhh
Confidence            4779999988876655566654


No 182
>KOG0562|consensus
Probab=30.86  E-value=43  Score=17.96  Aligned_cols=27  Identities=19%  Similarity=0.341  Sum_probs=19.8

Q ss_pred             CCCccCCCCCCcccCcchHHHHHHhhc
Q psy12012         51 EPRYQCPQCPHRTKQKSSLKTHMAVKH   77 (79)
Q Consensus        51 ~~~~~c~~c~~~f~~~~~l~~h~~~h~   77 (79)
                      +.+..|..|+..-+..+-|+.|.+.+.
T Consensus       151 k~dLrC~~Cq~~~~~~~kLK~Hl~~~~  177 (184)
T KOG0562|consen  151 KEDLRCWRCQTFGPHFPKLKAHLREEY  177 (184)
T ss_pred             ccceeehhhhhcccccHHHHHHHHHHH
Confidence            346789999855566778899988653


No 183
>PRK12860 transcriptional activator FlhC; Provisional
Probab=30.42  E-value=27  Score=18.96  Aligned_cols=28  Identities=18%  Similarity=0.433  Sum_probs=17.2

Q ss_pred             ccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCC
Q psy12012         24 LFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCP   60 (79)
Q Consensus        24 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~   60 (79)
                      ...|..|+..|.....        .. ...|.|+.|.
T Consensus       134 l~~C~~Cgg~fv~~~~--------e~-~~~f~CplC~  161 (189)
T PRK12860        134 LARCCRCGGKFVTHAH--------DL-RHNFVCGLCQ  161 (189)
T ss_pred             eccCCCCCCCeecccc--------cc-CCCCcCCCCC
Confidence            4578888877753211        12 3468888885


No 184
>KOG3214|consensus
Probab=30.41  E-value=31  Score=16.77  Aligned_cols=12  Identities=17%  Similarity=0.479  Sum_probs=8.1

Q ss_pred             ccCCCCCCcccC
Q psy12012         54 YQCPQCPHRTKQ   65 (79)
Q Consensus        54 ~~c~~c~~~f~~   65 (79)
                      ..|.+|+..|..
T Consensus        48 ~sC~iC~esFqt   59 (109)
T KOG3214|consen   48 ASCRICEESFQT   59 (109)
T ss_pred             eeeeehhhhhcc
Confidence            567777777654


No 185
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=30.03  E-value=22  Score=13.80  Aligned_cols=13  Identities=15%  Similarity=0.802  Sum_probs=7.7

Q ss_pred             CCCccccchhhhh
Q psy12012         21 HAGLFVCDVCDRR   33 (79)
Q Consensus        21 ~~~~~~c~~c~~~   33 (79)
                      +.+.|.|..|+..
T Consensus        21 ~~~~w~C~~C~~~   33 (40)
T PF04810_consen   21 GGKTWICNFCGTK   33 (40)
T ss_dssp             TTTEEEETTT--E
T ss_pred             CCCEEECcCCCCc
Confidence            4566888888654


No 186
>PRK12722 transcriptional activator FlhC; Provisional
Probab=29.90  E-value=31  Score=18.75  Aligned_cols=29  Identities=17%  Similarity=0.466  Sum_probs=17.2

Q ss_pred             ccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCC
Q psy12012         24 LFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPH   61 (79)
Q Consensus        24 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   61 (79)
                      ...|..|+..|.....        .. ...|.|+.|..
T Consensus       134 l~~C~~Cgg~fv~~~~--------e~-~~~f~CplC~~  162 (187)
T PRK12722        134 LSSCNCCGGHFVTHAH--------DP-VGSFVCGLCQP  162 (187)
T ss_pred             eccCCCCCCCeecccc--------cc-CCCCcCCCCCC
Confidence            3468888777653221        12 34688888863


No 187
>PRK01343 zinc-binding protein; Provisional
Probab=29.58  E-value=44  Score=14.41  Aligned_cols=13  Identities=31%  Similarity=0.958  Sum_probs=8.8

Q ss_pred             CCccCCCCCCccc
Q psy12012         52 PRYQCPQCPHRTK   64 (79)
Q Consensus        52 ~~~~c~~c~~~f~   64 (79)
                      +...|++|++.+.
T Consensus         8 p~~~CP~C~k~~~   20 (57)
T PRK01343          8 PTRPCPECGKPST   20 (57)
T ss_pred             CCCcCCCCCCcCc
Confidence            3456888887654


No 188
>KOG3352|consensus
Probab=29.26  E-value=32  Score=18.00  Aligned_cols=22  Identities=32%  Similarity=0.507  Sum_probs=14.3

Q ss_pred             HhhhhhcCCCCccCCCCCCcccCc
Q psy12012         43 HKKYECGKEPRYQCPQCPHRTKQK   66 (79)
Q Consensus        43 h~~~~~~~~~~~~c~~c~~~f~~~   66 (79)
                      ++-.+.+  +..+|++|+..|...
T Consensus       125 Wmwl~Kg--e~~rc~eCG~~fkL~  146 (153)
T KOG3352|consen  125 WMWLEKG--ETQRCPECGHYFKLV  146 (153)
T ss_pred             EEEEEcC--CcccCCcccceEEee
Confidence            3444444  567799999887653


No 189
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=28.49  E-value=26  Score=19.93  Aligned_cols=11  Identities=27%  Similarity=0.966  Sum_probs=7.3

Q ss_pred             CCccCCCCCCc
Q psy12012         52 PRYQCPQCPHR   62 (79)
Q Consensus        52 ~~~~c~~c~~~   62 (79)
                      +.+.|+.||..
T Consensus       321 r~~~C~~cg~~  331 (364)
T COG0675         321 RLFKCPRCGFV  331 (364)
T ss_pred             eeEECCCCCCe
Confidence            45777777754


No 190
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=28.13  E-value=8.9  Score=15.50  Aligned_cols=11  Identities=36%  Similarity=0.797  Sum_probs=5.7

Q ss_pred             ccCCC--CCCccc
Q psy12012         54 YQCPQ--CPHRTK   64 (79)
Q Consensus        54 ~~c~~--c~~~f~   64 (79)
                      +.|..  ||..|.
T Consensus        26 ~qC~N~~Cg~tfv   38 (47)
T PF04606_consen   26 CQCTNPECGHTFV   38 (47)
T ss_pred             EEECCCcCCCEEE
Confidence            44443  666554


No 191
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=28.01  E-value=26  Score=14.67  Aligned_cols=17  Identities=18%  Similarity=0.366  Sum_probs=10.3

Q ss_pred             CCCccccchhhhhhcch
Q psy12012         21 HAGLFVCDVCDRRYKYK   37 (79)
Q Consensus        21 ~~~~~~c~~c~~~~~~~   37 (79)
                      ....++|..|++.+...
T Consensus        32 ~~~~~rC~YCe~~~~~~   48 (52)
T PF02748_consen   32 EPIKLRCHYCERIITED   48 (52)
T ss_dssp             TTCEEEETTT--EEEHH
T ss_pred             CCCEEEeeCCCCEeccc
Confidence            44568888888776554


No 192
>PRK14873 primosome assembly protein PriA; Provisional
Probab=27.81  E-value=46  Score=21.82  Aligned_cols=11  Identities=36%  Similarity=1.298  Sum_probs=7.3

Q ss_pred             CCccCCCCCCc
Q psy12012         52 PRYQCPQCPHR   62 (79)
Q Consensus        52 ~~~~c~~c~~~   62 (79)
                      .|..|+.|+..
T Consensus       421 ~p~~Cp~Cgs~  431 (665)
T PRK14873        421 PDWRCPRCGSD  431 (665)
T ss_pred             cCccCCCCcCC
Confidence            46678888754


No 193
>KOG4118|consensus
Probab=27.41  E-value=59  Score=14.50  Aligned_cols=26  Identities=19%  Similarity=0.225  Sum_probs=16.4

Q ss_pred             ccccchhhhhhcchhhHHhHhhhhhc
Q psy12012         24 LFVCDVCDRRYKYKSGLYQHKKYECG   49 (79)
Q Consensus        24 ~~~c~~c~~~~~~~~~l~~h~~~~~~   49 (79)
                      .+.|.+|--....+..+.+|....+.
T Consensus        38 ~~kCtVC~~~mpdpktfkqhfe~kHp   63 (74)
T KOG4118|consen   38 HHKCTVCMVQMPDPKTFKQHFENKHP   63 (74)
T ss_pred             HhhhHhhHhhCCCCchHHHHHhhcCC
Confidence            36788876666666666666665433


No 194
>COG5539 Predicted cysteine protease (OTU family) [Posttranslational modification, protein turnover, chaperones]
Probab=27.22  E-value=30  Score=20.20  Aligned_cols=22  Identities=18%  Similarity=0.551  Sum_probs=12.6

Q ss_pred             ccccchhhhhhcchhhHHhHhh
Q psy12012         24 LFVCDVCDRRYKYKSGLYQHKK   45 (79)
Q Consensus        24 ~~~c~~c~~~~~~~~~l~~h~~   45 (79)
                      ..+|+.|+..|.....+..|.-
T Consensus       275 ~ik~n~c~~~~~~e~~~~~Ha~  296 (306)
T COG5539         275 SIKCNICGTGFVGEKDYYAHAL  296 (306)
T ss_pred             eEEeeccccccchhhHHHHHHH
Confidence            3456666666665555555543


No 195
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=27.22  E-value=40  Score=13.17  Aligned_cols=9  Identities=33%  Similarity=1.017  Sum_probs=6.4

Q ss_pred             CccCCCCCC
Q psy12012         53 RYQCPQCPH   61 (79)
Q Consensus        53 ~~~c~~c~~   61 (79)
                      |..|+.|+.
T Consensus         2 ~~~Cp~Cg~   10 (47)
T PF14690_consen    2 PPRCPHCGS   10 (47)
T ss_pred             CccCCCcCC
Confidence            567888874


No 196
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=27.10  E-value=15  Score=21.14  Aligned_cols=21  Identities=24%  Similarity=0.562  Sum_probs=12.2

Q ss_pred             CCCccCCCCCCcccCcchHHH
Q psy12012         51 EPRYQCPQCPHRTKQKSSLKT   71 (79)
Q Consensus        51 ~~~~~c~~c~~~f~~~~~l~~   71 (79)
                      .+++.|+.|+........|..
T Consensus       207 ~k~~PCPKCg~et~eTkdLSm  227 (314)
T PF06524_consen  207 GKPIPCPKCGYETQETKDLSM  227 (314)
T ss_pred             CCCCCCCCCCCccccccccee
Confidence            356777777765544444443


No 197
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=27.09  E-value=31  Score=16.85  Aligned_cols=14  Identities=14%  Similarity=0.413  Sum_probs=10.0

Q ss_pred             ccccchhhhhhcch
Q psy12012         24 LFVCDVCDRRYKYK   37 (79)
Q Consensus        24 ~~~c~~c~~~~~~~   37 (79)
                      |+.|..||..|..-
T Consensus         2 pH~CtrCG~vf~~g   15 (112)
T COG3364           2 PHQCTRCGEVFDDG   15 (112)
T ss_pred             Cceecccccccccc
Confidence            46788888777663


No 198
>COG0846 SIR2 NAD-dependent protein deacetylases, SIR2 family [Transcription]
Probab=26.69  E-value=42  Score=19.06  Aligned_cols=40  Identities=18%  Similarity=0.280  Sum_probs=22.9

Q ss_pred             cCCCCCCccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCC
Q psy12012         17 SEPNHAGLFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPH   61 (79)
Q Consensus        17 ~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   61 (79)
                      ..|..-....|..|+..+.........   ..  ..+-.|+.|+.
T Consensus       115 ~lHGsl~~~~C~~C~~~~~~~~~~~~~---~~--~~~p~C~~Cg~  154 (250)
T COG0846         115 ELHGSLKRVRCSKCGNQYYDEDVIKFI---ED--GLIPRCPKCGG  154 (250)
T ss_pred             EeccceeeeEeCCCcCccchhhhhhhc---cc--CCCCcCccCCC
Confidence            345455678899998777644311111   11  23456888886


No 199
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=26.35  E-value=32  Score=13.20  Aligned_cols=13  Identities=38%  Similarity=0.871  Sum_probs=8.0

Q ss_pred             CCccCCCCCCccc
Q psy12012         52 PRYQCPQCPHRTK   64 (79)
Q Consensus        52 ~~~~c~~c~~~f~   64 (79)
                      +-+.|+.||..+.
T Consensus        31 p~~~C~~CGE~~~   43 (46)
T TIGR03831        31 PALVCPQCGEEYL   43 (46)
T ss_pred             CccccccCCCEee
Confidence            3356788876543


No 200
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=26.34  E-value=29  Score=13.24  Aligned_cols=11  Identities=18%  Similarity=0.634  Sum_probs=4.0

Q ss_pred             cCCCCCCcccC
Q psy12012         55 QCPQCPHRTKQ   65 (79)
Q Consensus        55 ~c~~c~~~f~~   65 (79)
                      .|..|++.|..
T Consensus         5 ~C~eC~~~f~d   15 (34)
T PF01286_consen    5 KCDECGKPFMD   15 (34)
T ss_dssp             E-TTT--EES-
T ss_pred             hHhHhCCHHHH
Confidence            46666665543


No 201
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=26.22  E-value=36  Score=12.53  Aligned_cols=11  Identities=27%  Similarity=0.760  Sum_probs=7.2

Q ss_pred             CccCCCCCCcc
Q psy12012         53 RYQCPQCPHRT   63 (79)
Q Consensus        53 ~~~c~~c~~~f   63 (79)
                      -|+|..|+...
T Consensus         4 ~ykC~~CGniv   14 (34)
T cd00974           4 VYKCEICGNIV   14 (34)
T ss_pred             EEEcCCCCcEE
Confidence            46777777543


No 202
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=26.18  E-value=21  Score=14.83  Aligned_cols=12  Identities=25%  Similarity=0.684  Sum_probs=8.2

Q ss_pred             cCCCCCCcccCc
Q psy12012         55 QCPQCPHRTKQK   66 (79)
Q Consensus        55 ~c~~c~~~f~~~   66 (79)
                      .|+.|++.|...
T Consensus        14 ICpvCqRPFsWR   25 (54)
T COG4338          14 ICPVCQRPFSWR   25 (54)
T ss_pred             hhhhhcCchHHH
Confidence            477787777653


No 203
>PRK05580 primosome assembly protein PriA; Validated
Probab=26.18  E-value=22  Score=23.10  Aligned_cols=12  Identities=25%  Similarity=0.667  Sum_probs=7.8

Q ss_pred             CCCccCCCCCCc
Q psy12012         51 EPRYQCPQCPHR   62 (79)
Q Consensus        51 ~~~~~c~~c~~~   62 (79)
                      ..|..|+.|+..
T Consensus       419 ~~~~~Cp~Cg~~  430 (679)
T PRK05580        419 PIPKACPECGST  430 (679)
T ss_pred             CCCCCCCCCcCC
Confidence            346678888654


No 204
>PF05766 NinG:  Bacteriophage Lambda NinG protein;  InterPro: IPR008713 The ninR region of phage lambda contains two recombination genes, ninB (also known as orf) and ninG (also known as rap). These genes are involved in the RecF and RecBCD recombination pathways of Escherichia coli that operate on phage lambda [, ]. NinB and NinG participate in Red recombination, the primary pathway operating when wild-type lambda grows lytically in rec+ cells [].
Probab=26.18  E-value=32  Score=18.69  Aligned_cols=14  Identities=21%  Similarity=0.427  Sum_probs=8.3

Q ss_pred             Cccccchhhhhhcc
Q psy12012         23 GLFVCDVCDRRYKY   36 (79)
Q Consensus        23 ~~~~c~~c~~~~~~   36 (79)
                      ++-.|.+|+..|..
T Consensus         5 k~rKCKvCg~~F~P   18 (189)
T PF05766_consen    5 KRRKCKVCGEWFVP   18 (189)
T ss_pred             CCCcCcccCCcccc
Confidence            44566666666654


No 205
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=25.89  E-value=36  Score=12.50  Aligned_cols=11  Identities=27%  Similarity=0.772  Sum_probs=7.3

Q ss_pred             CccCCCCCCcc
Q psy12012         53 RYQCPQCPHRT   63 (79)
Q Consensus        53 ~~~c~~c~~~f   63 (79)
                      -|+|..|+..+
T Consensus         7 ~ykC~~Cgniv   17 (34)
T TIGR00319         7 VYKCEVCGNIV   17 (34)
T ss_pred             EEEcCCCCcEE
Confidence            47788777543


No 206
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=25.70  E-value=59  Score=19.06  Aligned_cols=24  Identities=33%  Similarity=0.588  Sum_probs=18.9

Q ss_pred             CCCccCCCCCCcccCcchHHHHHH
Q psy12012         51 EPRYQCPQCPHRTKQKSSLKTHMA   74 (79)
Q Consensus        51 ~~~~~c~~c~~~f~~~~~l~~h~~   74 (79)
                      ...|.|..|-+.|.....+..|+.
T Consensus        46 ~~lyiCe~Clky~~~~~~l~~H~~   69 (290)
T PLN03238         46 TKLYICEYCLKYMRKKKSLLRHLA   69 (290)
T ss_pred             CeEEEcCCCcchhCCHHHHHHHHH
Confidence            456888888888888888888865


No 207
>PF10272 Tmpp129:  Putative transmembrane protein precursor;  InterPro: IPR018801  This entry consists of proteins conserved from worms to humans. They are purported to be transmembrane protein-precursors but their function is unknown. 
Probab=25.65  E-value=34  Score=20.56  Aligned_cols=36  Identities=17%  Similarity=0.528  Sum_probs=19.6

Q ss_pred             cchh-hhhhcchhhHHhHhhhhhcCCCCccCCCCCCcccC
Q psy12012         27 CDVC-DRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRTKQ   65 (79)
Q Consensus        27 c~~c-~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~   65 (79)
                      |..| ++.|..+++-........+   ...|+-|...|--
T Consensus       316 C~~Cm~kwFasrQd~~~~~~Wl~~---~~~CPtCRa~FCi  352 (358)
T PF10272_consen  316 CLECMGKWFASRQDQQHPETWLSG---KCPCPTCRAKFCI  352 (358)
T ss_pred             HHHHHHHHhhhcCCCCChhhhhcC---CCCCCCCccccee
Confidence            3344 6677776643322222323   3568889887743


No 208
>PRK09951 hypothetical protein; Provisional
Probab=25.59  E-value=32  Score=19.05  Aligned_cols=10  Identities=40%  Similarity=0.694  Sum_probs=7.5

Q ss_pred             CCcccccccc
Q psy12012          1 MFGQFRFSES   10 (79)
Q Consensus         1 ~~~~f~~~~~   10 (79)
                      |||+|.....
T Consensus         1 MCGRf~~~~~   10 (222)
T PRK09951          1 MCGRFAQSQT   10 (222)
T ss_pred             CCCCccccCC
Confidence            8999976554


No 209
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=25.52  E-value=60  Score=19.06  Aligned_cols=30  Identities=27%  Similarity=0.337  Sum_probs=16.7

Q ss_pred             ccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCcccC
Q psy12012         26 VCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRTKQ   65 (79)
Q Consensus        26 ~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~   65 (79)
                      +|+.|+..+..+. |.         +..+.|+.|+.-|..
T Consensus        40 kc~~C~~~~~~~~-l~---------~~~~vcp~c~~h~rl   69 (296)
T CHL00174         40 QCENCYGLNYKKF-LK---------SKMNICEQCGYHLKM   69 (296)
T ss_pred             ECCCccchhhHHH-HH---------HcCCCCCCCCCCcCC
Confidence            5777765432221 21         234678888876554


No 210
>PF14447 Prok-RING_4:  Prokaryotic RING finger family 4
Probab=25.50  E-value=51  Score=14.12  Aligned_cols=10  Identities=30%  Similarity=0.720  Sum_probs=6.3

Q ss_pred             CCCCCCcccC
Q psy12012         56 CPQCPHRTKQ   65 (79)
Q Consensus        56 c~~c~~~f~~   65 (79)
                      |+.|+..|..
T Consensus        42 CPfC~~~~~~   51 (55)
T PF14447_consen   42 CPFCGTPFEF   51 (55)
T ss_pred             CCCCCCcccC
Confidence            6777766543


No 211
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=25.44  E-value=41  Score=14.13  Aligned_cols=9  Identities=44%  Similarity=1.069  Sum_probs=5.4

Q ss_pred             cCCCCCCcc
Q psy12012         55 QCPQCPHRT   63 (79)
Q Consensus        55 ~c~~c~~~f   63 (79)
                      .|+.||..+
T Consensus         2 ~CPyCge~~   10 (52)
T PF14255_consen    2 QCPYCGEPI   10 (52)
T ss_pred             CCCCCCCee
Confidence            467776544


No 212
>PRK04351 hypothetical protein; Provisional
Probab=25.44  E-value=21  Score=18.47  Aligned_cols=33  Identities=27%  Similarity=0.805  Sum_probs=19.0

Q ss_pred             ccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCcccC
Q psy12012         24 LFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRTKQ   65 (79)
Q Consensus        24 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~   65 (79)
                      .|.|..|+..+..      +.+.  . ...|.|..|+..+..
T Consensus       112 ~Y~C~~Cg~~~~r------~Rr~--n-~~~yrCg~C~g~L~~  144 (149)
T PRK04351        112 LYECQSCGQQYLR------KRRI--N-TKRYRCGKCRGKLKL  144 (149)
T ss_pred             EEECCCCCCEeee------eeec--C-CCcEEeCCCCcEeee
Confidence            4778778755432      2222  2 346888888765543


No 213
>KOG0782|consensus
Probab=25.23  E-value=19  Score=23.26  Aligned_cols=14  Identities=29%  Similarity=0.477  Sum_probs=8.0

Q ss_pred             ccCCCCCCcccCcc
Q psy12012         54 YQCPQCPHRTKQKS   67 (79)
Q Consensus        54 ~~c~~c~~~f~~~~   67 (79)
                      -+|..|++.|.++.
T Consensus       254 GkC~~CgKgFQQKf  267 (1004)
T KOG0782|consen  254 GKCNTCGKGFQQKF  267 (1004)
T ss_pred             cccchhhhhhhhhe
Confidence            45666666665543


No 214
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=25.17  E-value=28  Score=19.89  Aligned_cols=13  Identities=31%  Similarity=1.119  Sum_probs=8.5

Q ss_pred             CccCCCCCCcccC
Q psy12012         53 RYQCPQCPHRTKQ   65 (79)
Q Consensus        53 ~~~c~~c~~~f~~   65 (79)
                      .|.|+.|+..|.-
T Consensus       155 ef~C~~C~h~F~G  167 (278)
T PF15135_consen  155 EFHCPKCRHNFRG  167 (278)
T ss_pred             eeecccccccchh
Confidence            4677777776653


No 215
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=25.05  E-value=32  Score=12.87  Aligned_cols=11  Identities=18%  Similarity=0.268  Sum_probs=6.6

Q ss_pred             ccCCCCCCccc
Q psy12012         54 YQCPQCPHRTK   64 (79)
Q Consensus        54 ~~c~~c~~~f~   64 (79)
                      +.|..|+..|.
T Consensus        22 ~~C~~Cg~~~~   32 (33)
T PF08792_consen   22 EVCIFCGSSFP   32 (33)
T ss_pred             EEcccCCcEee
Confidence            45777766553


No 216
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=24.98  E-value=45  Score=14.65  Aligned_cols=43  Identities=16%  Similarity=0.230  Sum_probs=22.6

Q ss_pred             CCCCCCccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCcccC
Q psy12012         18 EPNHAGLFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRTKQ   65 (79)
Q Consensus        18 ~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~   65 (79)
                      .+.+..++.|.--+..+..+.-+.   ..  +.+....|+.|+..|..
T Consensus        18 I~~~~~~l~C~g~~~p~~HPrV~L---~m--g~~gev~CPYC~t~y~l   60 (62)
T COG4391          18 IEIGDLPLMCPGPEPPNDHPRVFL---DM--GDEGEVVCPYCSTRYRL   60 (62)
T ss_pred             EEeCCeeEEcCCCCCCCCCCEEEE---Ec--CCCCcEecCccccEEEe
Confidence            344566777765443333322111   11  32445679999887653


No 217
>PF06676 DUF1178:  Protein of unknown function (DUF1178);  InterPro: IPR009562 This family consists of several hypothetical bacterial proteins of around 150 residues in length. The function of this family is unknown.
Probab=24.93  E-value=95  Score=16.26  Aligned_cols=9  Identities=33%  Similarity=0.896  Sum_probs=4.8

Q ss_pred             CccCCCCCC
Q psy12012         53 RYQCPQCPH   61 (79)
Q Consensus        53 ~~~c~~c~~   61 (79)
                      ...|+.||.
T Consensus        32 lv~CP~Cgs   40 (148)
T PF06676_consen   32 LVSCPVCGS   40 (148)
T ss_pred             CccCCCCCC
Confidence            445555553


No 218
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=24.91  E-value=23  Score=20.29  Aligned_cols=10  Identities=40%  Similarity=1.125  Sum_probs=3.4

Q ss_pred             CccCCCCCCc
Q psy12012         53 RYQCPQCPHR   62 (79)
Q Consensus        53 ~~~c~~c~~~   62 (79)
                      ...|+.||..
T Consensus       211 R~~Cp~Cg~~  220 (290)
T PF04216_consen  211 RIKCPYCGNT  220 (290)
T ss_dssp             TTS-TTT---
T ss_pred             CCCCcCCCCC
Confidence            3456666644


No 219
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=24.56  E-value=95  Score=15.35  Aligned_cols=27  Identities=30%  Similarity=0.458  Sum_probs=21.5

Q ss_pred             CCCCccccchhhhhhcchhhHHhHhhh
Q psy12012         20 NHAGLFVCDVCDRRYKYKSGLYQHKKY   46 (79)
Q Consensus        20 ~~~~~~~c~~c~~~~~~~~~l~~h~~~   46 (79)
                      .|-..+-|-+|.+-|.....|..|.+.
T Consensus        51 PGlGqhYCieCaryf~t~~aL~~Hkkg   77 (126)
T COG5112          51 PGLGQHYCIECARYFITEKALMEHKKG   77 (126)
T ss_pred             CCCceeeeehhHHHHHHHHHHHHHhcc
Confidence            345567899999999999999888763


No 220
>KOG0402|consensus
Probab=24.51  E-value=23  Score=16.56  Aligned_cols=30  Identities=17%  Similarity=0.661  Sum_probs=18.0

Q ss_pred             ccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCccc
Q psy12012         24 LFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRTK   64 (79)
Q Consensus        24 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~   64 (79)
                      -|.|+.||+.-     +.   +...|   .+.|..|.+.+.
T Consensus        36 ky~CsfCGK~~-----vK---R~AvG---iW~C~~C~kv~a   65 (92)
T KOG0402|consen   36 KYTCSFCGKKT-----VK---RKAVG---IWKCGSCKKVVA   65 (92)
T ss_pred             hhhhhhcchhh-----hh---hhcee---EEecCCccceec
Confidence            48999999753     22   11223   467777776553


No 221
>PF13821 DUF4187:  Domain of unknown function (DUF4187)
Probab=24.36  E-value=29  Score=14.71  Aligned_cols=17  Identities=24%  Similarity=0.444  Sum_probs=13.3

Q ss_pred             cccchhhhhhcchhhHH
Q psy12012         25 FVCDVCDRRYKYKSGLY   41 (79)
Q Consensus        25 ~~c~~c~~~~~~~~~l~   41 (79)
                      +=|-.||..|.....|.
T Consensus        28 ~YC~~Cg~~Y~d~~dL~   44 (55)
T PF13821_consen   28 NYCFWCGTKYDDEEDLE   44 (55)
T ss_pred             ceeeeeCCccCCHHHHH
Confidence            56888988888877775


No 222
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=23.81  E-value=25  Score=21.98  Aligned_cols=10  Identities=40%  Similarity=0.863  Sum_probs=6.6

Q ss_pred             CCccCCCCCC
Q psy12012         52 PRYQCPQCPH   61 (79)
Q Consensus        52 ~~~~c~~c~~   61 (79)
                      .|..|+.|+.
T Consensus       252 ~~~~Cp~C~s  261 (505)
T TIGR00595       252 IPKTCPQCGS  261 (505)
T ss_pred             CCCCCCCCCC
Confidence            4566777764


No 223
>PF11494 Ta0938:  Ta0938;  InterPro: IPR021585  Ta0938 is a protein of unknown function however the structure has been determined. The protein has a novel fold and a putative Zn-binding motif. The structure has two different parts, one region contains a beta sheet flanked by two alpha helices and the other contains a bundle of loops which contain all cysteines in the protein. ; PDB: 2FQH_A.
Probab=23.40  E-value=44  Score=16.15  Aligned_cols=42  Identities=17%  Similarity=0.426  Sum_probs=15.3

Q ss_pred             CCCCCCccccchhhhhhcchhhHHhHhhhhhcCCCC-ccCCCCCCcccCc
Q psy12012         18 EPNHAGLFVCDVCDRRYKYKSGLYQHKKYECGKEPR-YQCPQCPHRTKQK   66 (79)
Q Consensus        18 ~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~-~~c~~c~~~f~~~   66 (79)
                      ...+.|...|..|+..+..   +  ++.+. + ++. |-|..|.+.|.+-
T Consensus         8 ~~ag~ke~~CalCG~tWg~---~--y~Ev~-G-~rLfFCCd~ca~EF~nm   50 (105)
T PF11494_consen    8 REAGTKEMGCALCGATWGD---Y--YEEVD-G-ERLFFCCDDCAKEFKNM   50 (105)
T ss_dssp             S---SGGGS-SS---S------S--S-B-T-T---BSSS--SSSS-TTS-
T ss_pred             eecccccccccccCCcHHH---H--HHhhc-C-CEEEEEcHHHHHHHHHH
Confidence            3456677889999987653   2  22332 3 333 5678888777664


No 224
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=23.35  E-value=17  Score=14.09  Aligned_cols=10  Identities=40%  Similarity=1.185  Sum_probs=7.1

Q ss_pred             cccchhhhhh
Q psy12012         25 FVCDVCDRRY   34 (79)
Q Consensus        25 ~~c~~c~~~~   34 (79)
                      |.|..|+..|
T Consensus        29 y~C~~C~~~w   38 (39)
T PF01096_consen   29 YVCCNCGHRW   38 (39)
T ss_dssp             EEESSSTEEE
T ss_pred             EEeCCCCCee
Confidence            6788887654


No 225
>KOG3456|consensus
Probab=23.33  E-value=40  Score=16.59  Aligned_cols=13  Identities=23%  Similarity=0.692  Sum_probs=9.8

Q ss_pred             ccccchhhhhhcc
Q psy12012         24 LFVCDVCDRRYKY   36 (79)
Q Consensus        24 ~~~c~~c~~~~~~   36 (79)
                      +..|.+||..|..
T Consensus       104 ~~~CgYCGlrf~~  116 (120)
T KOG3456|consen  104 PHICGYCGLRFVQ  116 (120)
T ss_pred             Ccccccchhhhhh
Confidence            4788899887754


No 226
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=23.05  E-value=95  Score=18.62  Aligned_cols=48  Identities=19%  Similarity=0.315  Sum_probs=28.0

Q ss_pred             ccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCcccCcchHHHHHHhh
Q psy12012         26 VCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRTKQKSSLKTHMAVK   76 (79)
Q Consensus        26 ~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~h   76 (79)
                      -|-.|...|+....-..-...  . ...|.|+.|...|-.....-.|...|
T Consensus       364 ~Cf~CQ~~fp~~~~~~~~~~~--s-s~rY~Ce~CK~~FC~dCdvfiHe~Lh  411 (421)
T COG5151         364 HCFVCQGPFPKPPVSPFDEST--S-SGRYQCELCKSTFCSDCDVFIHETLH  411 (421)
T ss_pred             cceeccCCCCCCCCCcccccc--c-ccceechhhhhhhhhhhHHHHHHHHh
Confidence            477777767664321111111  1 23588888888887776666666555


No 227
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=22.72  E-value=33  Score=14.88  Aligned_cols=7  Identities=43%  Similarity=1.312  Sum_probs=3.1

Q ss_pred             cchhhhh
Q psy12012         27 CDVCDRR   33 (79)
Q Consensus        27 c~~c~~~   33 (79)
                      |.+||+.
T Consensus         6 C~~CG~~   12 (59)
T PF09889_consen    6 CPVCGKP   12 (59)
T ss_pred             CCcCCCc
Confidence            4444433


No 228
>COG4847 Uncharacterized protein conserved in archaea [Function unknown]
Probab=22.63  E-value=21  Score=17.13  Aligned_cols=11  Identities=27%  Similarity=0.622  Sum_probs=8.0

Q ss_pred             Cccccchhhhh
Q psy12012         23 GLFVCDVCDRR   33 (79)
Q Consensus        23 ~~~~c~~c~~~   33 (79)
                      +.|.|.+|+..
T Consensus         5 kewkC~VCg~~   15 (103)
T COG4847           5 KEWKCYVCGGT   15 (103)
T ss_pred             ceeeEeeeCCE
Confidence            45788888755


No 229
>PF09943 DUF2175:  Uncharacterized protein conserved in archaea (DUF2175);  InterPro: IPR018686  This family of various hypothetical archaeal proteins has no known function. 
Probab=22.58  E-value=21  Score=17.32  Aligned_cols=10  Identities=20%  Similarity=0.833  Sum_probs=6.6

Q ss_pred             ccccchhhhh
Q psy12012         24 LFVCDVCDRR   33 (79)
Q Consensus        24 ~~~c~~c~~~   33 (79)
                      -|+|.+||+.
T Consensus         2 kWkC~iCg~~   11 (101)
T PF09943_consen    2 KWKCYICGKP   11 (101)
T ss_pred             ceEEEecCCe
Confidence            3677777654


No 230
>PF10122 Mu-like_Com:  Mu-like prophage protein Com;  InterPro: IPR019294  Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ]. 
Probab=22.37  E-value=26  Score=14.72  Aligned_cols=10  Identities=30%  Similarity=0.999  Sum_probs=6.6

Q ss_pred             CccCCCCCCc
Q psy12012         53 RYQCPQCPHR   62 (79)
Q Consensus        53 ~~~c~~c~~~   62 (79)
                      ..+|+.|+..
T Consensus        24 eIKCpRC~ti   33 (51)
T PF10122_consen   24 EIKCPRCKTI   33 (51)
T ss_pred             EEECCCCCcc
Confidence            4678877643


No 231
>PLN02748 tRNA dimethylallyltransferase
Probab=22.27  E-value=79  Score=19.87  Aligned_cols=23  Identities=17%  Similarity=0.475  Sum_probs=15.6

Q ss_pred             CCccCCCCCC-cccCcchHHHHHH
Q psy12012         52 PRYQCPQCPH-RTKQKSSLKTHMA   74 (79)
Q Consensus        52 ~~~~c~~c~~-~f~~~~~l~~h~~   74 (79)
                      +.|.|..|+. .+.-......|+.
T Consensus       417 ~~~~Ce~C~~~~~~G~~eW~~Hlk  440 (468)
T PLN02748        417 TQYVCEACGNKVLRGAHEWEQHKQ  440 (468)
T ss_pred             ccccccCCCCcccCCHHHHHHHhc
Confidence            4577999986 6766655666644


No 232
>COG5216 Uncharacterized conserved protein [Function unknown]
Probab=22.23  E-value=43  Score=14.56  Aligned_cols=11  Identities=45%  Similarity=1.174  Sum_probs=6.2

Q ss_pred             ccCCCCCCcccC
Q psy12012         54 YQCPQCPHRTKQ   65 (79)
Q Consensus        54 ~~c~~c~~~f~~   65 (79)
                      |.|+ ||..|.-
T Consensus        23 yPCP-CGDRFeI   33 (67)
T COG5216          23 YPCP-CGDRFEI   33 (67)
T ss_pred             ecCC-CCCEeEE
Confidence            4455 7766643


No 233
>PF01844 HNH:  HNH endonuclease;  InterPro: IPR002711 HNH endonuclease is found in bacteria and viruses [, , ]. This family includes pyocins, colicins and anaredoxins.; GO: 0003676 nucleic acid binding, 0004519 endonuclease activity; PDB: 2QGP_C.
Probab=22.19  E-value=13  Score=14.45  Aligned_cols=11  Identities=18%  Similarity=0.570  Sum_probs=3.5

Q ss_pred             cchhhhhhcch
Q psy12012         27 CDVCDRRYKYK   37 (79)
Q Consensus        27 c~~c~~~~~~~   37 (79)
                      |..|+..+...
T Consensus         1 C~~C~~~~~~~   11 (47)
T PF01844_consen    1 CQYCGKPGSDN   11 (47)
T ss_dssp             -TTT--B--GG
T ss_pred             CCCCCCcCccC
Confidence            56676665544


No 234
>smart00586 ZnF_DBF Zinc finger in DBF-like proteins.
Probab=22.10  E-value=82  Score=13.10  Aligned_cols=22  Identities=23%  Similarity=0.348  Sum_probs=13.7

Q ss_pred             CCccccchhhhhhcchhhHHhHhhh
Q psy12012         22 AGLFVCDVCDRRYKYKSGLYQHKKY   46 (79)
Q Consensus        22 ~~~~~c~~c~~~~~~~~~l~~h~~~   46 (79)
                      .||--|+.|...|..   |..|...
T Consensus         3 ~k~GYCE~Cr~kfd~---l~~Hi~s   24 (49)
T smart00586        3 KKPGYCENCREKYDD---LETHLLS   24 (49)
T ss_pred             CCCcccccHhHHHhh---HHHHhcc
Confidence            355568888777654   5666553


No 235
>PF10071 DUF2310:  Zn-ribbon-containing, possibly nucleic-acid-binding protein (DUF2310);  InterPro: IPR016908 This group represents uncharacterised conserved proteins.
Probab=21.61  E-value=39  Score=19.36  Aligned_cols=29  Identities=21%  Similarity=0.524  Sum_probs=18.8

Q ss_pred             ccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCC
Q psy12012         24 LFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCP   60 (79)
Q Consensus        24 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~   60 (79)
                      .-.|+.||+.+.....|.       + --.|+|..|.
T Consensus       220 ~r~CP~Cg~~W~L~~plh-------~-iFdFKCD~CR  248 (258)
T PF10071_consen  220 ARKCPSCGGDWRLKEPLH-------D-IFDFKCDPCR  248 (258)
T ss_pred             CCCCCCCCCccccCCchh-------h-ceeccCCcce
Confidence            346888888777666551       2 3457787774


No 236
>PTZ00409 Sir2 (Silent Information Regulator) protein; Provisional
Probab=21.36  E-value=1.1e+02  Score=17.61  Aligned_cols=21  Identities=10%  Similarity=0.126  Sum_probs=12.7

Q ss_pred             CCCCCCccccchhhhhhcchh
Q psy12012         18 EPNHAGLFVCDVCDRRYKYKS   38 (79)
Q Consensus        18 ~~~~~~~~~c~~c~~~~~~~~   38 (79)
                      .|..-....|..|+..+....
T Consensus       131 lHG~l~~~~C~~C~~~~~~~~  151 (271)
T PTZ00409        131 LHGSVFEARCCTCRKTIQLNK  151 (271)
T ss_pred             eccCcCcceeCCCCCCcccCH
Confidence            343344567888987765443


No 237
>PF10164 DUF2367:  Uncharacterized conserved protein (DUF2367);  InterPro: IPR019317  This is a highly conserved set of proteins which contains three pairs of cysteine residues within a length of 42 amino acids and is rich in proline residues towards the N terminus. It includes a membrane protein that has been found to be highly expressed in the mouse brain and consequently, several members have been assigned as brain protein i3 (Bri3). Their function is unknown.
Probab=21.32  E-value=62  Score=15.65  Aligned_cols=13  Identities=15%  Similarity=0.424  Sum_probs=8.9

Q ss_pred             CCCccCCCCCCcc
Q psy12012         51 EPRYQCPQCPHRT   63 (79)
Q Consensus        51 ~~~~~c~~c~~~f   63 (79)
                      .+..+|..|+..|
T Consensus        86 ~r~~rC~nCG~~f   98 (98)
T PF10164_consen   86 MRERRCSNCGATF   98 (98)
T ss_pred             cCccccCCCCccC
Confidence            3456788888665


No 238
>PF14354 Lar_restr_allev:  Restriction alleviation protein Lar
Probab=21.24  E-value=42  Score=14.05  Aligned_cols=12  Identities=25%  Similarity=0.473  Sum_probs=7.6

Q ss_pred             Cccccchhhhhh
Q psy12012         23 GLFVCDVCDRRY   34 (79)
Q Consensus        23 ~~~~c~~c~~~~   34 (79)
                      +...|+.||...
T Consensus         2 ~LkPCPFCG~~~   13 (61)
T PF14354_consen    2 ELKPCPFCGSAD   13 (61)
T ss_pred             CCcCCCCCCCcc
Confidence            345688887543


No 239
>TIGR03829 YokU_near_AblA uncharacterized protein, YokU family. Members of this protein family occur in various species of the genus Bacillus, always next to the gene (kamA or ablA) for lysine 2,3-aminomutase. Members have a pair of CXXC motifs, and share homology to the amino-terminal region of a family of putative transcription factors for which the C-terminal is modeled by pfam01381, a helix-turn-helix domain model. This family, however, is shorter and lacks the helix-turn-helix region. The function of this protein family is unknown, but a regulatory role in compatible solute biosynthesis is suggested by local genome context.
Probab=21.03  E-value=83  Score=14.95  Aligned_cols=16  Identities=19%  Similarity=0.656  Sum_probs=10.2

Q ss_pred             CCccCCCCCCcccCcc
Q psy12012         52 PRYQCPQCPHRTKQKS   67 (79)
Q Consensus        52 ~~~~c~~c~~~f~~~~   67 (79)
                      +-..|+.||..+....
T Consensus        34 Pa~~C~~CGe~y~~de   49 (89)
T TIGR03829        34 PSISCSHCGMEYQDDT   49 (89)
T ss_pred             CcccccCCCcEeecHH
Confidence            3466888887665543


No 240
>PF14375 Cys_rich_CWC:  Cysteine-rich CWC
Probab=20.96  E-value=61  Score=13.23  Aligned_cols=7  Identities=29%  Similarity=0.719  Sum_probs=2.8

Q ss_pred             CCCCCcc
Q psy12012         57 PQCPHRT   63 (79)
Q Consensus        57 ~~c~~~f   63 (79)
                      +.|+..|
T Consensus         2 P~Cg~~f    8 (50)
T PF14375_consen    2 PRCGAPF    8 (50)
T ss_pred             CCCCCcC
Confidence            3444433


No 241
>KOG3362|consensus
Probab=20.91  E-value=27  Score=18.17  Aligned_cols=21  Identities=33%  Similarity=0.645  Sum_probs=12.3

Q ss_pred             CccCCCCCCcccCcchHHHHH
Q psy12012         53 RYQCPQCPHRTKQKSSLKTHM   73 (79)
Q Consensus        53 ~~~c~~c~~~f~~~~~l~~h~   73 (79)
                      +|.|..||..+-....+..|.
T Consensus       129 ~ysC~~CG~kyCsv~C~~~Hn  149 (156)
T KOG3362|consen  129 KYSCVNCGTKYCSVRCLKTHN  149 (156)
T ss_pred             hhHHHhcCCceeechhhhhcc
Confidence            455666666666555665554


No 242
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]
Probab=20.74  E-value=87  Score=17.81  Aligned_cols=12  Identities=25%  Similarity=0.600  Sum_probs=9.0

Q ss_pred             CCCccCCCCCCc
Q psy12012         51 EPRYQCPQCPHR   62 (79)
Q Consensus        51 ~~~~~c~~c~~~   62 (79)
                      .....|+.||+-
T Consensus       219 d~iv~CP~CgRI  230 (239)
T COG1579         219 DEIVFCPYCGRI  230 (239)
T ss_pred             CCCccCCccchH
Confidence            456779999864


No 243
>PRK12496 hypothetical protein; Provisional
Probab=20.68  E-value=48  Score=17.43  Aligned_cols=12  Identities=25%  Similarity=0.631  Sum_probs=9.0

Q ss_pred             CccCCCCCCccc
Q psy12012         53 RYQCPQCPHRTK   64 (79)
Q Consensus        53 ~~~c~~c~~~f~   64 (79)
                      .+.|..|++.|.
T Consensus       127 ~~~C~gC~~~~~  138 (164)
T PRK12496        127 RKVCKGCKKKYP  138 (164)
T ss_pred             eEECCCCCcccc
Confidence            467888888775


No 244
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=20.29  E-value=89  Score=18.22  Aligned_cols=31  Identities=26%  Similarity=0.519  Sum_probs=17.2

Q ss_pred             cccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCCcccC
Q psy12012         25 FVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPHRTKQ   65 (79)
Q Consensus        25 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~   65 (79)
                      ..|+.|+.....+ .|.         ...+.|+.|+.-|..
T Consensus        27 ~~c~~c~~~~~~~-~l~---------~~~~vc~~c~~h~rl   57 (285)
T TIGR00515        27 TKCPKCGQVLYTK-ELE---------RNLEVCPKCDHHMRM   57 (285)
T ss_pred             eECCCCcchhhHH-HHH---------hhCCCCCCCCCcCcC
Confidence            3588887543222 121         234678888876554


No 245
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=20.24  E-value=14  Score=15.13  Aligned_cols=10  Identities=20%  Similarity=0.943  Sum_probs=4.7

Q ss_pred             ccCCCCCCcc
Q psy12012         54 YQCPQCPHRT   63 (79)
Q Consensus        54 ~~c~~c~~~f   63 (79)
                      |.|..|+..+
T Consensus        27 f~C~~C~~~l   36 (58)
T PF00412_consen   27 FKCSKCGKPL   36 (58)
T ss_dssp             SBETTTTCBT
T ss_pred             cccCCCCCcc
Confidence            4455554433


No 246
>PRK14138 NAD-dependent deacetylase; Provisional
Probab=20.23  E-value=1.2e+02  Score=17.01  Aligned_cols=40  Identities=20%  Similarity=0.444  Sum_probs=22.1

Q ss_pred             cCCCCCCccccchhhhhhcchhhHHhHhhhhhcCCCCccCCCCCC
Q psy12012         17 SEPNHAGLFVCDVCDRRYKYKSGLYQHKKYECGKEPRYQCPQCPH   61 (79)
Q Consensus        17 ~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   61 (79)
                      ..|..-....|..|++.+.....+.   ... . ...-.|+.|+.
T Consensus       112 elHG~~~~~~C~~C~~~~~~~~~~~---~~~-~-~~~p~Cp~Cgg  151 (244)
T PRK14138        112 ELHGNVEEYYCVRCGKRYTVEDVIE---KLE-K-SDVPRCDDCSG  151 (244)
T ss_pred             EccCCcCeeEECCCCCcccHHHHHH---HHh-c-CCCCCCCCCCC
Confidence            3444445567988988776543332   111 1 22346888873


Done!