Query         psy12014
Match_columns 78
No_of_seqs    108 out of 1309
Neff          11.6
Searched_HMMs 46136
Date          Fri Aug 16 16:28:18 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12014.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12014hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.9 5.5E-22 1.2E-26  103.6   4.2   70    7-77    177-246 (279)
  2 KOG2462|consensus               99.8 1.7E-20 3.7E-25   98.1   2.9   63    5-68    203-265 (279)
  3 KOG3623|consensus               99.7 6.3E-18 1.4E-22   98.0   2.1   64   13-77    890-953 (1007)
  4 KOG3576|consensus               99.6 1.9E-16 4.1E-21   80.5   1.1   67   10-77    110-176 (267)
  5 KOG3623|consensus               99.6 1.4E-15 3.1E-20   88.5   2.2   62    5-67    910-971 (1007)
  6 KOG1074|consensus               99.4 3.6E-14 7.8E-19   83.6  -0.3   68    3-71    619-693 (958)
  7 PHA02768 hypothetical protein;  99.3 8.4E-13 1.8E-17   54.6   1.9   44   17-63      5-48  (55)
  8 KOG3576|consensus               99.3 3.9E-13 8.5E-18   68.7   0.2   65    6-71    134-198 (267)
  9 KOG1074|consensus               99.2 3.9E-12 8.5E-17   75.3   0.8   57   17-74    353-409 (958)
 10 PHA00733 hypothetical protein   99.2 9.7E-11 2.1E-15   56.7   4.9   57   12-71     68-124 (128)
 11 PHA00616 hypothetical protein   99.1 3.1E-11 6.7E-16   47.8   1.6   32   46-77      1-32  (44)
 12 PF13465 zf-H2C2_2:  Zinc-finge  99.0 1.7E-10 3.7E-15   41.3   1.8   24   33-57      2-25  (26)
 13 PHA02768 hypothetical protein;  98.9   2E-09 4.2E-14   44.7   2.1   29   47-77      6-34  (55)
 14 PF13465 zf-H2C2_2:  Zinc-finge  98.9 1.2E-09 2.6E-14   39.1   1.1   24    5-28      2-25  (26)
 15 PHA00732 hypothetical protein   98.8 4.2E-09 9.2E-14   47.0   2.9   46   17-69      1-47  (79)
 16 KOG3608|consensus               98.8 8.2E-09 1.8E-13   57.0   3.7   31   47-77    264-295 (467)
 17 KOG3608|consensus               98.8   1E-08 2.2E-13   56.6   3.8   60   16-77    262-322 (467)
 18 PHA00616 hypothetical protein   98.7 1.4E-08   3E-13   40.3   1.8   34   17-51      1-34  (44)
 19 PHA00733 hypothetical protein   98.6 2.7E-08 5.9E-13   48.3   2.0   61   14-77     37-102 (128)
 20 KOG3993|consensus               98.6 3.6E-08 7.9E-13   55.5   2.0   57   15-71    293-381 (500)
 21 PF05605 zf-Di19:  Drought indu  98.5 4.5E-07 9.7E-12   37.8   4.4   52   17-71      2-54  (54)
 22 PLN03086 PRLI-interacting fact  98.5 2.1E-07 4.5E-12   54.5   4.0   58   16-77    477-544 (567)
 23 PLN03086 PRLI-interacting fact  98.5   3E-07 6.4E-12   53.9   4.2   59   13-77    449-507 (567)
 24 PF00096 zf-C2H2:  Zinc finger,  98.4   3E-07 6.6E-12   31.6   1.8   21   48-68      2-22  (23)
 25 PF00096 zf-C2H2:  Zinc finger,  98.4 2.9E-07 6.3E-12   31.7   1.7   23   18-40      1-23  (23)
 26 PF13912 zf-C2H2_6:  C2H2-type   98.2 7.5E-07 1.6E-11   31.8   1.5   23   47-69      2-24  (27)
 27 PF09237 GAGA:  GAGA factor;  I  98.2 2.7E-06 5.9E-11   34.6   2.6   32   44-75     22-53  (54)
 28 PF13894 zf-C2H2_4:  C2H2-type   98.2 2.3E-06   5E-11   29.4   2.0   23   47-69      1-23  (24)
 29 PF13912 zf-C2H2_6:  C2H2-type   98.1 3.2E-06 6.9E-11   30.1   2.1   25   17-41      1-25  (27)
 30 COG5189 SFP1 Putative transcri  98.0 2.5E-06 5.5E-11   46.9   0.9   53   15-67    347-419 (423)
 31 PF13894 zf-C2H2_4:  C2H2-type   97.9 1.2E-05 2.5E-10   27.5   1.9   23   18-40      1-23  (24)
 32 smart00355 ZnF_C2H2 zinc finge  97.8   3E-05 6.4E-10   26.9   2.2   22   48-69      2-23  (26)
 33 smart00355 ZnF_C2H2 zinc finge  97.7   5E-05 1.1E-09   26.2   2.0   24   18-41      1-24  (26)
 34 PF09237 GAGA:  GAGA factor;  I  97.6 0.00011 2.4E-09   30.0   2.5   35   11-46     18-52  (54)
 35 PF12756 zf-C2H2_2:  C2H2 type   97.6 9.1E-05   2E-09   34.1   2.6   24   46-69     50-73  (100)
 36 PHA00732 hypothetical protein   97.5 0.00012 2.6E-09   32.9   2.3   27   46-72      1-28  (79)
 37 PRK04860 hypothetical protein;  97.4 9.6E-05 2.1E-09   37.3   1.8   37   17-58    119-155 (160)
 38 PF13909 zf-H2C2_5:  C2H2-type   97.4  0.0002 4.4E-09   24.6   2.0   23   47-70      1-23  (24)
 39 PF12874 zf-met:  Zinc-finger o  97.4 0.00016 3.5E-09   25.1   1.7   20   19-38      2-21  (25)
 40 PF12874 zf-met:  Zinc-finger o  97.3 0.00019 4.2E-09   24.9   1.6   23   47-69      1-23  (25)
 41 KOG3993|consensus               97.3 4.7E-05   1E-09   43.5  -0.2   53   17-70    267-319 (500)
 42 PRK04860 hypothetical protein;  96.8 0.00076 1.6E-08   34.2   1.6   28   46-77    119-146 (160)
 43 PF12171 zf-C2H2_jaz:  Zinc-fin  96.7  0.0011 2.4E-08   23.5   1.0   21   47-67      2-22  (27)
 44 PF13913 zf-C2HC_2:  zinc-finge  96.4  0.0042 9.1E-08   21.7   1.9   19   48-67      4-22  (25)
 45 KOG2893|consensus               96.3  0.0012 2.5E-08   35.5   0.4   44   16-65     10-53  (341)
 46 smart00451 ZnF_U1 U1-like zinc  96.1  0.0077 1.7E-07   22.4   2.0   22   17-38      3-24  (35)
 47 COG5048 FOG: Zn-finger [Genera  96.1  0.0011 2.3E-08   37.5  -0.7   61   16-77    288-354 (467)
 48 PF12756 zf-C2H2_2:  C2H2 type   95.0   0.034 7.4E-07   25.4   2.4   27   16-42     49-75  (100)
 49 cd00350 rubredoxin_like Rubred  94.8   0.019 4.2E-07   21.3   1.1   24   18-54      2-25  (33)
 50 KOG2186|consensus               94.2    0.04 8.7E-07   30.0   1.8   49   18-70      4-52  (276)
 51 cd00729 rubredoxin_SM Rubredox  93.6   0.081 1.8E-06   19.8   1.7   25   17-54      2-26  (34)
 52 COG4049 Uncharacterized protei  93.2   0.074 1.6E-06   22.3   1.4   30   10-39     10-39  (65)
 53 COG1592 Rubrerythrin [Energy p  92.6    0.11 2.3E-06   26.7   1.8   24   17-54    134-157 (166)
 54 PF05443 ROS_MUCR:  ROS/MUCR tr  92.0    0.11 2.3E-06   25.8   1.3   25   47-74     73-97  (132)
 55 KOG1146|consensus               91.7    0.23 5.1E-06   33.1   2.7   57   12-68    460-540 (1406)
 56 PF09986 DUF2225:  Uncharacteri  90.1   0.038 8.1E-07   29.4  -1.4   45   15-59      3-61  (214)
 57 PF04959 ARS2:  Arsenite-resist  89.6     0.3 6.5E-06   26.2   1.7   26   14-39     74-99  (214)
 58 smart00659 RPOLCX RNA polymera  88.8    0.35 7.5E-06   19.3   1.3   27   17-55      2-28  (44)
 59 PF13719 zinc_ribbon_5:  zinc-r  88.6    0.48   1E-05   18.0   1.6   34   18-57      3-36  (37)
 60 PF13717 zinc_ribbon_4:  zinc-r  88.5    0.44 9.5E-06   18.0   1.4   33   18-56      3-35  (36)
 61 COG3357 Predicted transcriptio  88.1    0.22 4.7E-06   23.0   0.5   13   16-28     57-69  (97)
 62 PF09538 FYDLN_acid:  Protein o  87.6    0.52 1.1E-05   22.6   1.6   30   18-59     10-39  (108)
 63 TIGR00373 conserved hypothetic  87.6    0.71 1.5E-05   23.6   2.2   36   12-57    104-139 (158)
 64 COG5189 SFP1 Putative transcri  87.1    0.13 2.9E-06   29.2  -0.6   25   12-36    393-417 (423)
 65 KOG4167|consensus               86.8    0.13 2.8E-06   32.3  -0.7   24   47-70    793-816 (907)
 66 PRK06266 transcription initiat  86.4    0.86 1.9E-05   23.8   2.2   35   13-57    113-147 (178)
 67 PF04959 ARS2:  Arsenite-resist  86.2    0.42   9E-06   25.7   1.0   27   47-73     78-104 (214)
 68 KOG3408|consensus               85.9    0.91   2E-05   22.2   2.0   28   13-40     53-80  (129)
 69 PF12013 DUF3505:  Protein of u  85.7    0.89 1.9E-05   21.5   1.9   25   47-71     81-109 (109)
 70 COG4957 Predicted transcriptio  85.7     0.5 1.1E-05   23.6   1.0   25   47-74     77-101 (148)
 71 smart00734 ZnF_Rad18 Rad18-lik  85.2     1.2 2.5E-05   15.6   1.7   19   48-67      3-21  (26)
 72 PF13451 zf-trcl:  Probable zin  84.9    0.57 1.2E-05   19.2   0.9   39   15-53      2-40  (49)
 73 COG2888 Predicted Zn-ribbon RN  84.6     1.2 2.7E-05   19.0   1.8   33   16-54     26-58  (61)
 74 TIGR02098 MJ0042_CXXC MJ0042 f  84.2    0.96 2.1E-05   17.0   1.4   34   18-57      3-36  (38)
 75 KOG4167|consensus               83.9    0.26 5.6E-06   31.1  -0.4   25   18-42    793-817 (907)
 76 PF03604 DNA_RNApol_7kD:  DNA d  83.7    0.57 1.2E-05   17.3   0.6   26   18-55      1-26  (32)
 77 PRK00398 rpoP DNA-directed RNA  83.4     1.2 2.6E-05   17.6   1.6   30   17-57      3-32  (46)
 78 smart00531 TFIIE Transcription  83.3     1.6 3.4E-05   22.0   2.3   40   13-57     95-134 (147)
 79 COG1997 RPL43A Ribosomal prote  82.4    0.58 1.3E-05   21.5   0.5   33   16-59     34-66  (89)
 80 smart00614 ZnF_BED BED zinc fi  81.6     1.6 3.5E-05   17.6   1.7   20   48-67     20-44  (50)
 81 KOG2593|consensus               81.4    0.65 1.4E-05   27.5   0.5   41   10-54    121-161 (436)
 82 PF13878 zf-C2H2_3:  zinc-finge  80.2       2 4.2E-05   16.8   1.6   24   18-41     14-39  (41)
 83 PF10571 UPF0547:  Uncharacteri  79.8     1.1 2.3E-05   15.7   0.7   11   47-57     15-25  (26)
 84 COG4391 Uncharacterized protei  79.1     1.1 2.4E-05   19.2   0.8   46    8-58     15-60  (62)
 85 COG5048 FOG: Zn-finger [Genera  78.8     1.8   4E-05   24.7   1.8   56   15-71     31-88  (467)
 86 PF10013 DUF2256:  Uncharacteri  77.5     1.1 2.4E-05   17.7   0.5   12   48-59     10-21  (42)
 87 PHA00626 hypothetical protein   75.7       2 4.4E-05   18.1   1.1   17   15-31     21-37  (59)
 88 PF07975 C1_4:  TFIIH C1-like d  74.5    0.77 1.7E-05   19.0  -0.3   26   15-40     19-44  (51)
 89 PF12907 zf-met2:  Zinc-binding  73.7     0.7 1.5E-05   18.1  -0.5    9   19-27      3-11  (40)
 90 PF02892 zf-BED:  BED zinc fing  73.6     4.8  0.0001   15.6   1.9   20   47-66     17-40  (45)
 91 COG1996 RPC10 DNA-directed RNA  73.4     2.3 4.9E-05   17.4   0.9   29   15-54      4-32  (49)
 92 TIGR02300 FYDLN_acid conserved  73.0     3.3 7.2E-05   20.5   1.6   30   18-59     10-39  (129)
 93 PF05191 ADK_lid:  Adenylate ki  72.7     2.2 4.8E-05   16.2   0.8   31   18-57      2-32  (36)
 94 COG2331 Uncharacterized protei  72.7     2.4 5.2E-05   19.1   1.0   31   18-56     13-43  (82)
 95 PF07754 DUF1610:  Domain of un  71.9     1.9 4.1E-05   14.9   0.5    8   46-53     16-23  (24)
 96 PRK14890 putative Zn-ribbon RN  71.8     3.1 6.8E-05   17.7   1.2   33   16-54     24-56  (59)
 97 KOG1146|consensus               71.6     2.8 6.1E-05   28.6   1.5   56   15-71   1282-1353(1406)
 98 PRK03824 hypA hydrogenase nick  71.5     1.6 3.6E-05   21.7   0.4   15   16-30     69-83  (135)
 99 PLN02294 cytochrome c oxidase   71.0     2.5 5.4E-05   22.0   1.0   15   15-29    139-153 (174)
100 KOG4173|consensus               69.0       4 8.6E-05   22.1   1.4   49   19-68    108-168 (253)
101 cd00924 Cyt_c_Oxidase_Vb Cytoc  68.8     3.1 6.7E-05   19.6   0.9   14   16-29     78-91  (97)
102 KOG2785|consensus               66.7      11 0.00024   22.4   2.9   52   17-68    166-242 (390)
103 PF09723 Zn-ribbon_8:  Zinc rib  66.0     2.9 6.2E-05   16.3   0.5   30   17-54      5-34  (42)
104 smart00834 CxxC_CXXC_SSSS Puta  65.7     3.1 6.7E-05   15.7   0.5   30   17-54      5-34  (41)
105 PF15269 zf-C2H2_7:  Zinc-finge  65.4     5.6 0.00012   16.0   1.2   23   47-69     21-43  (54)
106 PF09845 DUF2072:  Zn-ribbon co  64.8     3.7   8E-05   20.5   0.8   14   46-59      1-14  (131)
107 PF02891 zf-MIZ:  MIZ/SP-RING z  64.3     5.5 0.00012   16.2   1.2   30   19-54     20-49  (50)
108 PF07295 DUF1451:  Protein of u  63.4     3.7 8.1E-05   20.8   0.7   28   17-55    112-139 (146)
109 COG5112 UFD2 U1-like Zn-finger  63.4     6.7 0.00014   18.9   1.5   26   14-39     52-77  (126)
110 PF08790 zf-LYAR:  LYAR-type C2  62.5     1.9 4.1E-05   15.5  -0.3    8   20-27      3-10  (28)
111 PF01155 HypA:  Hydrogenase exp  62.3     5.6 0.00012   19.1   1.2   25   18-55     71-95  (113)
112 smart00154 ZnF_AN1 AN1-like Zi  61.4     4.6 9.9E-05   15.5   0.7   14   46-59     12-25  (39)
113 TIGR00622 ssl1 transcription f  61.4     6.8 0.00015   19.0   1.3   49   19-70     57-105 (112)
114 PF04423 Rad50_zn_hook:  Rad50   61.0     3.5 7.6E-05   16.9   0.3   12   48-59     22-33  (54)
115 KOG2636|consensus               60.6     7.3 0.00016   23.7   1.6   29   10-38    394-423 (497)
116 KOG2071|consensus               60.1     7.6 0.00017   24.3   1.6   27   44-70    416-442 (579)
117 TIGR02605 CxxC_CxxC_SSSS putat  59.1     4.5 9.8E-05   16.3   0.5   30   17-54      5-34  (52)
118 PF01428 zf-AN1:  AN1-like Zinc  58.6     3.3 7.1E-05   16.2   0.0   15   45-59     12-26  (43)
119 KOG0717|consensus               56.0     7.2 0.00016   23.8   1.1   22   47-68    293-314 (508)
120 COG3364 Zn-ribbon containing p  55.0     6.3 0.00014   18.8   0.6   15   16-30      1-15  (112)
121 PTZ00043 cytochrome c oxidase   53.8       7 0.00015   21.5   0.8   18   14-31    178-195 (268)
122 COG1773 Rubredoxin [Energy pro  53.1     6.9 0.00015   16.5   0.5   14   17-30      3-16  (55)
123 PF01215 COX5B:  Cytochrome c o  52.1       6 0.00013   19.9   0.3   15   15-29    110-124 (136)
124 PRK05452 anaerobic nitric oxid  51.3      12 0.00026   22.8   1.5   40   14-54    422-466 (479)
125 COG3091 SprT Zn-dependent meta  51.0     8.3 0.00018   19.9   0.7   34   15-54    115-148 (156)
126 COG3677 Transposase and inacti  50.9     7.7 0.00017   19.2   0.6   17   14-30     50-66  (129)
127 KOG2231|consensus               50.9      23 0.00049   22.9   2.6   47   19-70    184-236 (669)
128 TIGR00100 hypA hydrogenase nic  48.3     7.5 0.00016   18.8   0.3   25   17-54     70-94  (115)
129 PRK14873 primosome assembly pr  48.1      18 0.00039   23.2   1.9   10   45-54    421-430 (665)
130 KOG1280|consensus               48.0      25 0.00054   20.8   2.3   39   15-53     77-116 (381)
131 PF04780 DUF629:  Protein of un  47.5      22 0.00047   21.9   2.1   25   18-42     58-83  (466)
132 PRK00464 nrdR transcriptional   47.1     8.5 0.00018   19.8   0.4   14   47-60     29-42  (154)
133 PRK12380 hydrogenase nickel in  46.6      10 0.00022   18.3   0.6   25   17-54     70-94  (113)
134 PF01927 Mut7-C:  Mut7-C RNAse   46.5      18 0.00038   18.3   1.5   46   18-63     92-141 (147)
135 COG1571 Predicted DNA-binding   45.7      12 0.00025   22.6   0.9   29   19-59    352-380 (421)
136 PF06397 Desulfoferrod_N:  Desu  44.7      12 0.00026   14.3   0.6   12   16-27      5-16  (36)
137 COG1198 PriA Primosomal protei  44.2     6.6 0.00014   25.3  -0.2   12   44-55    473-484 (730)
138 KOG2482|consensus               44.0      15 0.00034   21.6   1.2   23   17-39    195-217 (423)
139 PRK03681 hypA hydrogenase nick  43.2      12 0.00027   18.0   0.7   12   17-28     70-81  (114)
140 cd00730 rubredoxin Rubredoxin;  42.7      13 0.00028   15.2   0.6   11   47-57      2-12  (50)
141 PRK04351 hypothetical protein;  42.5      18 0.00039   18.5   1.2   31   18-57    113-143 (149)
142 PRK00564 hypA hydrogenase nick  41.4      14  0.0003   17.9   0.7   13   17-29     71-83  (117)
143 PF10537 WAC_Acf1_DNA_bd:  ATP-  41.3      43 0.00094   16.0   2.6   37   16-54      2-38  (102)
144 PF02176 zf-TRAF:  TRAF-type zi  41.3      10 0.00022   15.6   0.2   40   16-57      8-53  (60)
145 PF11931 DUF3449:  Domain of un  41.1     8.9 0.00019   20.6   0.0   25   12-36     96-121 (196)
146 PF07282 OrfB_Zn_ribbon:  Putat  40.7      27 0.00059   14.8   1.5   16   44-59     44-59  (69)
147 PF14353 CpXC:  CpXC protein     40.4     8.7 0.00019   18.7  -0.1   18   45-62     37-54  (128)
148 COG5236 Uncharacterized conser  40.1      35 0.00075   20.4   2.1   21   19-39    222-242 (493)
149 PF08274 PhnA_Zn_Ribbon:  PhnA   39.6      14  0.0003   13.4   0.4    8   47-54     20-27  (30)
150 PF02146 SIR2:  Sir2 family;  I  39.6      43 0.00093   17.3   2.3   39   12-55    100-138 (178)
151 COG1655 Uncharacterized protei  39.5     5.1 0.00011   22.1  -1.0   25   15-39     17-41  (267)
152 TIGR00627 tfb4 transcription f  39.4      30 0.00066   19.7   1.8    7   47-53    256-262 (279)
153 PF02591 DUF164:  Putative zinc  38.9      33 0.00072   14.1   1.6    8   47-54     47-54  (56)
154 COG4338 Uncharacterized protei  38.6     8.8 0.00019   15.7  -0.2   12   48-59     14-25  (54)
155 PF09963 DUF2197:  Uncharacteri  38.3     6.8 0.00015   16.6  -0.6   34   19-54      4-39  (56)
156 PF06220 zf-U1:  U1 zinc finger  38.2      30 0.00065   13.2   1.7   10   18-27      4-13  (38)
157 TIGR00595 priA primosomal prot  38.1      35 0.00075   21.1   2.1   10   45-54    252-261 (505)
158 PF06524 NOA36:  NOA36 protein;  36.1     9.5 0.00021   21.5  -0.4   26   44-69    207-232 (314)
159 PTZ00448 hypothetical protein;  35.9      34 0.00074   20.4   1.7   23   17-39    314-336 (373)
160 COG5188 PRP9 Splicing factor 3  35.9      33 0.00071   20.5   1.6   26   11-36    368-394 (470)
161 smart00731 SprT SprT homologue  35.5      18 0.00038   18.2   0.5   11   17-27    112-122 (146)
162 PF10263 SprT-like:  SprT-like   34.2      11 0.00025   18.8  -0.2   30   18-56    124-153 (157)
163 PF01286 XPA_N:  XPA protein N-  34.2      20 0.00043   13.5   0.5   11   19-29      5-15  (34)
164 KOG0978|consensus               33.9      11 0.00023   24.3  -0.5   15   19-33    680-694 (698)
165 TIGR00416 sms DNA repair prote  33.8      30 0.00065   21.1   1.4   11   17-27      7-17  (454)
166 PF00301 Rubredoxin:  Rubredoxi  33.7      18 0.00038   14.6   0.3   13   18-30      2-14  (47)
167 TIGR00319 desulf_FeS4 desulfof  33.1      23 0.00049   12.9   0.6   12   16-27      6-17  (34)
168 PF03811 Zn_Tnp_IS1:  InsA N-te  33.0      26 0.00056   13.2   0.7   12   12-23     24-35  (36)
169 cd00974 DSRD Desulforedoxin (D  32.7      23  0.0005   12.9   0.6   11   17-27      4-14  (34)
170 PF02748 PyrI_C:  Aspartate car  32.5      23 0.00049   14.6   0.5   15   14-28     32-46  (52)
171 PRK11823 DNA repair protein Ra  32.2      36 0.00079   20.7   1.5   11   17-27      7-17  (446)
172 PF12230 PRP21_like_P:  Pre-mRN  32.1      15 0.00033   19.9   0.0   26   16-42    167-192 (229)
173 KOG1842|consensus               31.8      30 0.00064   21.3   1.1   24   16-39     14-37  (505)
174 COG5151 SSL1 RNA polymerase II  31.5      48   0.001   19.5   1.8   25   46-70    388-412 (421)
175 KOG1994|consensus               31.0      32 0.00069   19.2   1.0   23   15-37    237-259 (268)
176 PF10276 zf-CHCC:  Zinc-finger   30.7      15 0.00033   14.3  -0.1    9   47-55     30-38  (40)
177 PF10083 DUF2321:  Uncharacteri  30.5      22 0.00048   18.4   0.4   18   15-32     66-83  (158)
178 COG5539 Predicted cysteine pro  30.5      48   0.001   19.2   1.7   27   12-38    270-296 (306)
179 PLN02748 tRNA dimethylallyltra  29.7      52  0.0011   20.4   1.8   24   16-39    417-441 (468)
180 PRK05978 hypothetical protein;  29.1      34 0.00074   17.6   0.9   11   47-57     53-63  (148)
181 COG1326 Uncharacterized archae  28.9      78  0.0017   17.2   2.2   12   45-56     29-40  (201)
182 TIGR01206 lysW lysine biosynth  28.8      30 0.00066   14.4   0.6   12   47-58      3-14  (54)
183 PF04810 zf-Sec23_Sec24:  Sec23  28.8      35 0.00075   13.0   0.8   14   13-26     20-33  (40)
184 KOG3507|consensus               28.5      26 0.00056   15.0   0.4   27   18-56     21-47  (62)
185 KOG0801|consensus               28.1      15 0.00033   19.2  -0.4   11   47-57    139-149 (205)
186 COG1579 Zn-ribbon protein, pos  27.9      58  0.0013   18.2   1.7   34   18-56    198-231 (239)
187 COG1675 TFA1 Transcription ini  27.8      70  0.0015   17.0   1.9   35   12-56    108-142 (176)
188 PF14690 zf-ISL3:  zinc-finger   27.5      36 0.00078   13.1   0.7    9   46-54      2-10  (47)
189 PRK08222 hydrogenase 4 subunit  27.5      47   0.001   17.5   1.3   19   16-34    113-131 (181)
190 PRK14138 NAD-dependent deacety  27.3 1.1E+02  0.0023   17.0   2.7   39   11-54    113-151 (244)
191 KOG0227|consensus               27.0      39 0.00084   18.3   0.9   19   47-65     54-72  (222)
192 COG1379 PHP family phosphoeste  26.9      25 0.00053   20.8   0.2   11   47-57    266-276 (403)
193 PF06676 DUF1178:  Protein of u  26.6   1E+02  0.0023   15.9   2.6   24   26-54     17-40  (148)
194 PLN03238 probable histone acet  26.6 1.2E+02  0.0026   17.6   2.8   23   16-38     47-69  (290)
195 COG0675 Transposase and inacti  26.2      43 0.00093   18.8   1.1   15   45-59    321-335 (364)
196 PF13821 DUF4187:  Domain of un  25.4      41 0.00088   14.1   0.7   20   16-35     26-45  (55)
197 KOG2807|consensus               24.9      82  0.0018   18.7   2.0   22   45-66    289-310 (378)
198 cd01121 Sms Sms (bacterial rad  24.7      49  0.0011   19.7   1.2    8   18-25     15-22  (372)
199 KOG3352|consensus               24.6      45 0.00098   17.3   0.9   14   45-58    132-145 (153)
200 TIGR03831 YgiT_finger YgiT-typ  24.6      39 0.00086   12.8   0.6   11   47-57     33-43  (46)
201 PRK12387 formate hydrogenlyase  24.4      52  0.0011   17.2   1.1   18   16-33    113-130 (180)
202 KOG4727|consensus               24.4      54  0.0012   17.5   1.1   22   17-38     75-96  (193)
203 PRK05580 primosome assembly pr  24.4      18 0.00039   23.2  -0.6   12   44-55    419-430 (679)
204 PLN02925 4-hydroxy-3-methylbut  23.6   1E+02  0.0022   20.5   2.3   26   47-72    635-660 (733)
205 PRK01343 zinc-binding protein;  23.5      56  0.0012   13.9   0.9   11   47-57     10-20  (57)
206 PF09943 DUF2175:  Uncharacteri  23.4      30 0.00065   16.6   0.2   11   17-27      2-12  (101)
207 KOG3014|consensus               23.4      65  0.0014   18.3   1.4   31   12-42     29-64  (257)
208 TIGR00244 transcriptional regu  23.0      40 0.00087   17.3   0.6   13   47-59     29-41  (147)
209 COG0846 SIR2 NAD-dependent pro  22.9      74  0.0016   17.9   1.6   39   11-54    116-154 (250)
210 PF14447 Prok-RING_4:  Prokaryo  22.5      50  0.0011   14.0   0.7   12   48-59     41-52  (55)
211 PF01194 RNA_pol_N:  RNA polyme  22.2      63  0.0014   13.9   1.0   14   46-59      4-17  (60)
212 PF08792 A2L_zn_ribbon:  A2L zi  22.2      43 0.00092   12.4   0.4   10   47-56     22-31  (33)
213 PF01363 FYVE:  FYVE zinc finge  22.1      43 0.00092   14.2   0.5   15   15-29     23-37  (69)
214 KOG4124|consensus               21.9      14  0.0003   21.9  -1.3   21   44-64    396-416 (442)
215 PF08271 TF_Zn_Ribbon:  TFIIB z  21.8      49  0.0011   12.7   0.6    7   48-54      2-8   (43)
216 PF01096 TFIIS_C:  Transcriptio  21.8      37  0.0008   12.9   0.2    9   47-55     29-37  (39)
217 smart00440 ZnF_C2C2 C2C2 Zinc   21.7      46 0.00099   12.8   0.5   10   47-56     29-38  (40)
218 PF03107 C1_2:  C1 domain;  Int  21.7      44 0.00095   11.8   0.4    7   47-53     16-22  (30)
219 PF01780 Ribosomal_L37ae:  Ribo  21.6      37 0.00079   15.9   0.2   30   17-57     35-64  (90)
220 PRK06260 threonine synthase; V  21.4      73  0.0016   19.0   1.5   10   18-27      4-13  (397)
221 PF11789 zf-Nse:  Zinc-finger o  21.3      44 0.00094   14.0   0.4   19   44-62     22-40  (57)
222 PF08252 Leader_CPA1:  arg-2/CP  21.1      59  0.0013   11.0   1.3   11   26-36      7-17  (24)
223 PF12773 DZR:  Double zinc ribb  20.8      64  0.0014   12.6   0.9   11   46-56     29-39  (50)
224 PF09855 DUF2082:  Nucleic-acid  20.7      52  0.0011   14.3   0.6    7   47-53      1-7   (64)
225 PLN03239 histone acetyltransfe  20.6 1.1E+02  0.0024   18.3   2.0   24   15-38    104-127 (351)
226 COG1656 Uncharacterized conser  20.6 1.1E+02  0.0025   16.1   1.9   19   47-65    131-149 (165)
227 PF14787 zf-CCHC_5:  GAG-polypr  20.6      58  0.0013   12.4   0.7   13   48-60      4-16  (36)
228 KOG1818|consensus               20.6      27 0.00057   22.4  -0.4   37   16-52    180-217 (634)
229 TIGR00280 L37a ribosomal prote  20.5      47   0.001   15.6   0.5   12   17-28     53-64  (91)
230 PRK12722 transcriptional activ  20.5      85  0.0018   16.9   1.4   28   18-54    135-162 (187)
231 PRK12860 transcriptional activ  20.5      85  0.0018   17.0   1.4   27   18-53    135-161 (189)
232 PF14311 DUF4379:  Domain of un  20.3      60  0.0013   13.2   0.7   13   47-59     29-41  (55)
233 CHL00174 accD acetyl-CoA carbo  20.3      85  0.0018   18.3   1.5   31   19-59     40-70  (296)

No 1  
>KOG2462|consensus
Probab=99.86  E-value=5.5e-22  Score=103.63  Aligned_cols=70  Identities=19%  Similarity=0.340  Sum_probs=59.6

Q ss_pred             hhhhhccCCCceecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcccccChhHHHHHHhhhhcCccccC
Q psy12014          7 LIDSLYKGGGLFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSYRAKQKIHLTTHMAIRHHKKLGKI   77 (78)
Q Consensus         7 ~~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~g~k~~~~   77 (78)
                      +.+.+-+..-++.|.+||+.|...=.|+.|++.|+| +|||.|..|+++|...++|..|++||.+.|.|+|
T Consensus       177 LkMHirTH~l~c~C~iCGKaFSRPWLLQGHiRTHTG-EKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC  246 (279)
T KOG2462|consen  177 LKMHIRTHTLPCECGICGKAFSRPWLLQGHIRTHTG-EKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQC  246 (279)
T ss_pred             HhhHhhccCCCcccccccccccchHHhhcccccccC-CCCccCCcccchhcchHHHHHHHHhhcCCccccC
Confidence            333444444788999999999988889999999999 8899999999999999999999999999999887


No 2  
>KOG2462|consensus
Probab=99.81  E-value=1.7e-20  Score=98.13  Aligned_cols=63  Identities=22%  Similarity=0.371  Sum_probs=58.7

Q ss_pred             hhhhhhhccCCCceecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcccccChhHHHHHHhh
Q psy12014          5 PKLIDSLYKGGGLFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSYRAKQKIHLTTHMAI   68 (78)
Q Consensus         5 ~~~~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~~~~l~~h~~~   68 (78)
                      ++.+.|+|||||||.|..|+++|..+++|..|+.+|.+ .++|+|..|+++|...+.|+.|...
T Consensus       203 LQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~-~K~~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  203 LQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSD-VKKHQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             hhcccccccCCCCccCCcccchhcchHHHHHHHHhhcC-CccccCcchhhHHHHHHHHHHhhhh
Confidence            45667999999999999999999999999999999999 8889999999999999999999653


No 3  
>KOG3623|consensus
Probab=99.70  E-value=6.3e-18  Score=97.99  Aligned_cols=64  Identities=31%  Similarity=0.658  Sum_probs=59.6

Q ss_pred             cCCCceecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcccccChhHHHHHHhhhhcCccccC
Q psy12014         13 KGGGLFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSYRAKQKIHLTTHMAIRHHKKLGKI   77 (78)
Q Consensus        13 ~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~g~k~~~~   77 (78)
                      +.+..|.|+.|+++|...+.|.+|...|+| ++||+|.+|.++|...-.|..|.|+|+|||||.|
T Consensus       890 te~gmyaCDqCDK~FqKqSSLaRHKYEHsG-qRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQC  953 (1007)
T KOG3623|consen  890 TEDGMYACDQCDKAFQKQSSLARHKYEHSG-QRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQC  953 (1007)
T ss_pred             CccccchHHHHHHHHHhhHHHHHhhhhhcC-CCCcccchhhHhhhhhhhhhhhhhhccCCCcchh
Confidence            446789999999999999999999999999 8899999999999999999999999999999987


No 4  
>KOG3576|consensus
Probab=99.60  E-value=1.9e-16  Score=80.53  Aligned_cols=67  Identities=16%  Similarity=0.309  Sum_probs=60.1

Q ss_pred             hhccCCCceecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcccccChhHHHHHHhhhhcCccccC
Q psy12014         10 SLYKGGGLFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSYRAKQKIHLTTHMAIRHHKKLGKI   77 (78)
Q Consensus        10 ~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~g~k~~~~   77 (78)
                      ....+...|.|.+|++.|.....|.+|+..|.. .+.+-|..||+.|...-.|..|.++|+|.+||||
T Consensus       110 gsssd~d~ftCrvCgK~F~lQRmlnrh~kch~~-vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc  176 (267)
T KOG3576|consen  110 GSSSDQDSFTCRVCGKKFGLQRMLNRHLKCHSD-VKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKC  176 (267)
T ss_pred             cCCCCCCeeeeehhhhhhhHHHHHHHHhhhccH-HHHHHHhhccCcccchhhhhhhhccccCccccch
Confidence            334556779999999999999999999999998 7778999999999999999999999999999998


No 5  
>KOG3623|consensus
Probab=99.56  E-value=1.4e-15  Score=88.55  Aligned_cols=62  Identities=23%  Similarity=0.434  Sum_probs=56.5

Q ss_pred             hhhhhhhccCCCceecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcccccChhHHHHHHh
Q psy12014          5 PKLIDSLYKGGGLFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSYRAKQKIHLTTHMA   67 (78)
Q Consensus         5 ~~~~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~~~~l~~h~~   67 (78)
                      +.+|.=-|+|.+||.|.+|.++|..+..|..|++.|.| +|||+|..|++.|+.+.++..|+.
T Consensus       910 LaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSG-EKPfQCdKClKRFSHSGSYSQHMN  971 (1007)
T KOG3623|consen  910 LARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSG-EKPFQCDKCLKRFSHSGSYSQHMN  971 (1007)
T ss_pred             HHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccC-CCcchhhhhhhhcccccchHhhhc
Confidence            34455569999999999999999999999999999999 999999999999999999988875


No 6  
>KOG1074|consensus
Probab=99.39  E-value=3.6e-14  Score=83.56  Aligned_cols=68  Identities=22%  Similarity=0.532  Sum_probs=55.2

Q ss_pred             CchhhhhhhccCCCceecCCchhhcCCHHHHHHHhhcccCCCCC----cccC---CCcccccChhHHHHHHhhhhc
Q psy12014          3 TTPKLIDSLYKGGGLFSCSDCSRVYKKKASLTRHQTYECGQQPK----YRCP---LCSYRAKQKIHLTTHMAIRHH   71 (78)
Q Consensus         3 ~~~~~~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~----~~c~---~c~~~f~~~~~l~~h~~~~~g   71 (78)
                      +.++.|.++|+||+||+|++|+++|..+.+|+.|+.+|.. ..|    +.|+   +|-+.|...-.|..|+++|.|
T Consensus       619 saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka-~p~~R~q~ScP~~~ic~~kftn~V~lpQhIriH~~  693 (958)
T KOG1074|consen  619 SALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKA-KPPARVQFSCPSTFICQKKFTNAVTLPQHIRIHLG  693 (958)
T ss_pred             hhhhhhhhcccCcCccccccccchhccccchhhccccccc-CccccccccCCchhhhcccccccccccceEEeecC
Confidence            3567788889999999999999999999999999888876 433    5677   787888888888888888874


No 7  
>PHA02768 hypothetical protein; Provisional
Probab=99.33  E-value=8.4e-13  Score=54.61  Aligned_cols=44  Identities=16%  Similarity=0.329  Sum_probs=38.9

Q ss_pred             ceecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcccccChhHHH
Q psy12014         17 LFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSYRAKQKIHLT   63 (78)
Q Consensus        17 ~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~~~~l~   63 (78)
                      -|.|+.||+.|...+.|..|++.|+   ++++|..|++.|...+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~---k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN---TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC---CcccCCcccceecccceeE
Confidence            3789999999999999999999998   3689999999999777654


No 8  
>KOG3576|consensus
Probab=99.30  E-value=3.9e-13  Score=68.67  Aligned_cols=65  Identities=22%  Similarity=0.373  Sum_probs=56.2

Q ss_pred             hhhhhhccCCCceecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcccccChhHHHHHHhhhhc
Q psy12014          6 KLIDSLYKGGGLFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSYRAKQKIHLTTHMAIRHH   71 (78)
Q Consensus         6 ~~~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~g   71 (78)
                      ..+..-|...+.+.|.-||+.|-..-+|.+|++.|++ .+||+|..|+++|.+..+|..|.+.-+|
T Consensus       134 nrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtg-vrpykc~~c~kaftqrcsleshl~kvhg  198 (267)
T KOG3576|consen  134 NRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTG-VRPYKCSLCEKAFTQRCSLESHLKKVHG  198 (267)
T ss_pred             HHHhhhccHHHHHHHhhccCcccchhhhhhhhccccC-ccccchhhhhHHHHhhccHHHHHHHHcC
Confidence            3445557777889999999999999999999999999 9999999999999999999999876554


No 9  
>KOG1074|consensus
Probab=99.19  E-value=3.9e-12  Score=75.30  Aligned_cols=57  Identities=23%  Similarity=0.482  Sum_probs=52.7

Q ss_pred             ceecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcccccChhHHHHHHhhhhcCcc
Q psy12014         17 LFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSYRAKQKIHLTTHMAIRHHKKL   74 (78)
Q Consensus        17 ~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~g~k~   74 (78)
                      +++|..|.+.|.+.+.|+.|.+.|++ ++||+|.+||..|....+|..|.+.|....|
T Consensus       353 khkCr~CakvfgS~SaLqiHlRSHTG-ERPfqCnvCG~~FSTkGNLKvH~~rH~e~~p  409 (958)
T KOG1074|consen  353 KHKCRFCAKVFGSDSALQIHLRSHTG-ERPFQCNVCGNRFSTKGNLKVHFQRHREKYP  409 (958)
T ss_pred             cchhhhhHhhcCchhhhhhhhhccCC-CCCeeecccccccccccceeeeeeeccccCC
Confidence            36899999999999999999999999 8899999999999999999999999876554


No 10 
>PHA00733 hypothetical protein
Probab=99.18  E-value=9.7e-11  Score=56.71  Aligned_cols=57  Identities=21%  Similarity=0.426  Sum_probs=49.4

Q ss_pred             ccCCCceecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcccccChhHHHHHHhhhhc
Q psy12014         12 YKGGGLFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSYRAKQKIHLTTHMAIRHH   71 (78)
Q Consensus        12 ~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~g   71 (78)
                      +.+++||.|..|++.|.....|..|++.+..   ++.|..|++.|.....|..|+...++
T Consensus        68 ~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h~~---~~~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         68 SKAVSPYVCPLCLMPFSSSVSLKQHIRYTEH---SKVCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             cCCCCCccCCCCCCcCCCHHHHHHHHhcCCc---CccCCCCCCccCCHHHHHHHHHHhcC
Confidence            3458899999999999999999999987632   58999999999999999999887664


No 11 
>PHA00616 hypothetical protein
Probab=99.13  E-value=3.1e-11  Score=47.83  Aligned_cols=32  Identities=19%  Similarity=0.355  Sum_probs=21.9

Q ss_pred             CcccCCCcccccChhHHHHHHhhhhcCccccC
Q psy12014         46 KYRCPLCSYRAKQKIHLTTHMAIRHHKKLGKI   77 (78)
Q Consensus        46 ~~~c~~c~~~f~~~~~l~~h~~~~~g~k~~~~   77 (78)
                      |++|..||+.|...+.+..|++.|+|+++++|
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~   32 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTL   32 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccce
Confidence            46677777777777777777777777766654


No 12 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=99.04  E-value=1.7e-10  Score=41.30  Aligned_cols=24  Identities=33%  Similarity=0.769  Sum_probs=16.2

Q ss_pred             HHHHhhcccCCCCCcccCCCccccc
Q psy12014         33 LTRHQTYECGQQPKYRCPLCSYRAK   57 (78)
Q Consensus        33 l~~h~~~h~~~~~~~~c~~c~~~f~   57 (78)
                      |..|++.|++ ++||.|+.|++.|.
T Consensus         2 l~~H~~~H~~-~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    2 LRRHMRTHTG-EKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHSS-SSSEEESSSSEEES
T ss_pred             HHHHhhhcCC-CCCCCCCCCcCeeC
Confidence            5667777777 66677777776664


No 13 
>PHA02768 hypothetical protein; Provisional
Probab=98.86  E-value=2e-09  Score=44.66  Aligned_cols=29  Identities=24%  Similarity=0.527  Sum_probs=25.7

Q ss_pred             cccCCCcccccChhHHHHHHhhhhcCccccC
Q psy12014         47 YRCPLCSYRAKQKIHLTTHMAIRHHKKLGKI   77 (78)
Q Consensus        47 ~~c~~c~~~f~~~~~l~~h~~~~~g~k~~~~   77 (78)
                      |+|+.||+.|...++|..|+++|+  ++++|
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc   34 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN--TNLKL   34 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC--CcccC
Confidence            899999999999999999999999  44444


No 14 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.85  E-value=1.2e-09  Score=39.07  Aligned_cols=24  Identities=13%  Similarity=0.347  Sum_probs=21.6

Q ss_pred             hhhhhhhccCCCceecCCchhhcC
Q psy12014          5 PKLIDSLYKGGGLFSCSDCSRVYK   28 (78)
Q Consensus         5 ~~~~~~~~~~~~~~~c~~c~~~f~   28 (78)
                      +..+++.|+|++||.|+.|++.|.
T Consensus         2 l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    2 LRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHSSSSSEEESSSSEEES
T ss_pred             HHHHhhhcCCCCCCCCCCCcCeeC
Confidence            467888999999999999999986


No 15 
>PHA00732 hypothetical protein
Probab=98.84  E-value=4.2e-09  Score=47.05  Aligned_cols=46  Identities=22%  Similarity=0.488  Sum_probs=38.0

Q ss_pred             ceecCCchhhcCCHHHHHHHhhc-ccCCCCCcccCCCcccccChhHHHHHHhhh
Q psy12014         17 LFSCSDCSRVYKKKASLTRHQTY-ECGQQPKYRCPLCSYRAKQKIHLTTHMAIR   69 (78)
Q Consensus        17 ~~~c~~c~~~f~~~~~l~~h~~~-h~~~~~~~~c~~c~~~f~~~~~l~~h~~~~   69 (78)
                      ||.|..|++.|.....|..|++. |.+    +.|..|++.|.   .+..|.++.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~----~~C~~CgKsF~---~l~~H~~~~   47 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL----TKCPVCNKSYR---RLNQHFYSQ   47 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC----CccCCCCCEeC---Chhhhhccc
Confidence            57899999999999999999984 654    58999999997   466776554


No 16 
>KOG3608|consensus
Probab=98.80  E-value=8.2e-09  Score=56.97  Aligned_cols=31  Identities=35%  Similarity=0.636  Sum_probs=16.1

Q ss_pred             cccCCCcccccChhHHHHHHhh-hhcCccccC
Q psy12014         47 YRCPLCSYRAKQKIHLTTHMAI-RHHKKLGKI   77 (78)
Q Consensus        47 ~~c~~c~~~f~~~~~l~~h~~~-~~g~k~~~~   77 (78)
                      |.|+.|+.+....++|..|+++ |+..||+||
T Consensus       264 ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKC  295 (467)
T KOG3608|consen  264 YKCPLCDMTCSSASSLTTHIRYRHSKDKPFKC  295 (467)
T ss_pred             ccccccccCCCChHHHHHHHHhhhccCCCccc
Confidence            4555555555555555555553 344555554


No 17 
>KOG3608|consensus
Probab=98.78  E-value=1e-08  Score=56.60  Aligned_cols=60  Identities=22%  Similarity=0.500  Sum_probs=43.4

Q ss_pred             CceecCCchhhcCCHHHHHHHhhc-ccCCCCCcccCCCcccccChhHHHHHHhhhhcCccccC
Q psy12014         16 GLFSCSDCSRVYKKKASLTRHQTY-ECGQQPKYRCPLCSYRAKQKIHLTTHMAIRHHKKLGKI   77 (78)
Q Consensus        16 ~~~~c~~c~~~f~~~~~l~~h~~~-h~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~g~k~~~~   77 (78)
                      ..|.|..|+.+...++.|..|++. |.. .+||+|..|++.+...+.|..|..+|+ +-.|.|
T Consensus       262 n~ykCplCdmtc~~~ssL~~H~r~rHs~-dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C  322 (467)
T KOG3608|consen  262 NCYKCPLCDMTCSSASSLTTHIRYRHSK-DKPFKCDECDTRCVRESDLAKHVQVHS-KTVYQC  322 (467)
T ss_pred             hcccccccccCCCChHHHHHHHHhhhcc-CCCccccchhhhhccHHHHHHHHHhcc-ccceec
Confidence            356777777777777777777776 444 777888888888888888888888776 444444


No 18 
>PHA00616 hypothetical protein
Probab=98.69  E-value=1.4e-08  Score=40.31  Aligned_cols=34  Identities=21%  Similarity=0.457  Sum_probs=30.7

Q ss_pred             ceecCCchhhcCCHHHHHHHhhcccCCCCCcccCC
Q psy12014         17 LFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPL   51 (78)
Q Consensus        17 ~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~   51 (78)
                      ||.|..||+.|.....+..|++.|++ ++++.|..
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg-~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHK-QNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcC-CCccceeE
Confidence            68999999999999999999999999 77787764


No 19 
>PHA00733 hypothetical protein
Probab=98.61  E-value=2.7e-08  Score=48.26  Aligned_cols=61  Identities=13%  Similarity=0.168  Sum_probs=46.3

Q ss_pred             CCCceecCCchhhcCCHHHHHHHh----h-cccCCCCCcccCCCcccccChhHHHHHHhhhhcCccccC
Q psy12014         14 GGGLFSCSDCSRVYKKKASLTRHQ----T-YECGQQPKYRCPLCSYRAKQKIHLTTHMAIRHHKKLGKI   77 (78)
Q Consensus        14 ~~~~~~c~~c~~~f~~~~~l~~h~----~-~h~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~g~k~~~~   77 (78)
                      ..+++.|.+|...|.....|..+.    . .+.+ .+||.|..|++.|.....|..|++.+  +.+++|
T Consensus        37 ~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~-~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C  102 (128)
T PHA00733         37 EQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKA-VSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVC  102 (128)
T ss_pred             hhhhHHHHHHhhhccChhhhcchHHHHhhcccCC-CCCccCCCCCCcCCCHHHHHHHHhcC--CcCccC
Confidence            457788999998888777766551    1 2233 66899999999999999999999876  345655


No 20 
>KOG3993|consensus
Probab=98.57  E-value=3.6e-08  Score=55.45  Aligned_cols=57  Identities=19%  Similarity=0.530  Sum_probs=47.6

Q ss_pred             CCceecCCchhhcCCHHHHHHHhhcccCC-------CC-------------------------CcccCCCcccccChhHH
Q psy12014         15 GGLFSCSDCSRVYKKKASLTRHQTYECGQ-------QP-------------------------KYRCPLCSYRAKQKIHL   62 (78)
Q Consensus        15 ~~~~~c~~c~~~f~~~~~l~~h~~~h~~~-------~~-------------------------~~~c~~c~~~f~~~~~l   62 (78)
                      ...|+|.+|++.|....+|..|.++|-..       .+                         -|.|..|++.|.....|
T Consensus       293 ~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYL  372 (500)
T KOG3993|consen  293 HVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYL  372 (500)
T ss_pred             EeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccccCCcccCceeecHHhhhhhHHHHHH
Confidence            34799999999999999999999998321       11                         26799999999999999


Q ss_pred             HHHHhhhhc
Q psy12014         63 TTHMAIRHH   71 (78)
Q Consensus        63 ~~h~~~~~g   71 (78)
                      ..|+-+|..
T Consensus       373 rKHqlthq~  381 (500)
T KOG3993|consen  373 RKHQLTHQR  381 (500)
T ss_pred             HHhHHhhhc
Confidence            999888863


No 21 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.53  E-value=4.5e-07  Score=37.78  Aligned_cols=52  Identities=27%  Similarity=0.598  Sum_probs=39.0

Q ss_pred             ceecCCchhhcCCHHHHHHHhhc-ccCCCCCcccCCCcccccChhHHHHHHhhhhc
Q psy12014         17 LFSCSDCSRVYKKKASLTRHQTY-ECGQQPKYRCPLCSYRAKQKIHLTTHMAIRHH   71 (78)
Q Consensus        17 ~~~c~~c~~~f~~~~~l~~h~~~-h~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~g   71 (78)
                      .|.|+.|++.|+ ...|..|... |..+.+.+.|++|...+.  .+|..|+..+++
T Consensus         2 ~f~CP~C~~~~~-~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H~   54 (54)
T PF05605_consen    2 SFTCPYCGKGFS-ESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQHR   54 (54)
T ss_pred             CcCCCCCCCccC-HHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhcC
Confidence            588999999554 5678888654 776556789999987544  488889887764


No 22 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.50  E-value=2.1e-07  Score=54.47  Aligned_cols=58  Identities=19%  Similarity=0.406  Sum_probs=31.2

Q ss_pred             CceecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcccccC----------hhHHHHHHhhhhcCccccC
Q psy12014         16 GLFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSYRAKQ----------KIHLTTHMAIRHHKKLGKI   77 (78)
Q Consensus        16 ~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~----------~~~l~~h~~~~~g~k~~~~   77 (78)
                      +++.|. |+..+ ....|..|+..|.+ .+|+.|..|+..+..          ...|..|.... |.+++.|
T Consensus       477 kpv~Cp-Cg~~~-~R~~L~~H~~thCp-~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G~rt~~C  544 (567)
T PLN03086        477 EPLQCP-CGVVL-EKEQMVQHQASTCP-LRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC-GSRTAPC  544 (567)
T ss_pred             CCccCC-CCCCc-chhHHHhhhhccCC-CCceeCCCCCCccccCccccchhhhhhhHHHHHHhc-CCcceEc
Confidence            455565 65433 34555566655665 555666666655531          23455565553 5555554


No 23 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.48  E-value=3e-07  Score=53.87  Aligned_cols=59  Identities=17%  Similarity=0.414  Sum_probs=49.1

Q ss_pred             cCCCceecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcccccChhHHHHHHhhhhcCccccC
Q psy12014         13 KGGGLFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSYRAKQKIHLTTHMAIRHHKKLGKI   77 (78)
Q Consensus        13 ~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~g~k~~~~   77 (78)
                      ..++.+.|..|++.|. ...|..|+..+.   .|+.|+ |+..+ ....|..|+.+|.++++++|
T Consensus       449 el~~H~~C~~Cgk~f~-~s~LekH~~~~H---kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C  507 (567)
T PLN03086        449 EAKNHVHCEKCGQAFQ-QGEMEKHMKVFH---EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITC  507 (567)
T ss_pred             ccccCccCCCCCCccc-hHHHHHHHHhcC---CCccCC-CCCCc-chhHHHhhhhccCCCCceeC
Confidence            3456789999999996 567899999864   468999 99755 56899999999999999988


No 24 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.39  E-value=3e-07  Score=31.65  Aligned_cols=21  Identities=33%  Similarity=0.730  Sum_probs=10.1

Q ss_pred             ccCCCcccccChhHHHHHHhh
Q psy12014         48 RCPLCSYRAKQKIHLTTHMAI   68 (78)
Q Consensus        48 ~c~~c~~~f~~~~~l~~h~~~   68 (78)
                      .|..|++.|.....|..|++.
T Consensus         2 ~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    2 KCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCccCCHHHHHHHHhH
Confidence            344455555555555544443


No 25 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.38  E-value=2.9e-07  Score=31.70  Aligned_cols=23  Identities=26%  Similarity=0.719  Sum_probs=20.8

Q ss_pred             eecCCchhhcCCHHHHHHHhhcc
Q psy12014         18 FSCSDCSRVYKKKASLTRHQTYE   40 (78)
Q Consensus        18 ~~c~~c~~~f~~~~~l~~h~~~h   40 (78)
                      |.|..|++.|.....|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            68999999999999999998764


No 26 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.25  E-value=7.5e-07  Score=31.84  Aligned_cols=23  Identities=17%  Similarity=0.333  Sum_probs=13.1

Q ss_pred             cccCCCcccccChhHHHHHHhhh
Q psy12014         47 YRCPLCSYRAKQKIHLTTHMAIR   69 (78)
Q Consensus        47 ~~c~~c~~~f~~~~~l~~h~~~~   69 (78)
                      ++|..|++.|.....|..|++.|
T Consensus         2 ~~C~~C~~~F~~~~~l~~H~~~h   24 (27)
T PF13912_consen    2 FECDECGKTFSSLSALREHKRSH   24 (27)
T ss_dssp             EEETTTTEEESSHHHHHHHHCTT
T ss_pred             CCCCccCCccCChhHHHHHhHHh
Confidence            45555555555555555555554


No 27 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=98.18  E-value=2.7e-06  Score=34.65  Aligned_cols=32  Identities=38%  Similarity=0.722  Sum_probs=21.9

Q ss_pred             CCCcccCCCcccccChhHHHHHHhhhhcCccc
Q psy12014         44 QPKYRCPLCSYRAKQKIHLTTHMAIRHHKKLG   75 (78)
Q Consensus        44 ~~~~~c~~c~~~f~~~~~l~~h~~~~~g~k~~   75 (78)
                      ..|-.|++|+..+.+..+|..|+.+.++.||.
T Consensus        22 ~~PatCP~C~a~~~~srnLrRHle~~H~~k~~   53 (54)
T PF09237_consen   22 EQPATCPICGAVIRQSRNLRRHLEIRHFKKPG   53 (54)
T ss_dssp             S--EE-TTT--EESSHHHHHHHHHHHTTTS--
T ss_pred             CCCCCCCcchhhccchhhHHHHHHHHhcccCC
Confidence            66788999999999999999999888888774


No 28 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.15  E-value=2.3e-06  Score=29.39  Aligned_cols=23  Identities=30%  Similarity=0.782  Sum_probs=11.9

Q ss_pred             cccCCCcccccChhHHHHHHhhh
Q psy12014         47 YRCPLCSYRAKQKIHLTTHMAIR   69 (78)
Q Consensus        47 ~~c~~c~~~f~~~~~l~~h~~~~   69 (78)
                      |.|..|++.|.....|..|+..+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            34555666666666666555544


No 29 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.12  E-value=3.2e-06  Score=30.14  Aligned_cols=25  Identities=24%  Similarity=0.814  Sum_probs=22.7

Q ss_pred             ceecCCchhhcCCHHHHHHHhhccc
Q psy12014         17 LFSCSDCSRVYKKKASLTRHQTYEC   41 (78)
Q Consensus        17 ~~~c~~c~~~f~~~~~l~~h~~~h~   41 (78)
                      +|.|..|++.|.....|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            5899999999999999999998764


No 30 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.98  E-value=2.5e-06  Score=46.91  Aligned_cols=53  Identities=28%  Similarity=0.577  Sum_probs=41.7

Q ss_pred             CCceecCC--chhhcCCHHHHHHHhhc-c-----------------cCCCCCcccCCCcccccChhHHHHHHh
Q psy12014         15 GGLFSCSD--CSRVYKKKASLTRHQTY-E-----------------CGQQPKYRCPLCSYRAKQKIHLTTHMA   67 (78)
Q Consensus        15 ~~~~~c~~--c~~~f~~~~~l~~h~~~-h-----------------~~~~~~~~c~~c~~~f~~~~~l~~h~~   67 (78)
                      ++||+|.+  |++.+...-.|+-|+.- |                 ..+.|||+|.+|++.+.....|.-|+.
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            59999987  99999988888777653 2                 112489999999999998888876654


No 31 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.91  E-value=1.2e-05  Score=27.54  Aligned_cols=23  Identities=26%  Similarity=0.723  Sum_probs=18.9

Q ss_pred             eecCCchhhcCCHHHHHHHhhcc
Q psy12014         18 FSCSDCSRVYKKKASLTRHQTYE   40 (78)
Q Consensus        18 ~~c~~c~~~f~~~~~l~~h~~~h   40 (78)
                      |.|+.|+..|.....|..|+..+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            68999999999999999998764


No 32 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.80  E-value=3e-05  Score=26.85  Aligned_cols=22  Identities=41%  Similarity=0.670  Sum_probs=11.8

Q ss_pred             ccCCCcccccChhHHHHHHhhh
Q psy12014         48 RCPLCSYRAKQKIHLTTHMAIR   69 (78)
Q Consensus        48 ~c~~c~~~f~~~~~l~~h~~~~   69 (78)
                      .|..|++.|.....+..|++.|
T Consensus         2 ~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        2 RCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCcchhCCHHHHHHHHHHh
Confidence            4555555555555555555543


No 33 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.68  E-value=5e-05  Score=26.24  Aligned_cols=24  Identities=29%  Similarity=0.818  Sum_probs=21.0

Q ss_pred             eecCCchhhcCCHHHHHHHhhccc
Q psy12014         18 FSCSDCSRVYKKKASLTRHQTYEC   41 (78)
Q Consensus        18 ~~c~~c~~~f~~~~~l~~h~~~h~   41 (78)
                      +.|..|++.|.....|..|+..|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            579999999999999999998654


No 34 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.59  E-value=0.00011  Score=30.04  Aligned_cols=35  Identities=17%  Similarity=0.249  Sum_probs=23.5

Q ss_pred             hccCCCceecCCchhhcCCHHHHHHHhhcccCCCCC
Q psy12014         11 LYKGGGLFSCSDCSRVYKKKASLTRHQTYECGQQPK   46 (78)
Q Consensus        11 ~~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~   46 (78)
                      ....+.|..|.+|+..+....+|.+|+....+ .+|
T Consensus        18 ~~~S~~PatCP~C~a~~~~srnLrRHle~~H~-~k~   52 (54)
T PF09237_consen   18 KSQSEQPATCPICGAVIRQSRNLRRHLEIRHF-KKP   52 (54)
T ss_dssp             CCTTS--EE-TTT--EESSHHHHHHHHHHHTT-TS-
T ss_pred             hhccCCCCCCCcchhhccchhhHHHHHHHHhc-ccC
Confidence            34568899999999999999999999977555 443


No 35 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.57  E-value=9.1e-05  Score=34.07  Aligned_cols=24  Identities=29%  Similarity=0.742  Sum_probs=19.4

Q ss_pred             CcccCCCcccccChhHHHHHHhhh
Q psy12014         46 KYRCPLCSYRAKQKIHLTTHMAIR   69 (78)
Q Consensus        46 ~~~c~~c~~~f~~~~~l~~h~~~~   69 (78)
                      .+.|..|++.|.....|..|++.+
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             CCCCCccCCCCcCHHHHHHHHcCc
Confidence            378899999999899999998865


No 36 
>PHA00732 hypothetical protein
Probab=97.50  E-value=0.00012  Score=32.86  Aligned_cols=27  Identities=19%  Similarity=0.581  Sum_probs=23.4

Q ss_pred             CcccCCCcccccChhHHHHHHhh-hhcC
Q psy12014         46 KYRCPLCSYRAKQKIHLTTHMAI-RHHK   72 (78)
Q Consensus        46 ~~~c~~c~~~f~~~~~l~~h~~~-~~g~   72 (78)
                      ||.|..|++.|.....|..|++. |.+.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~~   28 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTLT   28 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCCC
Confidence            58899999999999999999984 6653


No 37 
>PRK04860 hypothetical protein; Provisional
Probab=97.44  E-value=9.6e-05  Score=37.34  Aligned_cols=37  Identities=24%  Similarity=0.609  Sum_probs=24.2

Q ss_pred             ceecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcccccC
Q psy12014         17 LFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSYRAKQ   58 (78)
Q Consensus        17 ~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~   58 (78)
                      +|.|. |+.   ....+.+|.+++++ .++|.|..|+..|..
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g-~~~YrC~~C~~~l~~  155 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRG-EAVYRCRRCGETLVF  155 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcC-CccEECCCCCceeEE
Confidence            46776 765   33445677777777 666777777766653


No 38 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.41  E-value=0.0002  Score=24.64  Aligned_cols=23  Identities=43%  Similarity=0.996  Sum_probs=13.4

Q ss_pred             cccCCCcccccChhHHHHHHhhhh
Q psy12014         47 YRCPLCSYRAKQKIHLTTHMAIRH   70 (78)
Q Consensus        47 ~~c~~c~~~f~~~~~l~~h~~~~~   70 (78)
                      |+|..|+.... ...|..|++.++
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            45666766655 666777766654


No 39 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.39  E-value=0.00016  Score=25.08  Aligned_cols=20  Identities=25%  Similarity=0.639  Sum_probs=10.2

Q ss_pred             ecCCchhhcCCHHHHHHHhh
Q psy12014         19 SCSDCSRVYKKKASLTRHQT   38 (78)
Q Consensus        19 ~c~~c~~~f~~~~~l~~h~~   38 (78)
                      .|.+|+..|.....+..|.+
T Consensus         2 ~C~~C~~~f~s~~~~~~H~~   21 (25)
T PF12874_consen    2 YCDICNKSFSSENSLRQHLR   21 (25)
T ss_dssp             EETTTTEEESSHHHHHHHHT
T ss_pred             CCCCCCCCcCCHHHHHHHHC
Confidence            45555555555555555543


No 40 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.32  E-value=0.00019  Score=24.86  Aligned_cols=23  Identities=17%  Similarity=0.524  Sum_probs=20.5

Q ss_pred             cccCCCcccccChhHHHHHHhhh
Q psy12014         47 YRCPLCSYRAKQKIHLTTHMAIR   69 (78)
Q Consensus        47 ~~c~~c~~~f~~~~~l~~h~~~~   69 (78)
                      |.|..|...|.....+..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            57999999999999999998765


No 41 
>KOG3993|consensus
Probab=97.32  E-value=4.7e-05  Score=43.50  Aligned_cols=53  Identities=23%  Similarity=0.459  Sum_probs=43.2

Q ss_pred             ceecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcccccChhHHHHHHhhhh
Q psy12014         17 LFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSYRAKQKIHLTTHMAIRH   70 (78)
Q Consensus        17 ~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~   70 (78)
                      .|.|..|...|...-.|..|.-.-.. ...|+|+.|++.|+=..+|..|.|=|-
T Consensus       267 dyiCqLCK~kYeD~F~LAQHrC~RIV-~vEYrCPEC~KVFsCPANLASHRRWHK  319 (500)
T KOG3993|consen  267 DYICQLCKEKYEDAFALAQHRCPRIV-HVEYRCPECDKVFSCPANLASHRRWHK  319 (500)
T ss_pred             HHHHHHHHHhhhhHHHHhhccCCeeE-EeeecCCcccccccCchhhhhhhcccC
Confidence            48899999999888888888643333 334999999999999999999998873


No 42 
>PRK04860 hypothetical protein; Provisional
Probab=96.84  E-value=0.00076  Score=34.17  Aligned_cols=28  Identities=18%  Similarity=0.502  Sum_probs=24.4

Q ss_pred             CcccCCCcccccChhHHHHHHhhhhcCccccC
Q psy12014         46 KYRCPLCSYRAKQKIHLTTHMAIRHHKKLGKI   77 (78)
Q Consensus        46 ~~~c~~c~~~f~~~~~l~~h~~~~~g~k~~~~   77 (78)
                      +|.|. |+.   ...++..|.++++|+++|.|
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC  146 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRC  146 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEEC
Confidence            58897 886   67778999999999999988


No 43 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.66  E-value=0.0011  Score=23.46  Aligned_cols=21  Identities=24%  Similarity=0.518  Sum_probs=11.5

Q ss_pred             cccCCCcccccChhHHHHHHh
Q psy12014         47 YRCPLCSYRAKQKIHLTTHMA   67 (78)
Q Consensus        47 ~~c~~c~~~f~~~~~l~~h~~   67 (78)
                      |-|..|++.|.....+..|+.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~   22 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMK   22 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTT
T ss_pred             CCcccCCCCcCCHHHHHHHHc
Confidence            345555555555555555544


No 44 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=96.44  E-value=0.0042  Score=21.69  Aligned_cols=19  Identities=26%  Similarity=0.632  Sum_probs=9.9

Q ss_pred             ccCCCcccccChhHHHHHHh
Q psy12014         48 RCPLCSYRAKQKIHLTTHMA   67 (78)
Q Consensus        48 ~c~~c~~~f~~~~~l~~h~~   67 (78)
                      .|+.|++.| ....|..|+.
T Consensus         4 ~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    4 PCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             cCCCCCCEE-CHHHHHHHHH
Confidence            455666666 3444555543


No 45 
>KOG2893|consensus
Probab=96.34  E-value=0.0012  Score=35.53  Aligned_cols=44  Identities=23%  Similarity=0.507  Sum_probs=33.7

Q ss_pred             CceecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcccccChhHHHHH
Q psy12014         16 GLFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSYRAKQKIHLTTH   65 (78)
Q Consensus        16 ~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~~~~l~~h   65 (78)
                      ++ .|..|++.|.....|..|+.     .+.|+|.+|-+....-..|..|
T Consensus        10 kp-wcwycnrefddekiliqhqk-----akhfkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   10 KP-WCWYCNREFDDEKILIQHQK-----AKHFKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             Cc-eeeecccccchhhhhhhhhh-----hccceeeeehhhhccCCCceee
Confidence            44 48899999999999999988     5568999997655555555555


No 46 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=96.09  E-value=0.0077  Score=22.37  Aligned_cols=22  Identities=23%  Similarity=0.495  Sum_probs=15.1

Q ss_pred             ceecCCchhhcCCHHHHHHHhh
Q psy12014         17 LFSCSDCSRVYKKKASLTRHQT   38 (78)
Q Consensus        17 ~~~c~~c~~~f~~~~~l~~h~~   38 (78)
                      +|.|+.|+..|.....+..|..
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHC
Confidence            4667777777776666666654


No 47 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=96.07  E-value=0.0011  Score=37.52  Aligned_cols=61  Identities=21%  Similarity=0.425  Sum_probs=52.0

Q ss_pred             CceecCCchhhcCCHHHHHHHhh--cccCCC--CCcccC--CCcccccChhHHHHHHhhhhcCccccC
Q psy12014         16 GLFSCSDCSRVYKKKASLTRHQT--YECGQQ--PKYRCP--LCSYRAKQKIHLTTHMAIRHHKKLGKI   77 (78)
Q Consensus        16 ~~~~c~~c~~~f~~~~~l~~h~~--~h~~~~--~~~~c~--~c~~~f~~~~~l~~h~~~~~g~k~~~~   77 (78)
                      .++.|..|...|.....+..|.+  .|.+ .  +|+.|+  .|++.|.....+..|..+|++..+.++
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~-~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  354 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSG-ESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKE  354 (467)
T ss_pred             cCCCCccccCCcccccccccccccccccc-ccCCceeeeccCCCccccccccccCCcccccCCCcccc
Confidence            36788889999999999999999  7988 6  889999  799999999999999999988776554


No 48 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=94.95  E-value=0.034  Score=25.38  Aligned_cols=27  Identities=19%  Similarity=0.563  Sum_probs=22.7

Q ss_pred             CceecCCchhhcCCHHHHHHHhhcccC
Q psy12014         16 GLFSCSDCSRVYKKKASLTRHQTYECG   42 (78)
Q Consensus        16 ~~~~c~~c~~~f~~~~~l~~h~~~h~~   42 (78)
                      ..+.|..|++.|.+...|..|++.+..
T Consensus        49 ~~~~C~~C~~~f~s~~~l~~Hm~~~~H   75 (100)
T PF12756_consen   49 ESFRCPYCNKTFRSREALQEHMRSKHH   75 (100)
T ss_dssp             SSEEBSSSS-EESSHHHHHHHHHHTTT
T ss_pred             CCCCCCccCCCCcCHHHHHHHHcCccC
Confidence            369999999999999999999997544


No 49 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=94.81  E-value=0.019  Score=21.33  Aligned_cols=24  Identities=25%  Similarity=0.955  Sum_probs=16.5

Q ss_pred             eecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcc
Q psy12014         18 FSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSY   54 (78)
Q Consensus        18 ~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~   54 (78)
                      |.|..||..+...             ..++.|+.|+.
T Consensus         2 ~~C~~CGy~y~~~-------------~~~~~CP~Cg~   25 (33)
T cd00350           2 YVCPVCGYIYDGE-------------EAPWVCPVCGA   25 (33)
T ss_pred             EECCCCCCEECCC-------------cCCCcCcCCCC
Confidence            6788888665432             24688999974


No 50 
>KOG2186|consensus
Probab=94.18  E-value=0.04  Score=30.05  Aligned_cols=49  Identities=18%  Similarity=0.407  Sum_probs=36.1

Q ss_pred             eecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcccccChhHHHHHHhhhh
Q psy12014         18 FSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSYRAKQKIHLTTHMAIRH   70 (78)
Q Consensus        18 ~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~   70 (78)
                      |.|..||....-+ .+..|+..-++ .. |.|.-|+.+|.. .+...|....+
T Consensus         4 FtCnvCgEsvKKp-~vekH~srCrn-~~-fSCIDC~k~F~~-~sYknH~kCIT   52 (276)
T KOG2186|consen    4 FTCNVCGESVKKP-QVEKHMSRCRN-AY-FSCIDCGKTFER-VSYKNHTKCIT   52 (276)
T ss_pred             Eehhhhhhhcccc-chHHHHHhccC-Ce-eEEeeccccccc-chhhhhhhhcc
Confidence            6799999887644 45668887666 54 899999999987 45566766544


No 51 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=93.59  E-value=0.081  Score=19.82  Aligned_cols=25  Identities=24%  Similarity=0.891  Sum_probs=16.6

Q ss_pred             ceecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcc
Q psy12014         17 LFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSY   54 (78)
Q Consensus        17 ~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~   54 (78)
                      .|.|..||..+.             +...|..|+.|+.
T Consensus         2 ~~~C~~CG~i~~-------------g~~~p~~CP~Cg~   26 (34)
T cd00729           2 VWVCPVCGYIHE-------------GEEAPEKCPICGA   26 (34)
T ss_pred             eEECCCCCCEeE-------------CCcCCCcCcCCCC
Confidence            478888886543             2134678999875


No 52 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=93.24  E-value=0.074  Score=22.28  Aligned_cols=30  Identities=20%  Similarity=0.543  Sum_probs=23.8

Q ss_pred             hhccCCCceecCCchhhcCCHHHHHHHhhc
Q psy12014         10 SLYKGGGLFSCSDCSRVYKKKASLTRHQTY   39 (78)
Q Consensus        10 ~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~   39 (78)
                      +...||.-+.|+.|+..|.....+.+|...
T Consensus        10 ~~RDGE~~lrCPRC~~~FR~~K~Y~RHVNK   39 (65)
T COG4049          10 RDRDGEEFLRCPRCGMVFRRRKDYIRHVNK   39 (65)
T ss_pred             eccCCceeeeCCchhHHHHHhHHHHHHhhH
Confidence            345677788999999999988888888754


No 53 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=92.61  E-value=0.11  Score=26.75  Aligned_cols=24  Identities=25%  Similarity=0.775  Sum_probs=18.3

Q ss_pred             ceecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcc
Q psy12014         17 LFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSY   54 (78)
Q Consensus        17 ~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~   54 (78)
                      -|.|.+||..             +.+ ..|..|+.|+-
T Consensus       134 ~~vC~vCGy~-------------~~g-e~P~~CPiCga  157 (166)
T COG1592         134 VWVCPVCGYT-------------HEG-EAPEVCPICGA  157 (166)
T ss_pred             EEEcCCCCCc-------------ccC-CCCCcCCCCCC
Confidence            6999999854             345 66789999983


No 54 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=91.96  E-value=0.11  Score=25.77  Aligned_cols=25  Identities=20%  Similarity=0.308  Sum_probs=15.7

Q ss_pred             cccCCCcccccChhHHHHHHhhhhcCcc
Q psy12014         47 YRCPLCSYRAKQKIHLTTHMAIRHHKKL   74 (78)
Q Consensus        47 ~~c~~c~~~f~~~~~l~~h~~~~~g~k~   74 (78)
                      ..|.+||+.|...   ..|++.|+|..|
T Consensus        73 i~clecGk~~k~L---krHL~~~~gltp   97 (132)
T PF05443_consen   73 IICLECGKKFKTL---KRHLRTHHGLTP   97 (132)
T ss_dssp             EE-TBT--EESBH---HHHHHHTT-S-H
T ss_pred             eEEccCCcccchH---HHHHHHccCCCH
Confidence            5799999987754   789999987654


No 55 
>KOG1146|consensus
Probab=91.66  E-value=0.23  Score=33.14  Aligned_cols=57  Identities=21%  Similarity=0.387  Sum_probs=45.3

Q ss_pred             ccCCCceecCCchhhcCCHHHHHHHhhcccCC------------------------CCCcccCCCcccccChhHHHHHHh
Q psy12014         12 YKGGGLFSCSDCSRVYKKKASLTRHQTYECGQ------------------------QPKYRCPLCSYRAKQKIHLTTHMA   67 (78)
Q Consensus        12 ~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~~------------------------~~~~~c~~c~~~f~~~~~l~~h~~   67 (78)
                      ++-.+.+.|..|+..|.....|..|++....+                        .+|+.|..|...+....+|..|++
T Consensus       460 ~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~Lsihlq  539 (1406)
T KOG1146|consen  460 HSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLSIHLQ  539 (1406)
T ss_pred             ecccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCcccceeeeeeeecchHHHHHHH
Confidence            44458899999999999999999999871110                        246889999999988888888877


Q ss_pred             h
Q psy12014         68 I   68 (78)
Q Consensus        68 ~   68 (78)
                      .
T Consensus       540 S  540 (1406)
T KOG1146|consen  540 S  540 (1406)
T ss_pred             H
Confidence            5


No 56 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=90.09  E-value=0.038  Score=29.43  Aligned_cols=45  Identities=20%  Similarity=0.440  Sum_probs=28.3

Q ss_pred             CCceecCCchhhcCCHHHHHHHhhcc---cCC------CCC-----cccCCCcccccCh
Q psy12014         15 GGLFSCSDCSRVYKKKASLTRHQTYE---CGQ------QPK-----YRCPLCSYRAKQK   59 (78)
Q Consensus        15 ~~~~~c~~c~~~f~~~~~l~~h~~~h---~~~------~~~-----~~c~~c~~~f~~~   59 (78)
                      ++...|+.|+..|..........+.-   ...      ..|     +.|+.||.++...
T Consensus         3 ~k~~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             CCceECCCCCCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCCCccccc
Confidence            46678999999998775544443321   110      222     5799999876533


No 57 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=89.62  E-value=0.3  Score=26.21  Aligned_cols=26  Identities=15%  Similarity=0.432  Sum_probs=20.9

Q ss_pred             CCCceecCCchhhcCCHHHHHHHhhc
Q psy12014         14 GGGLFSCSDCSRVYKKKASLTRHQTY   39 (78)
Q Consensus        14 ~~~~~~c~~c~~~f~~~~~l~~h~~~   39 (78)
                      .+..|.|..|++.|.-..++..|+..
T Consensus        74 ~~~K~~C~lc~KlFkg~eFV~KHI~n   99 (214)
T PF04959_consen   74 DEDKWRCPLCGKLFKGPEFVRKHIFN   99 (214)
T ss_dssp             SSEEEEE-SSS-EESSHHHHHHHHHH
T ss_pred             cCCEECCCCCCcccCChHHHHHHHhh
Confidence            45569999999999999999999876


No 58 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=88.79  E-value=0.35  Score=19.27  Aligned_cols=27  Identities=33%  Similarity=0.883  Sum_probs=18.6

Q ss_pred             ceecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCccc
Q psy12014         17 LFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSYR   55 (78)
Q Consensus        17 ~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~~   55 (78)
                      .|.|..||..|...           . ..+.+|+.||..
T Consensus         2 ~Y~C~~Cg~~~~~~-----------~-~~~irC~~CG~r   28 (44)
T smart00659        2 IYICGECGRENEIK-----------S-KDVVRCRECGYR   28 (44)
T ss_pred             EEECCCCCCEeecC-----------C-CCceECCCCCce
Confidence            47899999877532           1 335789999853


No 59 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=88.63  E-value=0.48  Score=18.00  Aligned_cols=34  Identities=24%  Similarity=0.621  Sum_probs=20.8

Q ss_pred             eecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCccccc
Q psy12014         18 FSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSYRAK   57 (78)
Q Consensus        18 ~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~   57 (78)
                      -.|+.|+..|......    ....+ . ..+|..|+..|.
T Consensus         3 i~CP~C~~~f~v~~~~----l~~~~-~-~vrC~~C~~~f~   36 (37)
T PF13719_consen    3 ITCPNCQTRFRVPDDK----LPAGG-R-KVRCPKCGHVFR   36 (37)
T ss_pred             EECCCCCceEEcCHHH----cccCC-c-EEECCCCCcEee
Confidence            3688888888755421    11222 3 378998887764


No 60 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=88.49  E-value=0.44  Score=18.05  Aligned_cols=33  Identities=24%  Similarity=0.549  Sum_probs=20.6

Q ss_pred             eecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcccc
Q psy12014         18 FSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSYRA   56 (78)
Q Consensus        18 ~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~~f   56 (78)
                      ..|+.|+..|...+..    ....+ . ..+|..|+..|
T Consensus         3 i~Cp~C~~~y~i~d~~----ip~~g-~-~v~C~~C~~~f   35 (36)
T PF13717_consen    3 ITCPNCQAKYEIDDEK----IPPKG-R-KVRCSKCGHVF   35 (36)
T ss_pred             EECCCCCCEEeCCHHH----CCCCC-c-EEECCCCCCEe
Confidence            4688888888765532    22222 3 37888888766


No 61 
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=88.08  E-value=0.22  Score=23.04  Aligned_cols=13  Identities=15%  Similarity=0.536  Sum_probs=8.2

Q ss_pred             CceecCCchhhcC
Q psy12014         16 GLFSCSDCSRVYK   28 (78)
Q Consensus        16 ~~~~c~~c~~~f~   28 (78)
                      +|-.|..||..|.
T Consensus        57 ~Pa~CkkCGfef~   69 (97)
T COG3357          57 RPARCKKCGFEFR   69 (97)
T ss_pred             cChhhcccCcccc
Confidence            4556777776664


No 62 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=87.61  E-value=0.52  Score=22.59  Aligned_cols=30  Identities=20%  Similarity=0.569  Sum_probs=21.1

Q ss_pred             eecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcccccCh
Q psy12014         18 FSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSYRAKQK   59 (78)
Q Consensus        18 ~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~~   59 (78)
                      ..|..||..|=   .|        . +.|..|+.||..|...
T Consensus        10 R~Cp~CG~kFY---DL--------n-k~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCPSCGAKFY---DL--------N-KDPIVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCcchhc---cC--------C-CCCccCCCCCCccCcc
Confidence            47888887652   12        2 5678899999887755


No 63 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=87.59  E-value=0.71  Score=23.56  Aligned_cols=36  Identities=14%  Similarity=0.427  Sum_probs=26.6

Q ss_pred             ccCCCceecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCccccc
Q psy12014         12 YKGGGLFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSYRAK   57 (78)
Q Consensus        12 ~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~   57 (78)
                      .+...-|.|+.|+..|+...++.         . -|.|+.||....
T Consensus       104 e~~~~~Y~Cp~c~~r~tf~eA~~---------~-~F~Cp~Cg~~L~  139 (158)
T TIGR00373       104 ETNNMFFICPNMCVRFTFNEAME---------L-NFTCPRCGAMLD  139 (158)
T ss_pred             ccCCCeEECCCCCcEeeHHHHHH---------c-CCcCCCCCCEee
Confidence            44566789999999888766653         1 399999997654


No 64 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=87.06  E-value=0.13  Score=29.18  Aligned_cols=25  Identities=24%  Similarity=0.505  Sum_probs=18.9

Q ss_pred             ccCCCceecCCchhhcCCHHHHHHH
Q psy12014         12 YKGGGLFSCSDCSRVYKKKASLTRH   36 (78)
Q Consensus        12 ~~~~~~~~c~~c~~~f~~~~~l~~h   36 (78)
                      -...|||+|..|++.+..--.|+-|
T Consensus       393 ~~~~KPYrCevC~KRYKNlNGLKYH  417 (423)
T COG5189         393 SAKDKPYRCEVCDKRYKNLNGLKYH  417 (423)
T ss_pred             cccCCceeccccchhhccCccceec
Confidence            4567999999999998865555444


No 65 
>KOG4167|consensus
Probab=86.79  E-value=0.13  Score=32.28  Aligned_cols=24  Identities=17%  Similarity=0.289  Sum_probs=22.1

Q ss_pred             cccCCCcccccChhHHHHHHhhhh
Q psy12014         47 YRCPLCSYRAKQKIHLTTHMAIRH   70 (78)
Q Consensus        47 ~~c~~c~~~f~~~~~l~~h~~~~~   70 (78)
                      |.|..|++.|..-.+++.|+++|.
T Consensus       793 FpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  793 FPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             eehHHHHHHHHHHhhhhHHHHHHH
Confidence            789999999999999999999985


No 66 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=86.42  E-value=0.86  Score=23.77  Aligned_cols=35  Identities=20%  Similarity=0.596  Sum_probs=25.2

Q ss_pred             cCCCceecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCccccc
Q psy12014         13 KGGGLFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSYRAK   57 (78)
Q Consensus        13 ~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~   57 (78)
                      ....-|.|+.|+..|+....+.          .-|.|+.||....
T Consensus       113 ~~~~~Y~Cp~C~~rytf~eA~~----------~~F~Cp~Cg~~L~  147 (178)
T PRK06266        113 ENNMFFFCPNCHIRFTFDEAME----------YGFRCPQCGEMLE  147 (178)
T ss_pred             cCCCEEECCCCCcEEeHHHHhh----------cCCcCCCCCCCCe
Confidence            3456689999999888665442          1399999997554


No 67 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=86.20  E-value=0.42  Score=25.69  Aligned_cols=27  Identities=33%  Similarity=0.656  Sum_probs=21.0

Q ss_pred             cccCCCcccccChhHHHHHHhhhhcCc
Q psy12014         47 YRCPLCSYRAKQKIHLTTHMAIRHHKK   73 (78)
Q Consensus        47 ~~c~~c~~~f~~~~~l~~h~~~~~g~k   73 (78)
                      |.|..|+|.|.-......|+..-|.|+
T Consensus        78 ~~C~lc~KlFkg~eFV~KHI~nKH~e~  104 (214)
T PF04959_consen   78 WRCPLCGKLFKGPEFVRKHIFNKHPEK  104 (214)
T ss_dssp             EEE-SSS-EESSHHHHHHHHHHH-HHH
T ss_pred             ECCCCCCcccCChHHHHHHHhhcCHHH
Confidence            899999999999999999988766553


No 68 
>KOG3408|consensus
Probab=85.92  E-value=0.91  Score=22.23  Aligned_cols=28  Identities=32%  Similarity=0.736  Sum_probs=22.2

Q ss_pred             cCCCceecCCchhhcCCHHHHHHHhhcc
Q psy12014         13 KGGGLFSCSDCSRVYKKKASLTRHQTYE   40 (78)
Q Consensus        13 ~~~~~~~c~~c~~~f~~~~~l~~h~~~h   40 (78)
                      .|...|.|..|.+-|.....|..|.+.-
T Consensus        53 PG~GqfyCi~CaRyFi~~~~l~~H~ktK   80 (129)
T KOG3408|consen   53 PGGGQFYCIECARYFIDAKALKTHFKTK   80 (129)
T ss_pred             CCCceeehhhhhhhhcchHHHHHHHhcc
Confidence            3455688999999999998888887653


No 69 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=85.71  E-value=0.89  Score=21.53  Aligned_cols=25  Identities=36%  Similarity=0.817  Sum_probs=21.9

Q ss_pred             ccc----CCCcccccChhHHHHHHhhhhc
Q psy12014         47 YRC----PLCSYRAKQKIHLTTHMAIRHH   71 (78)
Q Consensus        47 ~~c----~~c~~~f~~~~~l~~h~~~~~g   71 (78)
                      |.|    ..|+........+..|.+..+|
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            789    8899999999999999988765


No 70 
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=85.71  E-value=0.5  Score=23.56  Aligned_cols=25  Identities=16%  Similarity=0.098  Sum_probs=18.6

Q ss_pred             cccCCCcccccChhHHHHHHhhhhcCcc
Q psy12014         47 YRCPLCSYRAKQKIHLTTHMAIRHHKKL   74 (78)
Q Consensus        47 ~~c~~c~~~f~~~~~l~~h~~~~~g~k~   74 (78)
                      ..|.++|+.|.   +|.+|+.+|.|..|
T Consensus        77 IicLEDGkkfK---SLKRHL~t~~gmTP  101 (148)
T COG4957          77 IICLEDGKKFK---SLKRHLTTHYGLTP  101 (148)
T ss_pred             EEEeccCcchH---HHHHHHhcccCCCH
Confidence            35777887665   67889999887654


No 71 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=85.24  E-value=1.2  Score=15.57  Aligned_cols=19  Identities=21%  Similarity=0.691  Sum_probs=11.0

Q ss_pred             ccCCCcccccChhHHHHHHh
Q psy12014         48 RCPLCSYRAKQKIHLTTHMA   67 (78)
Q Consensus        48 ~c~~c~~~f~~~~~l~~h~~   67 (78)
                      .|+.|++.+ ....++.|..
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            577777666 3345555543


No 72 
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=84.88  E-value=0.57  Score=19.17  Aligned_cols=39  Identities=21%  Similarity=0.439  Sum_probs=20.6

Q ss_pred             CCceecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCc
Q psy12014         15 GGLFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCS   53 (78)
Q Consensus        15 ~~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~   53 (78)
                      .+.+.|..||..|.-...-+..-..-.-...|-+|..|.
T Consensus         2 Dk~l~C~dCg~~FvfTa~EQ~fy~eKgf~n~p~RC~~CR   40 (49)
T PF13451_consen    2 DKTLTCKDCGAEFVFTAGEQKFYAEKGFDNEPKRCPSCR   40 (49)
T ss_pred             CeeEEcccCCCeEEEehhHHHHHHhcCCcCCCccCHHHH
Confidence            457889999997774432222211111112356777764


No 73 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=84.56  E-value=1.2  Score=18.96  Aligned_cols=33  Identities=27%  Similarity=0.638  Sum_probs=18.9

Q ss_pred             CceecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcc
Q psy12014         16 GLFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSY   54 (78)
Q Consensus        16 ~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~   54 (78)
                      -.|.|..||........-  - +.  . -.+|.|+.||.
T Consensus        26 v~F~CPnCGe~~I~Rc~~--C-Rk--~-g~~Y~Cp~CGF   58 (61)
T COG2888          26 VKFPCPNCGEVEIYRCAK--C-RK--L-GNPYRCPKCGF   58 (61)
T ss_pred             eEeeCCCCCceeeehhhh--H-HH--c-CCceECCCcCc
Confidence            348888888654433211  1 11  1 34689988873


No 74 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=84.22  E-value=0.96  Score=17.02  Aligned_cols=34  Identities=24%  Similarity=0.447  Sum_probs=20.5

Q ss_pred             eecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCccccc
Q psy12014         18 FSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSYRAK   57 (78)
Q Consensus        18 ~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~   57 (78)
                      ..|+.|+..|......    ....+ . ...|+.|+..|.
T Consensus         3 ~~CP~C~~~~~v~~~~----~~~~~-~-~v~C~~C~~~~~   36 (38)
T TIGR02098         3 IQCPNCKTSFRVVDSQ----LGANG-G-KVRCGKCGHVWY   36 (38)
T ss_pred             EECCCCCCEEEeCHHH----cCCCC-C-EEECCCCCCEEE
Confidence            4688888877654432    11112 2 368999987764


No 75 
>KOG4167|consensus
Probab=83.90  E-value=0.26  Score=31.10  Aligned_cols=25  Identities=28%  Similarity=0.563  Sum_probs=22.8

Q ss_pred             eecCCchhhcCCHHHHHHHhhcccC
Q psy12014         18 FSCSDCSRVYKKKASLTRHQTYECG   42 (78)
Q Consensus        18 ~~c~~c~~~f~~~~~l~~h~~~h~~   42 (78)
                      |.|.+|++.|.....+..||..|.-
T Consensus       793 FpCreC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  793 FPCRECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             eehHHHHHHHHHHhhhhHHHHHHHH
Confidence            8999999999988889999998866


No 76 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=83.69  E-value=0.57  Score=17.34  Aligned_cols=26  Identities=27%  Similarity=0.735  Sum_probs=14.3

Q ss_pred             eecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCccc
Q psy12014         18 FSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSYR   55 (78)
Q Consensus        18 ~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~~   55 (78)
                      |.|..|+..+..          . . ..+.+|..||..
T Consensus         1 Y~C~~Cg~~~~~----------~-~-~~~irC~~CG~R   26 (32)
T PF03604_consen    1 YICGECGAEVEL----------K-P-GDPIRCPECGHR   26 (32)
T ss_dssp             EBESSSSSSE-B----------S-T-SSTSSBSSSS-S
T ss_pred             CCCCcCCCeeEc----------C-C-CCcEECCcCCCe
Confidence            457777765531          1 1 234788888853


No 77 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=83.41  E-value=1.2  Score=17.63  Aligned_cols=30  Identities=30%  Similarity=0.734  Sum_probs=18.8

Q ss_pred             ceecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCccccc
Q psy12014         17 LFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSYRAK   57 (78)
Q Consensus        17 ~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~   57 (78)
                      .|.|..||..+....          . .....|+.||..+.
T Consensus         3 ~y~C~~CG~~~~~~~----------~-~~~~~Cp~CG~~~~   32 (46)
T PRK00398          3 EYKCARCGREVELDE----------Y-GTGVRCPYCGYRIL   32 (46)
T ss_pred             EEECCCCCCEEEECC----------C-CCceECCCCCCeEE
Confidence            578888887664311          1 11478999986443


No 78 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=83.30  E-value=1.6  Score=21.95  Aligned_cols=40  Identities=15%  Similarity=0.512  Sum_probs=26.1

Q ss_pred             cCCCceecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCccccc
Q psy12014         13 KGGGLFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSYRAK   57 (78)
Q Consensus        13 ~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~   57 (78)
                      .+..-|.|+.|+..|.....+..   .... . .|.|+.|+....
T Consensus        95 ~~~~~Y~Cp~C~~~y~~~ea~~~---~d~~-~-~f~Cp~Cg~~l~  134 (147)
T smart00531       95 TNNAYYKCPNCQSKYTFLEANQL---LDMD-G-TFTCPRCGEELE  134 (147)
T ss_pred             cCCcEEECcCCCCEeeHHHHHHh---cCCC-C-cEECCCCCCEEE
Confidence            44567899999999885544321   1111 2 299999997553


No 79 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=82.39  E-value=0.58  Score=21.53  Aligned_cols=33  Identities=18%  Similarity=0.472  Sum_probs=21.7

Q ss_pred             CceecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcccccCh
Q psy12014         16 GLFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSYRAKQK   59 (78)
Q Consensus        16 ~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~~   59 (78)
                      ..|.|+.|++.        .+.+.-++   -|.|..|+..|.-.
T Consensus        34 ~~~~Cp~C~~~--------~VkR~a~G---IW~C~kCg~~fAGg   66 (89)
T COG1997          34 AKHVCPFCGRT--------TVKRIATG---IWKCRKCGAKFAGG   66 (89)
T ss_pred             cCCcCCCCCCc--------ceeeeccC---eEEcCCCCCeeccc
Confidence            46788888865        22344444   48899998877543


No 80 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=81.63  E-value=1.6  Score=17.58  Aligned_cols=20  Identities=20%  Similarity=0.630  Sum_probs=10.7

Q ss_pred             ccCCCcccccCh-----hHHHHHHh
Q psy12014         48 RCPLCSYRAKQK-----IHLTTHMA   67 (78)
Q Consensus        48 ~c~~c~~~f~~~-----~~l~~h~~   67 (78)
                      .|..|++.+...     ++|..|+.
T Consensus        20 ~C~~C~~~l~~~~~~gTs~L~rHl~   44 (50)
T smart00614       20 KCKYCGKKLSRSSKGGTSNLRRHLR   44 (50)
T ss_pred             EecCCCCEeeeCCCCCcHHHHHHHH
Confidence            455565544433     45666655


No 81 
>KOG2593|consensus
Probab=81.35  E-value=0.65  Score=27.50  Aligned_cols=41  Identities=15%  Similarity=0.393  Sum_probs=27.1

Q ss_pred             hhccCCCceecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcc
Q psy12014         10 SLYKGGGLFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSY   54 (78)
Q Consensus        10 ~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~   54 (78)
                      +-.+....|.|+.|.+.|..-..++   ..... .-.|.|..|+.
T Consensus       121 ~d~t~~~~Y~Cp~C~kkyt~Lea~~---L~~~~-~~~F~C~~C~g  161 (436)
T KOG2593|consen  121 RDDTNVAGYVCPNCQKKYTSLEALQ---LLDNE-TGEFHCENCGG  161 (436)
T ss_pred             hhccccccccCCccccchhhhHHHH---hhccc-CceEEEecCCC
Confidence            4455667899999999998766553   32221 22488888864


No 82 
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=80.21  E-value=2  Score=16.76  Aligned_cols=24  Identities=21%  Similarity=0.539  Sum_probs=15.9

Q ss_pred             eecCCchhhcC--CHHHHHHHhhccc
Q psy12014         18 FSCSDCSRVYK--KKASLTRHQTYEC   41 (78)
Q Consensus        18 ~~c~~c~~~f~--~~~~l~~h~~~h~   41 (78)
                      -.|..||..+.  ....-..|.+.|.
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~~yH~   39 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHKKYHD   39 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHHHHHh
Confidence            47888888776  3455666666553


No 83 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=79.79  E-value=1.1  Score=15.73  Aligned_cols=11  Identities=36%  Similarity=0.914  Sum_probs=8.1

Q ss_pred             cccCCCccccc
Q psy12014         47 YRCPLCSYRAK   57 (78)
Q Consensus        47 ~~c~~c~~~f~   57 (78)
                      -.|+.||..|.
T Consensus        15 ~~Cp~CG~~F~   25 (26)
T PF10571_consen   15 KFCPHCGYDFE   25 (26)
T ss_pred             CcCCCCCCCCc
Confidence            36888888774


No 84 
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=79.05  E-value=1.1  Score=19.20  Aligned_cols=46  Identities=17%  Similarity=0.353  Sum_probs=30.0

Q ss_pred             hhhhccCCCceecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcccccC
Q psy12014          8 IDSLYKGGGLFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSYRAKQ   58 (78)
Q Consensus         8 ~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~   58 (78)
                      +..++.+..++.|..-+..+.....+     ..-+......|+.|+..|..
T Consensus        15 ~~~I~~~~~~l~C~g~~~p~~HPrV~-----L~mg~~gev~CPYC~t~y~l   60 (62)
T COG4391          15 HETIEIGDLPLMCPGPEPPNDHPRVF-----LDMGDEGEVVCPYCSTRYRL   60 (62)
T ss_pred             ceEEEeCCeeEEcCCCCCCCCCCEEE-----EEcCCCCcEecCccccEEEe
Confidence            56677888999998877666544321     11132444689999987764


No 85 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=78.77  E-value=1.8  Score=24.72  Aligned_cols=56  Identities=23%  Similarity=0.526  Sum_probs=43.2

Q ss_pred             CCceecCCchhhcCCHHHHHHHhhcccCCCCCcccCC--CcccccChhHHHHHHhhhhc
Q psy12014         15 GGLFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPL--CSYRAKQKIHLTTHMAIRHH   71 (78)
Q Consensus        15 ~~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~--c~~~f~~~~~l~~h~~~~~g   71 (78)
                      ...+.|..|...|........|.+.+.+ .++..|..  |...+.....+..+...++.
T Consensus        31 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   88 (467)
T COG5048          31 PRPDSCPNCTDSFSRLEHLTRHIRSHTG-EKPSQCSYSGCDKSFSRPLELSRHLRTHHN   88 (467)
T ss_pred             Cchhhcccccccccccchhhhhcccccc-cCCccccccccccccCCcchhhhhcccccc
Confidence            4567889999999988889999999999 77788876  45666666667777666653


No 86 
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=77.52  E-value=1.1  Score=17.71  Aligned_cols=12  Identities=25%  Similarity=0.708  Sum_probs=9.4

Q ss_pred             ccCCCcccccCh
Q psy12014         48 RCPLCSYRAKQK   59 (78)
Q Consensus        48 ~c~~c~~~f~~~   59 (78)
                      .|..|++.|...
T Consensus        10 ~C~~C~rpf~WR   21 (42)
T PF10013_consen   10 ICPVCGRPFTWR   21 (42)
T ss_pred             cCcccCCcchHH
Confidence            688888888754


No 87 
>PHA00626 hypothetical protein
Probab=75.67  E-value=2  Score=18.10  Aligned_cols=17  Identities=29%  Similarity=0.554  Sum_probs=13.0

Q ss_pred             CCceecCCchhhcCCHH
Q psy12014         15 GGLFSCSDCSRVYKKKA   31 (78)
Q Consensus        15 ~~~~~c~~c~~~f~~~~   31 (78)
                      ...|.|..|+..|+...
T Consensus        21 snrYkCkdCGY~ft~~~   37 (59)
T PHA00626         21 SDDYVCCDCGYNDSKDA   37 (59)
T ss_pred             CcceEcCCCCCeechhh
Confidence            46799999998887543


No 88 
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=74.53  E-value=0.77  Score=18.96  Aligned_cols=26  Identities=15%  Similarity=0.453  Sum_probs=13.7

Q ss_pred             CCceecCCchhhcCCHHHHHHHhhcc
Q psy12014         15 GGLFSCSDCSRVYKKKASLTRHQTYE   40 (78)
Q Consensus        15 ~~~~~c~~c~~~f~~~~~l~~h~~~h   40 (78)
                      ...|.|+.|...|...-++-.|...|
T Consensus        19 ~~~y~C~~C~~~FC~dCD~fiHE~LH   44 (51)
T PF07975_consen   19 SSRYRCPKCKNHFCIDCDVFIHETLH   44 (51)
T ss_dssp             -EEE--TTTT--B-HHHHHTTTTTS-
T ss_pred             CCeEECCCCCCccccCcChhhhcccc
Confidence            35699999999998776665665544


No 89 
>PF12907 zf-met2:  Zinc-binding
Probab=73.73  E-value=0.7  Score=18.08  Aligned_cols=9  Identities=22%  Similarity=0.885  Sum_probs=4.3

Q ss_pred             ecCCchhhc
Q psy12014         19 SCSDCSRVY   27 (78)
Q Consensus        19 ~c~~c~~~f   27 (78)
                      .|.+|...|
T Consensus         3 ~C~iC~qtF   11 (40)
T PF12907_consen    3 ICKICRQTF   11 (40)
T ss_pred             CcHHhhHHH
Confidence            455555433


No 90 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=73.60  E-value=4.8  Score=15.56  Aligned_cols=20  Identities=25%  Similarity=0.536  Sum_probs=8.5

Q ss_pred             cccCCCcccccCh----hHHHHHH
Q psy12014         47 YRCPLCSYRAKQK----IHLTTHM   66 (78)
Q Consensus        47 ~~c~~c~~~f~~~----~~l~~h~   66 (78)
                      ..|..|++.+...    +.|..|+
T Consensus        17 a~C~~C~~~~~~~~~~ts~l~~HL   40 (45)
T PF02892_consen   17 AKCKYCGKVIKYSSGGTSNLKRHL   40 (45)
T ss_dssp             EEETTTTEE-----SSTHHHHHHH
T ss_pred             EEeCCCCeEEeeCCCcHHHHHHhh
Confidence            4566665544432    4455554


No 91 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=73.42  E-value=2.3  Score=17.44  Aligned_cols=29  Identities=24%  Similarity=0.589  Sum_probs=18.6

Q ss_pred             CCceecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcc
Q psy12014         15 GGLFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSY   54 (78)
Q Consensus        15 ~~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~   54 (78)
                      ...|.|..|++.+...       .   . ....+|+.||.
T Consensus         4 ~~~Y~C~~Cg~~~~~~-------~---~-~~~irCp~Cg~   32 (49)
T COG1996           4 MMEYKCARCGREVELD-------Q---E-TRGIRCPYCGS   32 (49)
T ss_pred             eEEEEhhhcCCeeehh-------h---c-cCceeCCCCCc
Confidence            3468899999887211       1   1 33478998874


No 92 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=72.97  E-value=3.3  Score=20.55  Aligned_cols=30  Identities=10%  Similarity=0.172  Sum_probs=20.5

Q ss_pred             eecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcccccCh
Q psy12014         18 FSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSYRAKQK   59 (78)
Q Consensus        18 ~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~~   59 (78)
                      ..|..||..|=   .|        . +.|..|+.||..+...
T Consensus        10 r~Cp~cg~kFY---DL--------n-k~p~vcP~cg~~~~~~   39 (129)
T TIGR02300        10 RICPNTGSKFY---DL--------N-RRPAVSPYTGEQFPPE   39 (129)
T ss_pred             ccCCCcCcccc---cc--------C-CCCccCCCcCCccCcc
Confidence            47888887652   11        2 5678899999877554


No 93 
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=72.73  E-value=2.2  Score=16.16  Aligned_cols=31  Identities=19%  Similarity=0.462  Sum_probs=15.8

Q ss_pred             eecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCccccc
Q psy12014         18 FSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSYRAK   57 (78)
Q Consensus        18 ~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~   57 (78)
                      +.|..||..|-        ...... ..+-.|..||..+.
T Consensus         2 r~C~~Cg~~Yh--------~~~~pP-~~~~~Cd~cg~~L~   32 (36)
T PF05191_consen    2 RICPKCGRIYH--------IEFNPP-KVEGVCDNCGGELV   32 (36)
T ss_dssp             EEETTTTEEEE--------TTTB---SSTTBCTTTTEBEB
T ss_pred             cCcCCCCCccc--------cccCCC-CCCCccCCCCCeeE
Confidence            35667776653        222223 33457777775443


No 94 
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=72.70  E-value=2.4  Score=19.08  Aligned_cols=31  Identities=23%  Similarity=0.716  Sum_probs=18.3

Q ss_pred             eecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcccc
Q psy12014         18 FSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSYRA   56 (78)
Q Consensus        18 ~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~~f   56 (78)
                      |.|..|+..|.    +-.++.   . ..--.|..|+..+
T Consensus        13 Y~c~~cg~~~d----vvq~~~---d-dplt~ce~c~a~~   43 (82)
T COG2331          13 YECTECGNRFD----VVQAMT---D-DPLTTCEECGARL   43 (82)
T ss_pred             EeecccchHHH----HHHhcc---c-CccccChhhChHH
Confidence            78999998774    222333   1 2223688887543


No 95 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=71.91  E-value=1.9  Score=14.88  Aligned_cols=8  Identities=38%  Similarity=1.315  Sum_probs=4.8

Q ss_pred             CcccCCCc
Q psy12014         46 KYRCPLCS   53 (78)
Q Consensus        46 ~~~c~~c~   53 (78)
                      +|.|+.||
T Consensus        16 ~f~CPnCG   23 (24)
T PF07754_consen   16 PFPCPNCG   23 (24)
T ss_pred             eEeCCCCC
Confidence            46666665


No 96 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=71.81  E-value=3.1  Score=17.74  Aligned_cols=33  Identities=24%  Similarity=0.708  Sum_probs=17.5

Q ss_pred             CceecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcc
Q psy12014         16 GLFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSY   54 (78)
Q Consensus        16 ~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~   54 (78)
                      -.|.|..||.....+-.  .-..   . -.+|.|+.||.
T Consensus        24 ~~F~CPnCG~~~I~RC~--~CRk---~-~~~Y~CP~CGF   56 (59)
T PRK14890         24 VKFLCPNCGEVIIYRCE--KCRK---Q-SNPYTCPKCGF   56 (59)
T ss_pred             CEeeCCCCCCeeEeech--hHHh---c-CCceECCCCCC
Confidence            45788888875222211  0111   1 34688888873


No 97 
>KOG1146|consensus
Probab=71.63  E-value=2.8  Score=28.62  Aligned_cols=56  Identities=25%  Similarity=0.398  Sum_probs=41.9

Q ss_pred             CCceecCCchhhcCCHHHHHHHhhcccCC----------------CCCcccCCCcccccChhHHHHHHhhhhc
Q psy12014         15 GGLFSCSDCSRVYKKKASLTRHQTYECGQ----------------QPKYRCPLCSYRAKQKIHLTTHMAIRHH   71 (78)
Q Consensus        15 ~~~~~c~~c~~~f~~~~~l~~h~~~h~~~----------------~~~~~c~~c~~~f~~~~~l~~h~~~~~g   71 (78)
                      ..+|.|..|...|.....|..|++...-.                ..++ |..|...|+....|..|++.-.+
T Consensus      1282 ~~~~~~~~~~~~~~~~~~l~~~~~k~~~~~~~~~~~~~~~l~~~d~~~~-c~~c~~~~~~~~alqihm~~~~~ 1353 (1406)
T KOG1146|consen 1282 THRYLCRQCKMAFDGEAPLTAHQRKFCFAGRGSGGSMPPPLRVPDCTYH-CLACEVLLSGREALQIHMRSSAH 1353 (1406)
T ss_pred             chhHHHHHHHhhhcchhHHHHHHHHHHhccCccccCCCCcccCcccccc-chHHHhhcchhHHHHHHHHHhhh
Confidence            56788999999999998888887522100                1235 88899999999999999886544


No 98 
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=71.46  E-value=1.6  Score=21.67  Aligned_cols=15  Identities=20%  Similarity=0.744  Sum_probs=11.8

Q ss_pred             CceecCCchhhcCCH
Q psy12014         16 GLFSCSDCSRVYKKK   30 (78)
Q Consensus        16 ~~~~c~~c~~~f~~~   30 (78)
                      ..+.|..||..|...
T Consensus        69 ~~~~C~~CG~~~~~~   83 (135)
T PRK03824         69 AVLKCRNCGNEWSLK   83 (135)
T ss_pred             eEEECCCCCCEEecc
Confidence            458999999888654


No 99 
>PLN02294 cytochrome c oxidase subunit Vb
Probab=71.04  E-value=2.5  Score=22.04  Aligned_cols=15  Identities=27%  Similarity=0.826  Sum_probs=11.0

Q ss_pred             CCceecCCchhhcCC
Q psy12014         15 GGLFSCSDCSRVYKK   29 (78)
Q Consensus        15 ~~~~~c~~c~~~f~~   29 (78)
                      +++++|..||..|..
T Consensus       139 Gkp~RCpeCG~~fkL  153 (174)
T PLN02294        139 GKSFECPVCTQYFEL  153 (174)
T ss_pred             CCceeCCCCCCEEEE
Confidence            467788888887753


No 100
>KOG4173|consensus
Probab=69.04  E-value=4  Score=22.12  Aligned_cols=49  Identities=31%  Similarity=0.508  Sum_probs=25.6

Q ss_pred             ecCCchhhcCCHHHHHHHhhc-c---------cCCCCCcccCC--CcccccChhHHHHHHhh
Q psy12014         19 SCSDCSRVYKKKASLTRHQTY-E---------CGQQPKYRCPL--CSYRAKQKIHLTTHMAI   68 (78)
Q Consensus        19 ~c~~c~~~f~~~~~l~~h~~~-h---------~~~~~~~~c~~--c~~~f~~~~~l~~h~~~   68 (78)
                      .|..|.+.|+....|..|+.. |         .| ..-|+|.+  |+.-|........|+..
T Consensus       108 sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG-~dMy~ClvEgCt~KFkT~r~RkdH~I~  168 (253)
T KOG4173|consen  108 SCSFCKRAFPTGHLLDAHILEWHDSLFQALVERG-QDMYQCLVEGCTEKFKTSRDRKDHMIR  168 (253)
T ss_pred             hhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcC-ccHHHHHHHhhhhhhhhhhhhhhHHHH
Confidence            566666666666555555432 1         22 22355544  55566555555555544


No 101
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=68.78  E-value=3.1  Score=19.62  Aligned_cols=14  Identities=29%  Similarity=0.710  Sum_probs=10.3

Q ss_pred             CceecCCchhhcCC
Q psy12014         16 GLFSCSDCSRVYKK   29 (78)
Q Consensus        16 ~~~~c~~c~~~f~~   29 (78)
                      ++++|..||..|..
T Consensus        78 ~~~rC~eCG~~fkL   91 (97)
T cd00924          78 KPKRCPECGHVFKL   91 (97)
T ss_pred             CceeCCCCCcEEEE
Confidence            67788888877753


No 102
>KOG2785|consensus
Probab=66.71  E-value=11  Score=22.38  Aligned_cols=52  Identities=19%  Similarity=0.236  Sum_probs=37.7

Q ss_pred             ceecCCchhhcCCHHHHHHHhhcccCCCC----------------------CcccCCCc---ccccChhHHHHHHhh
Q psy12014         17 LFSCSDCSRVYKKKASLTRHQTYECGQQP----------------------KYRCPLCS---YRAKQKIHLTTHMAI   68 (78)
Q Consensus        17 ~~~c~~c~~~f~~~~~l~~h~~~h~~~~~----------------------~~~c~~c~---~~f~~~~~l~~h~~~   68 (78)
                      |=.|..|+..+..-..-..||..+.+..-                      -+.|..|.   +.|........|+..
T Consensus       166 Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  166 PTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             CcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            44588898888877666678887655322                      25777787   888888888888764


No 103
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=65.97  E-value=2.9  Score=16.29  Aligned_cols=30  Identities=17%  Similarity=0.571  Sum_probs=19.4

Q ss_pred             ceecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcc
Q psy12014         17 LFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSY   54 (78)
Q Consensus        17 ~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~   54 (78)
                      .|.|..||..|....      ....  ..+..|+.|+.
T Consensus         5 ey~C~~Cg~~fe~~~------~~~~--~~~~~CP~Cg~   34 (42)
T PF09723_consen    5 EYRCEECGHEFEVLQ------SISE--DDPVPCPECGS   34 (42)
T ss_pred             EEEeCCCCCEEEEEE------EcCC--CCCCcCCCCCC
Confidence            378999998886422      2222  23468999986


No 104
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=65.70  E-value=3.1  Score=15.70  Aligned_cols=30  Identities=20%  Similarity=0.548  Sum_probs=18.8

Q ss_pred             ceecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcc
Q psy12014         17 LFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSY   54 (78)
Q Consensus        17 ~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~   54 (78)
                      .|.|..|+..|.....      ...+ . ...|+.||.
T Consensus         5 ~y~C~~Cg~~fe~~~~------~~~~-~-~~~CP~Cg~   34 (41)
T smart00834        5 EYRCEDCGHTFEVLQK------ISDD-P-LATCPECGG   34 (41)
T ss_pred             EEEcCCCCCEEEEEEe------cCCC-C-CCCCCCCCC
Confidence            3789999998763321      1112 2 367999986


No 105
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=65.37  E-value=5.6  Score=15.97  Aligned_cols=23  Identities=35%  Similarity=0.798  Sum_probs=15.9

Q ss_pred             cccCCCcccccChhHHHHHHhhh
Q psy12014         47 YRCPLCSYRAKQKIHLTTHMAIR   69 (78)
Q Consensus        47 ~~c~~c~~~f~~~~~l~~h~~~~   69 (78)
                      |+|-.|..+....+.|-.|+...
T Consensus        21 ykcfqcpftc~~kshl~nhmky~   43 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMKYS   43 (54)
T ss_pred             ceeecCCcccchHHHHHHHHHHH
Confidence            56777776667777777777643


No 106
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=64.76  E-value=3.7  Score=20.49  Aligned_cols=14  Identities=14%  Similarity=0.358  Sum_probs=9.4

Q ss_pred             CcccCCCcccccCh
Q psy12014         46 KYRCPLCSYRAKQK   59 (78)
Q Consensus        46 ~~~c~~c~~~f~~~   59 (78)
                      |.+|..||+.|...
T Consensus         1 PH~Ct~Cg~~f~dg   14 (131)
T PF09845_consen    1 PHQCTKCGRVFEDG   14 (131)
T ss_pred             CcccCcCCCCcCCC
Confidence            46677777777644


No 107
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=64.33  E-value=5.5  Score=16.18  Aligned_cols=30  Identities=27%  Similarity=0.812  Sum_probs=13.0

Q ss_pred             ecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcc
Q psy12014         19 SCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSY   54 (78)
Q Consensus        19 ~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~   54 (78)
                      .|..- ..|+....|...+.     ...|.|+.|++
T Consensus        20 ~C~H~-~CFDl~~fl~~~~~-----~~~W~CPiC~~   49 (50)
T PF02891_consen   20 NCKHL-QCFDLESFLESNQR-----TPKWKCPICNK   49 (50)
T ss_dssp             T--SS---EEHHHHHHHHHH-----S---B-TTT--
T ss_pred             cCccc-ceECHHHHHHHhhc-----cCCeECcCCcC
Confidence            34443 35777777765554     33389999875


No 108
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=63.43  E-value=3.7  Score=20.83  Aligned_cols=28  Identities=18%  Similarity=0.469  Sum_probs=16.8

Q ss_pred             ceecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCccc
Q psy12014         17 LFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSYR   55 (78)
Q Consensus        17 ~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~~   55 (78)
                      .+.|..||....         ..+++ .- -.|+.|+..
T Consensus       112 ~l~C~~Cg~~~~---------~~~~~-~l-~~Cp~C~~~  139 (146)
T PF07295_consen  112 TLVCENCGHEVE---------LTHPE-RL-PPCPKCGHT  139 (146)
T ss_pred             eEecccCCCEEE---------ecCCC-cC-CCCCCCCCC
Confidence            488998886532         12333 33 478888753


No 109
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=63.41  E-value=6.7  Score=18.89  Aligned_cols=26  Identities=27%  Similarity=0.593  Sum_probs=21.4

Q ss_pred             CCCceecCCchhhcCCHHHHHHHhhc
Q psy12014         14 GGGLFSCSDCSRVYKKKASLTRHQTY   39 (78)
Q Consensus        14 ~~~~~~c~~c~~~f~~~~~l~~h~~~   39 (78)
                      |...+.|..|.+-|.....|..|.+.
T Consensus        52 GlGqhYCieCaryf~t~~aL~~Hkkg   77 (126)
T COG5112          52 GLGQHYCIECARYFITEKALMEHKKG   77 (126)
T ss_pred             CCceeeeehhHHHHHHHHHHHHHhcc
Confidence            44568899999999999989888764


No 110
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=62.50  E-value=1.9  Score=15.50  Aligned_cols=8  Identities=50%  Similarity=1.373  Sum_probs=3.7

Q ss_pred             cCCchhhc
Q psy12014         20 CSDCSRVY   27 (78)
Q Consensus        20 c~~c~~~f   27 (78)
                      |..|++.|
T Consensus         3 CiDC~~~F   10 (28)
T PF08790_consen    3 CIDCSKDF   10 (28)
T ss_dssp             ETTTTEEE
T ss_pred             eecCCCCc
Confidence            44444444


No 111
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=62.28  E-value=5.6  Score=19.13  Aligned_cols=25  Identities=24%  Similarity=0.772  Sum_probs=14.4

Q ss_pred             eecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCccc
Q psy12014         18 FSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSYR   55 (78)
Q Consensus        18 ~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~~   55 (78)
                      ..|..|+..|....            .. +.|+.|+..
T Consensus        71 ~~C~~Cg~~~~~~~------------~~-~~CP~Cgs~   95 (113)
T PF01155_consen   71 ARCRDCGHEFEPDE------------FD-FSCPRCGSP   95 (113)
T ss_dssp             EEETTTS-EEECHH------------CC-HH-SSSSSS
T ss_pred             EECCCCCCEEecCC------------CC-CCCcCCcCC
Confidence            67888888776533            11 567777653


No 112
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=61.45  E-value=4.6  Score=15.54  Aligned_cols=14  Identities=14%  Similarity=0.449  Sum_probs=10.4

Q ss_pred             CcccCCCcccccCh
Q psy12014         46 KYRCPLCSYRAKQK   59 (78)
Q Consensus        46 ~~~c~~c~~~f~~~   59 (78)
                      |+.|..|+..|-..
T Consensus        12 ~f~C~~C~~~FC~~   25 (39)
T smart00154       12 GFKCRHCGNLFCGE   25 (39)
T ss_pred             CeECCccCCccccc
Confidence            68888888877544


No 113
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=61.38  E-value=6.8  Score=19.04  Aligned_cols=49  Identities=14%  Similarity=0.288  Sum_probs=30.9

Q ss_pred             ecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcccccChhHHHHHHhhhh
Q psy12014         19 SCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSYRAKQKIHLTTHMAIRH   70 (78)
Q Consensus        19 ~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~   70 (78)
                      .|--|...|........-.  -.. ...|+|..|...|-.+...-.|..+|.
T Consensus        57 ~C~~C~~~f~~~~~~~~~~--~~~-~~~y~C~~C~~~FC~dCD~fiHe~Lh~  105 (112)
T TIGR00622        57 FCFGCQGPFPKPPVSPFDE--LKD-SHRYVCAVCKNVFCVDCDVFVHESLHC  105 (112)
T ss_pred             cccCcCCCCCCcccccccc--ccc-ccceeCCCCCCccccccchhhhhhccC
Confidence            3777777776432111110  122 335899999999988888878877764


No 114
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=61.01  E-value=3.5  Score=16.89  Aligned_cols=12  Identities=33%  Similarity=0.897  Sum_probs=6.4

Q ss_pred             ccCCCcccccCh
Q psy12014         48 RCPLCSYRAKQK   59 (78)
Q Consensus        48 ~c~~c~~~f~~~   59 (78)
                      .|++|++.|...
T Consensus        22 ~CPlC~r~l~~e   33 (54)
T PF04423_consen   22 CCPLCGRPLDEE   33 (54)
T ss_dssp             E-TTT--EE-HH
T ss_pred             cCCCCCCCCCHH
Confidence            899999988644


No 115
>KOG2636|consensus
Probab=60.57  E-value=7.3  Score=23.66  Aligned_cols=29  Identities=28%  Similarity=0.466  Sum_probs=18.0

Q ss_pred             hhccCCCceecCCch-hhcCCHHHHHHHhh
Q psy12014         10 SLYKGGGLFSCSDCS-RVYKKKASLTRHQT   38 (78)
Q Consensus        10 ~~~~~~~~~~c~~c~-~~f~~~~~l~~h~~   38 (78)
                      ..|.-+..|.|.+|| .++--+..+.+|-.
T Consensus       394 KLHGL~~ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  394 KLHGLDIEYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             hhcCCCcccceeeccCccccCcHHHHHHhH
Confidence            345556777888887 45555555666543


No 116
>KOG2071|consensus
Probab=60.05  E-value=7.6  Score=24.30  Aligned_cols=27  Identities=22%  Similarity=0.464  Sum_probs=17.4

Q ss_pred             CCCcccCCCcccccChhHHHHHHhhhh
Q psy12014         44 QPKYRCPLCSYRAKQKIHLTTHMAIRH   70 (78)
Q Consensus        44 ~~~~~c~~c~~~f~~~~~l~~h~~~~~   70 (78)
                      ..|-+|..||..|........|+..|.
T Consensus       416 ~~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  416 DSPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             CCcchhcccccccccchhhhhHhhhhh
Confidence            345667777777776666666666554


No 117
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=59.14  E-value=4.5  Score=16.27  Aligned_cols=30  Identities=20%  Similarity=0.586  Sum_probs=19.0

Q ss_pred             ceecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcc
Q psy12014         17 LFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSY   54 (78)
Q Consensus        17 ~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~   54 (78)
                      .|.|..|+..|....      ....  ..+..|+.|+.
T Consensus         5 ey~C~~Cg~~fe~~~------~~~~--~~~~~CP~Cg~   34 (52)
T TIGR02605         5 EYRCTACGHRFEVLQ------KMSD--DPLATCPECGG   34 (52)
T ss_pred             EEEeCCCCCEeEEEE------ecCC--CCCCCCCCCCC
Confidence            378999999886421      1111  23367999985


No 118
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=58.64  E-value=3.3  Score=16.19  Aligned_cols=15  Identities=20%  Similarity=0.445  Sum_probs=8.6

Q ss_pred             CCcccCCCcccccCh
Q psy12014         45 PKYRCPLCSYRAKQK   59 (78)
Q Consensus        45 ~~~~c~~c~~~f~~~   59 (78)
                      .|+.|..|+..|-..
T Consensus        12 ~~~~C~~C~~~FC~~   26 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLK   26 (43)
T ss_dssp             SHEE-TTTS-EE-TT
T ss_pred             CCeECCCCCcccCcc
Confidence            467888888877543


No 119
>KOG0717|consensus
Probab=55.98  E-value=7.2  Score=23.81  Aligned_cols=22  Identities=23%  Similarity=0.421  Sum_probs=18.4

Q ss_pred             cccCCCcccccChhHHHHHHhh
Q psy12014         47 YRCPLCSYRAKQKIHLTTHMAI   68 (78)
Q Consensus        47 ~~c~~c~~~f~~~~~l~~h~~~   68 (78)
                      +-|.+|.++|.....+..|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            6799999999998888888654


No 120
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=55.02  E-value=6.3  Score=18.83  Aligned_cols=15  Identities=20%  Similarity=0.616  Sum_probs=11.9

Q ss_pred             CceecCCchhhcCCH
Q psy12014         16 GLFSCSDCSRVYKKK   30 (78)
Q Consensus        16 ~~~~c~~c~~~f~~~   30 (78)
                      .|+.|..||..|..-
T Consensus         1 MpH~CtrCG~vf~~g   15 (112)
T COG3364           1 MPHQCTRCGEVFDDG   15 (112)
T ss_pred             CCceecccccccccc
Confidence            378899999998863


No 121
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=53.80  E-value=7  Score=21.53  Aligned_cols=18  Identities=22%  Similarity=0.741  Sum_probs=14.2

Q ss_pred             CCCceecCCchhhcCCHH
Q psy12014         14 GGGLFSCSDCSRVYKKKA   31 (78)
Q Consensus        14 ~~~~~~c~~c~~~f~~~~   31 (78)
                      .+++.+|..||..|....
T Consensus       178 EGkpqRCpECGqVFKLVr  195 (268)
T PTZ00043        178 EGFLYRCGECDQIFMLVR  195 (268)
T ss_pred             CCCCccCCCCCcEEEEEE
Confidence            456889999999997543


No 122
>COG1773 Rubredoxin [Energy production and conversion]
Probab=53.08  E-value=6.9  Score=16.48  Aligned_cols=14  Identities=36%  Similarity=0.819  Sum_probs=11.2

Q ss_pred             ceecCCchhhcCCH
Q psy12014         17 LFSCSDCSRVYKKK   30 (78)
Q Consensus        17 ~~~c~~c~~~f~~~   30 (78)
                      .|+|..||..|...
T Consensus         3 ~~~C~~CG~vYd~e   16 (55)
T COG1773           3 RWRCSVCGYVYDPE   16 (55)
T ss_pred             ceEecCCceEeccc
Confidence            58899999888754


No 123
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=52.08  E-value=6  Score=19.92  Aligned_cols=15  Identities=33%  Similarity=0.844  Sum_probs=10.9

Q ss_pred             CCceecCCchhhcCC
Q psy12014         15 GGLFSCSDCSRVYKK   29 (78)
Q Consensus        15 ~~~~~c~~c~~~f~~   29 (78)
                      +++.+|..||..|..
T Consensus       110 g~~~RCpeCG~~fkL  124 (136)
T PF01215_consen  110 GKPQRCPECGQVFKL  124 (136)
T ss_dssp             TSEEEETTTEEEEEE
T ss_pred             CCccCCCCCCeEEEE
Confidence            357788888887764


No 124
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=51.30  E-value=12  Score=22.80  Aligned_cols=40  Identities=28%  Similarity=0.542  Sum_probs=23.1

Q ss_pred             CCCceecCCchhhcCCHHHHHHHhhcccCC-----CCCcccCCCcc
Q psy12014         14 GGGLFSCSDCSRVYKKKASLTRHQTYECGQ-----QPKYRCPLCSY   54 (78)
Q Consensus        14 ~~~~~~c~~c~~~f~~~~~l~~h~~~h~~~-----~~~~~c~~c~~   54 (78)
                      ..+.|.|..|+..+....--.. +.+..+.     ...|.|+.|+.
T Consensus       422 ~~~~~~c~~c~~~yd~~~g~~~-~~~~~gt~~~~lp~~~~cp~c~~  466 (479)
T PRK05452        422 LGPRMQCSVCQWIYDPAKGEPM-QDVAPGTPWSEVPDNFLCPECSL  466 (479)
T ss_pred             CCCeEEECCCCeEECCCCCCcc-cCCCCCCChhhCCCCCcCcCCCC
Confidence            4567999999998875421111 1111110     12389999974


No 125
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=50.99  E-value=8.3  Score=19.85  Aligned_cols=34  Identities=32%  Similarity=0.705  Sum_probs=19.1

Q ss_pred             CCceecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcc
Q psy12014         15 GGLFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSY   54 (78)
Q Consensus        15 ~~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~   54 (78)
                      .-+|.|. |+..+....   +|-..-.| + .|.|..|+.
T Consensus       115 ~~~Y~C~-C~q~~l~~R---Rhn~~~~g-~-~YrC~~C~g  148 (156)
T COG3091         115 TYPYRCQ-CQQHYLRIR---RHNTVRRG-E-VYRCGKCGG  148 (156)
T ss_pred             ceeEEee-cCCccchhh---hccccccc-c-eEEeccCCc
Confidence            3457777 777665432   33333344 3 477777754


No 126
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=50.90  E-value=7.7  Score=19.25  Aligned_cols=17  Identities=18%  Similarity=0.700  Sum_probs=12.9

Q ss_pred             CCCceecCCchhhcCCH
Q psy12014         14 GGGLFSCSDCSRVYKKK   30 (78)
Q Consensus        14 ~~~~~~c~~c~~~f~~~   30 (78)
                      |...|.|..|++.|...
T Consensus        50 ~~qRyrC~~C~~tf~~~   66 (129)
T COG3677          50 GHQRYKCKSCGSTFTVE   66 (129)
T ss_pred             cccccccCCcCcceeee
Confidence            35678999999888743


No 127
>KOG2231|consensus
Probab=50.85  E-value=23  Score=22.88  Aligned_cols=47  Identities=21%  Similarity=0.414  Sum_probs=29.6

Q ss_pred             ecCCchhhcCCHHHHHHHhhcccCCCCCcccCCC------cccccChhHHHHHHhhhh
Q psy12014         19 SCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLC------SYRAKQKIHLTTHMAIRH   70 (78)
Q Consensus        19 ~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c------~~~f~~~~~l~~h~~~~~   70 (78)
                      .|..|...|.....|..|++.+.     +.|..|      ...|.....|..|.+..+
T Consensus       184 ~C~~C~~~fld~~el~rH~~~~h-----~~chfC~~~~~~neyy~~~~dLe~HfR~~H  236 (669)
T KOG2231|consen  184 LCKFCHERFLDDDELYRHLRFDH-----EFCHFCDYKTGQNEYYNDYDDLEEHFRKGH  236 (669)
T ss_pred             cchhhhhhhccHHHHHHhhccce-----eheeecCcccccchhcccchHHHHHhhhcC
Confidence            57778888887777888877432     344444      234555666777766554


No 128
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=48.34  E-value=7.5  Score=18.80  Aligned_cols=25  Identities=36%  Similarity=0.773  Sum_probs=15.4

Q ss_pred             ceecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcc
Q psy12014         17 LFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSY   54 (78)
Q Consensus        17 ~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~   54 (78)
                      ...|..|+..|....             ..+.|+.|+.
T Consensus        70 ~~~C~~Cg~~~~~~~-------------~~~~CP~Cgs   94 (115)
T TIGR00100        70 ECECEDCSEEVSPEI-------------DLYRCPKCHG   94 (115)
T ss_pred             EEEcccCCCEEecCC-------------cCccCcCCcC
Confidence            367888887665321             1256888874


No 129
>PRK14873 primosome assembly protein PriA; Provisional
Probab=48.14  E-value=18  Score=23.22  Aligned_cols=10  Identities=50%  Similarity=1.457  Sum_probs=6.6

Q ss_pred             CCcccCCCcc
Q psy12014         45 PKYRCPLCSY   54 (78)
Q Consensus        45 ~~~~c~~c~~   54 (78)
                      .|+.|+.|+.
T Consensus       421 ~p~~Cp~Cgs  430 (665)
T PRK14873        421 PDWRCPRCGS  430 (665)
T ss_pred             cCccCCCCcC
Confidence            3567777764


No 130
>KOG1280|consensus
Probab=47.97  E-value=25  Score=20.82  Aligned_cols=39  Identities=21%  Similarity=0.415  Sum_probs=25.3

Q ss_pred             CCceecCCchhhcCCHHHHHHHhhc-ccCCCCCcccCCCc
Q psy12014         15 GGLFSCSDCSRVYKKKASLTRHQTY-ECGQQPKYRCPLCS   53 (78)
Q Consensus        15 ~~~~~c~~c~~~f~~~~~l~~h~~~-h~~~~~~~~c~~c~   53 (78)
                      ...|.|..|+..--....+..|... |........|++|.
T Consensus        77 ~qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   77 PQSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             cccccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            3568999999866666667777544 55423234577765


No 131
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=47.50  E-value=22  Score=21.89  Aligned_cols=25  Identities=20%  Similarity=0.449  Sum_probs=16.0

Q ss_pred             eecCCchhhcCCHHHHHHHhhc-ccC
Q psy12014         18 FSCSDCSRVYKKKASLTRHQTY-ECG   42 (78)
Q Consensus        18 ~~c~~c~~~f~~~~~l~~h~~~-h~~   42 (78)
                      |.|..|.+.|.....+..|+.. |.+
T Consensus        58 WiCp~CskkF~d~~~~~~H~~~eH~~   83 (466)
T PF04780_consen   58 WICPRCSKKFSDAESCLSHMEQEHPA   83 (466)
T ss_pred             eeCCcccceeCCHHHHHHHHHHhhhh
Confidence            4566777777777666666653 444


No 132
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=47.07  E-value=8.5  Score=19.78  Aligned_cols=14  Identities=21%  Similarity=0.308  Sum_probs=11.5

Q ss_pred             cccCCCcccccChh
Q psy12014         47 YRCPLCSYRAKQKI   60 (78)
Q Consensus        47 ~~c~~c~~~f~~~~   60 (78)
                      ++|+.||.+|...-
T Consensus        29 ~~c~~c~~~f~~~e   42 (154)
T PRK00464         29 RECLACGKRFTTFE   42 (154)
T ss_pred             eeccccCCcceEeE
Confidence            78999999987553


No 133
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=46.59  E-value=10  Score=18.32  Aligned_cols=25  Identities=32%  Similarity=0.612  Sum_probs=15.3

Q ss_pred             ceecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcc
Q psy12014         17 LFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSY   54 (78)
Q Consensus        17 ~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~   54 (78)
                      ...|..|+..|....             ..+.|+.|+.
T Consensus        70 ~~~C~~Cg~~~~~~~-------------~~~~CP~Cgs   94 (113)
T PRK12380         70 QAWCWDCSQVVEIHQ-------------HDAQCPHCHG   94 (113)
T ss_pred             EEEcccCCCEEecCC-------------cCccCcCCCC
Confidence            367888886664321             1256888874


No 134
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=46.51  E-value=18  Score=18.25  Aligned_cols=46  Identities=15%  Similarity=0.239  Sum_probs=24.7

Q ss_pred             eecCCchhhcCCHHHHHHHhhcccC----CCCCcccCCCcccccChhHHH
Q psy12014         18 FSCSDCSRVYKKKASLTRHQTYECG----QQPKYRCPLCSYRAKQKIHLT   63 (78)
Q Consensus        18 ~~c~~c~~~f~~~~~l~~h~~~h~~----~~~~~~c~~c~~~f~~~~~l~   63 (78)
                      -.|..|+..+...+.-.........    ...=+.|+.|++.|..-++..
T Consensus        92 sRC~~CN~~L~~v~~~~v~~~vp~~v~~~~~~f~~C~~C~kiyW~GsH~~  141 (147)
T PF01927_consen   92 SRCPKCNGPLRPVSKEEVKDRVPPYVYETYDEFWRCPGCGKIYWEGSHWR  141 (147)
T ss_pred             CccCCCCcEeeechhhccccccCccccccCCeEEECCCCCCEecccccHH
Confidence            4799998866433211111111111    012268999999988765554


No 135
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=45.66  E-value=12  Score=22.63  Aligned_cols=29  Identities=31%  Similarity=0.787  Sum_probs=17.0

Q ss_pred             ecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcccccCh
Q psy12014         19 SCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSYRAKQK   59 (78)
Q Consensus        19 ~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~~   59 (78)
                      .|+.||....+.           | .+-|+|..|+..+...
T Consensus       352 ~Cp~Cg~~m~S~-----------G-~~g~rC~kCg~~~~~~  380 (421)
T COG1571         352 VCPRCGGRMKSA-----------G-RNGFRCKKCGTRARET  380 (421)
T ss_pred             CCCccCCchhhc-----------C-CCCcccccccccCCcc
Confidence            677777653321           2 2247888887766544


No 136
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=44.67  E-value=12  Score=14.25  Aligned_cols=12  Identities=17%  Similarity=0.908  Sum_probs=6.2

Q ss_pred             CceecCCchhhc
Q psy12014         16 GLFSCSDCSRVY   27 (78)
Q Consensus        16 ~~~~c~~c~~~f   27 (78)
                      +-|+|..||...
T Consensus         5 ~~YkC~~CGniV   16 (36)
T PF06397_consen    5 EFYKCEHCGNIV   16 (36)
T ss_dssp             EEEE-TTT--EE
T ss_pred             cEEEccCCCCEE
Confidence            347888888754


No 137
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=44.15  E-value=6.6  Score=25.32  Aligned_cols=12  Identities=25%  Similarity=0.595  Sum_probs=8.2

Q ss_pred             CCCcccCCCccc
Q psy12014         44 QPKYRCPLCSYR   55 (78)
Q Consensus        44 ~~~~~c~~c~~~   55 (78)
                      ..|..|+.||..
T Consensus       473 ~~p~~Cp~Cgs~  484 (730)
T COG1198         473 PIPQSCPECGSE  484 (730)
T ss_pred             CCCCCCCCCCCC
Confidence            456778888753


No 138
>KOG2482|consensus
Probab=44.02  E-value=15  Score=21.64  Aligned_cols=23  Identities=22%  Similarity=0.632  Sum_probs=20.7

Q ss_pred             ceecCCchhhcCCHHHHHHHhhc
Q psy12014         17 LFSCSDCSRVYKKKASLTRHQTY   39 (78)
Q Consensus        17 ~~~c~~c~~~f~~~~~l~~h~~~   39 (78)
                      .+.|..|.+.|..+.-|..||+.
T Consensus       195 r~~CLyCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHh
Confidence            47899999999999999999985


No 139
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=43.21  E-value=12  Score=18.05  Aligned_cols=12  Identities=17%  Similarity=0.442  Sum_probs=8.3

Q ss_pred             ceecCCchhhcC
Q psy12014         17 LFSCSDCSRVYK   28 (78)
Q Consensus        17 ~~~c~~c~~~f~   28 (78)
                      ...|..|+..|.
T Consensus        70 ~~~C~~Cg~~~~   81 (114)
T PRK03681         70 ECWCETCQQYVT   81 (114)
T ss_pred             EEEcccCCCeee
Confidence            367888886554


No 140
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=42.71  E-value=13  Score=15.22  Aligned_cols=11  Identities=36%  Similarity=1.126  Sum_probs=7.8

Q ss_pred             cccCCCccccc
Q psy12014         47 YRCPLCSYRAK   57 (78)
Q Consensus        47 ~~c~~c~~~f~   57 (78)
                      |+|..|+..+.
T Consensus         2 y~C~~CgyiYd   12 (50)
T cd00730           2 YECRICGYIYD   12 (50)
T ss_pred             cCCCCCCeEEC
Confidence            67788876655


No 141
>PRK04351 hypothetical protein; Provisional
Probab=42.53  E-value=18  Score=18.49  Aligned_cols=31  Identities=26%  Similarity=0.685  Sum_probs=16.6

Q ss_pred             eecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCccccc
Q psy12014         18 FSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSYRAK   57 (78)
Q Consensus        18 ~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~   57 (78)
                      |.|..|+..+..      + +.+.. .+ |.|..|+..+.
T Consensus       113 Y~C~~Cg~~~~r------~-Rr~n~-~~-yrCg~C~g~L~  143 (149)
T PRK04351        113 YECQSCGQQYLR------K-RRINT-KR-YRCGKCRGKLK  143 (149)
T ss_pred             EECCCCCCEeee------e-eecCC-Cc-EEeCCCCcEee
Confidence            667777755432      1 22332 33 77777765443


No 142
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=41.44  E-value=14  Score=17.94  Aligned_cols=13  Identities=46%  Similarity=1.053  Sum_probs=9.1

Q ss_pred             ceecCCchhhcCC
Q psy12014         17 LFSCSDCSRVYKK   29 (78)
Q Consensus        17 ~~~c~~c~~~f~~   29 (78)
                      ...|..|+..|..
T Consensus        71 ~~~C~~Cg~~~~~   83 (117)
T PRK00564         71 ELECKDCSHVFKP   83 (117)
T ss_pred             EEEhhhCCCcccc
Confidence            4678888876653


No 143
>PF10537 WAC_Acf1_DNA_bd:  ATP-utilising chromatin assembly and remodelling N-terminal;  InterPro: IPR013136 ACF (for ATP-utilising chromatin assembly and remodeling factor) is a chromatin-remodeling complex that catalyzes the ATP-dependent assembly of periodic nucleosome arrays. This reaction utilises the energy of ATP hydrolysis by ISWI, the smaller of the two subunits of ACF. Acf1, the large subunit of ACF, is essential for the full activity of the complex. The WAC (WSTF/Acf1/cbp146) domain is an ~110-residue module present at the N-termini of Acf1-related proteins in a variety of organisms. It is found in association with other domains such as the bromodomain, the PHD-type zinc finger, DDT or WAKS. The DNA-binding region of Acf1 includes the WAC domain, which is necessary for the efficient binding of ACF complex to DNA. It seems probable that the WAC domain will be involved in DNA binding in other related factors [, ].   Some proteins known to contain a WAC domain are the Drosophila melanogaster (Fruit fly) ATP-dependent chromatin assembly factor large subunit Acf1, human WSTF (Williams syndrome transcription factor), mouse cbp146, yeast imitation switch two complex protein 1 (ITC1 or YGL133w), and yeast protein YPL216w. 
Probab=41.32  E-value=43  Score=15.97  Aligned_cols=37  Identities=5%  Similarity=0.190  Sum_probs=22.6

Q ss_pred             CceecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcc
Q psy12014         16 GLFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSY   54 (78)
Q Consensus        16 ~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~   54 (78)
                      .-|.|..-+..|..-..+...+..... . -|.|...|+
T Consensus         2 eVf~i~~T~EiF~dYe~Y~~R~~~y~~-~-vwtC~~TGk   38 (102)
T PF10537_consen    2 EVFYIPFTGEIFRDYEEYLKRMILYNQ-R-VWTCEITGK   38 (102)
T ss_pred             ceEEeCCCCcccCCHHHHHHHHHHHhC-C-eeEEecCCC
Confidence            346677777777766655555444443 3 377777665


No 144
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=41.29  E-value=10  Score=15.58  Aligned_cols=40  Identities=25%  Similarity=0.644  Sum_probs=21.2

Q ss_pred             CceecCC--chhhcCCHHHHHHHhhcccCCCCCcccCC----Cccccc
Q psy12014         16 GLFSCSD--CSRVYKKKASLTRHQTYECGQQPKYRCPL----CSYRAK   57 (78)
Q Consensus        16 ~~~~c~~--c~~~f~~~~~l~~h~~~h~~~~~~~~c~~----c~~~f~   57 (78)
                      .+-.|..  |...+. +..|..|....-. ..+..|..    |...+.
T Consensus         8 ~~v~C~~~cc~~~i~-r~~l~~H~~~~C~-~~~v~C~~~~~GC~~~~~   53 (60)
T PF02176_consen    8 RPVPCPNGCCNEMIP-RKELDDHLENECP-KRPVPCPYSPYGCKERVP   53 (60)
T ss_dssp             SEEE-TT--S-BEEE-CCCHHHHHHTTST-TSEEE-SS----S--EEE
T ss_pred             CEeeCCCCCccccee-HHHHHHHHHccCC-CCcEECCCCCCCCCCccc
Confidence            3456766  444444 3457788876555 55677887    766554


No 145
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=41.10  E-value=8.9  Score=20.57  Aligned_cols=25  Identities=24%  Similarity=0.547  Sum_probs=0.0

Q ss_pred             ccCCCceecCCchh-hcCCHHHHHHH
Q psy12014         12 YKGGGLFSCSDCSR-VYKKKASLTRH   36 (78)
Q Consensus        12 ~~~~~~~~c~~c~~-~f~~~~~l~~h   36 (78)
                      |.-...|.|.+||. .+.-+..+.+|
T Consensus        96 hGL~~ey~CEICGN~~Y~GrkaFekH  121 (196)
T PF11931_consen   96 HGLGVEYKCEICGNQSYKGRKAFEKH  121 (196)
T ss_dssp             --------------------------
T ss_pred             hCCCCeeeeEeCCCcceecHHHHHHh
Confidence            33455677777775 33333444444


No 146
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=40.73  E-value=27  Score=14.83  Aligned_cols=16  Identities=19%  Similarity=0.762  Sum_probs=11.0

Q ss_pred             CCCcccCCCcccccCh
Q psy12014         44 QPKYRCPLCSYRAKQK   59 (78)
Q Consensus        44 ~~~~~c~~c~~~f~~~   59 (78)
                      ...+.|+.||.....+
T Consensus        44 ~r~~~C~~Cg~~~~rD   59 (69)
T PF07282_consen   44 GRVFTCPNCGFEMDRD   59 (69)
T ss_pred             cceEEcCCCCCEECcH
Confidence            3458899998765544


No 147
>PF14353 CpXC:  CpXC protein
Probab=40.41  E-value=8.7  Score=18.71  Aligned_cols=18  Identities=22%  Similarity=0.608  Sum_probs=12.8

Q ss_pred             CCcccCCCcccccChhHH
Q psy12014         45 PKYRCPLCSYRAKQKIHL   62 (78)
Q Consensus        45 ~~~~c~~c~~~f~~~~~l   62 (78)
                      ..+.|+.||..|.....+
T Consensus        37 ~~~~CP~Cg~~~~~~~p~   54 (128)
T PF14353_consen   37 FSFTCPSCGHKFRLEYPL   54 (128)
T ss_pred             CEEECCCCCCceecCCCE
Confidence            347899999877655443


No 148
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=40.10  E-value=35  Score=20.37  Aligned_cols=21  Identities=24%  Similarity=0.430  Sum_probs=16.8

Q ss_pred             ecCCchhhcCCHHHHHHHhhc
Q psy12014         19 SCSDCSRVYKKKASLTRHQTY   39 (78)
Q Consensus        19 ~c~~c~~~f~~~~~l~~h~~~   39 (78)
                      .|.-|...|=..+.|.+|++.
T Consensus       222 ~C~FC~~~FYdDDEL~~HcR~  242 (493)
T COG5236         222 LCIFCKIYFYDDDELRRHCRL  242 (493)
T ss_pred             hhhhccceecChHHHHHHHHh
Confidence            477788888888888888875


No 149
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=39.57  E-value=14  Score=13.42  Aligned_cols=8  Identities=38%  Similarity=0.999  Sum_probs=5.1

Q ss_pred             cccCCCcc
Q psy12014         47 YRCPLCSY   54 (78)
Q Consensus        47 ~~c~~c~~   54 (78)
                      +.|+.|+.
T Consensus        20 ~vCp~C~~   27 (30)
T PF08274_consen   20 LVCPECGH   27 (30)
T ss_dssp             EEETTTTE
T ss_pred             EeCCcccc
Confidence            66776653


No 150
>PF02146 SIR2:  Sir2 family;  InterPro: IPR003000 These sequences represent the Sirtuin (Sir2-related) family of NAD+-dependent deacetylases. This family of enzymes is broadly conserved from bacteria to humans. In yeast, Sir2 proteins form complexes with other proteins to silence chromatin by accessing histones and deacetylating them. Sir2 proteins have been proposed to play a role in silencing, chromosome stability and ageing []. The bacterial enzyme CobB, an homologue of Sir2, is a phosphoribosyltransferase []. An in vitro ADP ribosyltransferase activity has also been associated with human members of this family []. Sir2-like enzymes employ NAD+ as a cosubstrate in deacetylation reactions [] and catalyse a reaction in which the cleavage of NAD(+)and histone and/or protein deacetylation are coupled to the formation of O-acetyl-ADP-ribose, a novel metabolite. The dependence of the reaction on both NAD(+) and the generation of this potential second messenger offers new clues to understanding the function and regulation of nuclear, cytoplasmic and mitochondrial Sir2-like enzymes []. Silent Information Regulator protein of Saccharomyces cerevisiae (Sir2) is one of several factors critical for silencing at least three loci. Among them, it is unique because it silences the rDNA as well as the mating type loci and telomeres []. Sir2 interacts in a complex with itself and with Sir3 and Sir4, two proteins that are able to interact with nucleosomes. In addition Sir2 also interacts with ubiquitination factors and/or complexes [].  Homologues of Sir2 share a core domain including the GAG and NID motifs and a putative C4 Zinc finger. The regions containing these three conserved motifs are individually essential for Sir2 silencing function, as are the four cysteins []. In addition, the conserved residues HG next to the putative Zn finger have been shown to be essential for the ADP ribosyltransferase activity []. ; GO: 0008270 zinc ion binding, 0070403 NAD+ binding, 0006476 protein deacetylation; PDB: 1S5P_A 3PKI_E 3PKJ_F 3K35_A 1ICI_A 1M2K_A 1M2G_A 1M2N_B 1M2H_A 1M2J_A ....
Probab=39.56  E-value=43  Score=17.32  Aligned_cols=39  Identities=21%  Similarity=0.392  Sum_probs=22.3

Q ss_pred             ccCCCceecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCccc
Q psy12014         12 YKGGGLFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSYR   55 (78)
Q Consensus        12 ~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~~   55 (78)
                      |..-....|..|++.+........ ..  .  ..+..|+.|+..
T Consensus       100 HG~l~~~~C~~C~~~~~~~~~~~~-~~--~--~~~~~C~~C~~~  138 (178)
T PF02146_consen  100 HGSLFRLRCSKCGKEYDREDIVDS-ID--E--EEPPRCPKCGGL  138 (178)
T ss_dssp             TEEEEEEEETTTSBEEEGHHHHHH-HH--T--TSSCBCTTTSCB
T ss_pred             HhhhceeeecCCCccccchhhccc-cc--c--cccccccccCcc
Confidence            333345689999998876543321 11  1  222478888763


No 151
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=39.46  E-value=5.1  Score=22.12  Aligned_cols=25  Identities=20%  Similarity=0.339  Sum_probs=12.0

Q ss_pred             CCceecCCchhhcCCHHHHHHHhhc
Q psy12014         15 GGLFSCSDCSRVYKKKASLTRHQTY   39 (78)
Q Consensus        15 ~~~~~c~~c~~~f~~~~~l~~h~~~   39 (78)
                      ++...|+.|+..|.....+....++
T Consensus        17 kk~ieCPvC~tkFkkeev~tgsiRi   41 (267)
T COG1655          17 KKTIECPVCNTKFKKEEVKTGSIRI   41 (267)
T ss_pred             hceeccCcccchhhhhheeccceeE
Confidence            3445566666555544433333333


No 152
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=39.41  E-value=30  Score=19.71  Aligned_cols=7  Identities=29%  Similarity=1.246  Sum_probs=3.2

Q ss_pred             cccCCCc
Q psy12014         47 YRCPLCS   53 (78)
Q Consensus        47 ~~c~~c~   53 (78)
                      |.|+.|.
T Consensus       256 yvCs~Cl  262 (279)
T TIGR00627       256 FVCSVCL  262 (279)
T ss_pred             EECCCcc
Confidence            4444443


No 153
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=38.88  E-value=33  Score=14.06  Aligned_cols=8  Identities=38%  Similarity=0.912  Sum_probs=4.9

Q ss_pred             cccCCCcc
Q psy12014         47 YRCPLCSY   54 (78)
Q Consensus        47 ~~c~~c~~   54 (78)
                      ..|+.|++
T Consensus        47 ~~Cp~CgR   54 (56)
T PF02591_consen   47 VFCPNCGR   54 (56)
T ss_pred             EECcCCCc
Confidence            55666664


No 154
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=38.65  E-value=8.8  Score=15.68  Aligned_cols=12  Identities=25%  Similarity=0.703  Sum_probs=9.8

Q ss_pred             ccCCCcccccCh
Q psy12014         48 RCPLCSYRAKQK   59 (78)
Q Consensus        48 ~c~~c~~~f~~~   59 (78)
                      +|++|++.|...
T Consensus        14 ICpvCqRPFsWR   25 (54)
T COG4338          14 ICPVCQRPFSWR   25 (54)
T ss_pred             hhhhhcCchHHH
Confidence            799999988755


No 155
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=38.27  E-value=6.8  Score=16.57  Aligned_cols=34  Identities=15%  Similarity=0.325  Sum_probs=16.6

Q ss_pred             ecCCchhhcCCHHH--HHHHhhcccCCCCCcccCCCcc
Q psy12014         19 SCSDCSRVYKKKAS--LTRHQTYECGQQPKYRCPLCSY   54 (78)
Q Consensus        19 ~c~~c~~~f~~~~~--l~~h~~~h~~~~~~~~c~~c~~   54 (78)
                      .|..|++.+.....  ...-.+.. + ...|.|..|..
T Consensus         4 kC~lCdk~~~Id~~~~~aKrLrnr-P-i~tYmC~eC~~   39 (56)
T PF09963_consen    4 KCILCDKKEEIDEDTPEAKRLRNR-P-IHTYMCDECKE   39 (56)
T ss_pred             EEEecCCEEEeccCCHHHHHhhcC-C-CcceeChhHHH
Confidence            56677776553322  22222221 2 33477887753


No 156
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=38.16  E-value=30  Score=13.18  Aligned_cols=10  Identities=20%  Similarity=0.853  Sum_probs=3.0

Q ss_pred             eecCCchhhc
Q psy12014         18 FSCSDCSRVY   27 (78)
Q Consensus        18 ~~c~~c~~~f   27 (78)
                      |-|+.|...+
T Consensus         4 yyCdyC~~~~   13 (38)
T PF06220_consen    4 YYCDYCKKYL   13 (38)
T ss_dssp             -B-TTT--B-
T ss_pred             eeccccccee
Confidence            5566666555


No 157
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=38.13  E-value=35  Score=21.12  Aligned_cols=10  Identities=30%  Similarity=0.733  Sum_probs=6.6

Q ss_pred             CCcccCCCcc
Q psy12014         45 PKYRCPLCSY   54 (78)
Q Consensus        45 ~~~~c~~c~~   54 (78)
                      .|..|+.|+.
T Consensus       252 ~~~~Cp~C~s  261 (505)
T TIGR00595       252 IPKTCPQCGS  261 (505)
T ss_pred             CCCCCCCCCC
Confidence            4567777764


No 158
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=36.09  E-value=9.5  Score=21.54  Aligned_cols=26  Identities=19%  Similarity=0.485  Sum_probs=18.5

Q ss_pred             CCCcccCCCcccccChhHHHHHHhhh
Q psy12014         44 QPKYRCPLCSYRAKQKIHLTTHMAIR   69 (78)
Q Consensus        44 ~~~~~c~~c~~~f~~~~~l~~h~~~~   69 (78)
                      .+++.|+.|+.-......|....++|
T Consensus       207 ~k~~PCPKCg~et~eTkdLSmStR~h  232 (314)
T PF06524_consen  207 GKPIPCPKCGYETQETKDLSMSTRSH  232 (314)
T ss_pred             CCCCCCCCCCCcccccccceeeeecc
Confidence            45788999987766666666666555


No 159
>PTZ00448 hypothetical protein; Provisional
Probab=35.91  E-value=34  Score=20.43  Aligned_cols=23  Identities=13%  Similarity=0.426  Sum_probs=19.0

Q ss_pred             ceecCCchhhcCCHHHHHHHhhc
Q psy12014         17 LFSCSDCSRVYKKKASLTRHQTY   39 (78)
Q Consensus        17 ~~~c~~c~~~f~~~~~l~~h~~~   39 (78)
                      .+.|..|+-.|........|.+.
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            57799999999877777778775


No 160
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=35.87  E-value=33  Score=20.50  Aligned_cols=26  Identities=31%  Similarity=0.478  Sum_probs=15.0

Q ss_pred             hccCCCceecCCch-hhcCCHHHHHHH
Q psy12014         11 LYKGGGLFSCSDCS-RVYKKKASLTRH   36 (78)
Q Consensus        11 ~~~~~~~~~c~~c~-~~f~~~~~l~~h   36 (78)
                      .|.-.+.|.|.+|| +++--...+.+|
T Consensus       368 lhgLd~ef~CEICgNyvy~GR~~FdrH  394 (470)
T COG5188         368 LHGLDIEFECEICGNYVYYGRDRFDRH  394 (470)
T ss_pred             hcCCCcceeeeecccccccchHHHHhh
Confidence            45556777888887 344444444444


No 161
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=35.47  E-value=18  Score=18.16  Aligned_cols=11  Identities=27%  Similarity=1.056  Sum_probs=6.4

Q ss_pred             ceecCCchhhc
Q psy12014         17 LFSCSDCSRVY   27 (78)
Q Consensus        17 ~~~c~~c~~~f   27 (78)
                      .|.|..|+..+
T Consensus       112 ~y~C~~C~~~~  122 (146)
T smart00731      112 PYRCTGCGQRY  122 (146)
T ss_pred             EEECCCCCCCC
Confidence            45666666544


No 162
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=34.21  E-value=11  Score=18.80  Aligned_cols=30  Identities=33%  Similarity=0.865  Sum_probs=15.6

Q ss_pred             eecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcccc
Q psy12014         18 FSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSYRA   56 (78)
Q Consensus        18 ~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~~f   56 (78)
                      |.|..|+..+..      +.+. .  ...+.|..|+..+
T Consensus       124 ~~C~~C~~~~~r------~~~~-~--~~~~~C~~C~~~l  153 (157)
T PF10263_consen  124 YRCPSCGREYKR------HRRS-K--RKRYRCGRCGGPL  153 (157)
T ss_pred             EEcCCCCCEeee------eccc-c--hhhEECCCCCCEE
Confidence            567777765432      2222 1  2226777776544


No 163
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=34.19  E-value=20  Score=13.47  Aligned_cols=11  Identities=18%  Similarity=0.963  Sum_probs=5.3

Q ss_pred             ecCCchhhcCC
Q psy12014         19 SCSDCSRVYKK   29 (78)
Q Consensus        19 ~c~~c~~~f~~   29 (78)
                      .|..|++.|..
T Consensus         5 ~C~eC~~~f~d   15 (34)
T PF01286_consen    5 KCDECGKPFMD   15 (34)
T ss_dssp             E-TTT--EES-
T ss_pred             hHhHhCCHHHH
Confidence            68888887763


No 164
>KOG0978|consensus
Probab=33.87  E-value=11  Score=24.34  Aligned_cols=15  Identities=13%  Similarity=0.570  Sum_probs=8.7

Q ss_pred             ecCCchhhcCCHHHH
Q psy12014         19 SCSDCSRVYKKKASL   33 (78)
Q Consensus        19 ~c~~c~~~f~~~~~l   33 (78)
                      .|+.|+.+|...++.
T Consensus       680 KCP~Cn~aFganDv~  694 (698)
T KOG0978|consen  680 KCPKCNAAFGANDVH  694 (698)
T ss_pred             CCCCCCCCCCccccc
Confidence            466666666655443


No 165
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=33.79  E-value=30  Score=21.07  Aligned_cols=11  Identities=27%  Similarity=0.682  Sum_probs=7.7

Q ss_pred             ceecCCchhhc
Q psy12014         17 LFSCSDCSRVY   27 (78)
Q Consensus        17 ~~~c~~c~~~f   27 (78)
                      .|.|..||...
T Consensus         7 ~y~C~~Cg~~~   17 (454)
T TIGR00416         7 KFVCQHCGADS   17 (454)
T ss_pred             eEECCcCCCCC
Confidence            47888887654


No 166
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=33.74  E-value=18  Score=14.64  Aligned_cols=13  Identities=31%  Similarity=0.940  Sum_probs=9.7

Q ss_pred             eecCCchhhcCCH
Q psy12014         18 FSCSDCSRVYKKK   30 (78)
Q Consensus        18 ~~c~~c~~~f~~~   30 (78)
                      |.|..|+..+...
T Consensus         2 y~C~~CgyvYd~~   14 (47)
T PF00301_consen    2 YQCPVCGYVYDPE   14 (47)
T ss_dssp             EEETTTSBEEETT
T ss_pred             cCCCCCCEEEcCC
Confidence            6788888877644


No 167
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=33.14  E-value=23  Score=12.87  Aligned_cols=12  Identities=17%  Similarity=0.805  Sum_probs=8.7

Q ss_pred             CceecCCchhhc
Q psy12014         16 GLFSCSDCSRVY   27 (78)
Q Consensus        16 ~~~~c~~c~~~f   27 (78)
                      +-|+|..|+...
T Consensus         6 ~~ykC~~Cgniv   17 (34)
T TIGR00319         6 QVYKCEVCGNIV   17 (34)
T ss_pred             cEEEcCCCCcEE
Confidence            357888888754


No 168
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=33.00  E-value=26  Score=13.25  Aligned_cols=12  Identities=33%  Similarity=0.880  Sum_probs=7.6

Q ss_pred             ccCCCceecCCc
Q psy12014         12 YKGGGLFSCSDC   23 (78)
Q Consensus        12 ~~~~~~~~c~~c   23 (78)
                      ..|...|.|..|
T Consensus        24 ~~G~qryrC~~C   35 (36)
T PF03811_consen   24 PSGHQRYRCKDC   35 (36)
T ss_pred             CCCCEeEecCcC
Confidence            345566777766


No 169
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=32.67  E-value=23  Score=12.88  Aligned_cols=11  Identities=18%  Similarity=0.881  Sum_probs=7.7

Q ss_pred             ceecCCchhhc
Q psy12014         17 LFSCSDCSRVY   27 (78)
Q Consensus        17 ~~~c~~c~~~f   27 (78)
                      -|+|..|+...
T Consensus         4 ~ykC~~CGniv   14 (34)
T cd00974           4 VYKCEICGNIV   14 (34)
T ss_pred             EEEcCCCCcEE
Confidence            47788887654


No 170
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=32.48  E-value=23  Score=14.64  Aligned_cols=15  Identities=20%  Similarity=0.450  Sum_probs=8.0

Q ss_pred             CCCceecCCchhhcC
Q psy12014         14 GGGLFSCSDCSRVYK   28 (78)
Q Consensus        14 ~~~~~~c~~c~~~f~   28 (78)
                      +...++|..|++.+.
T Consensus        32 ~~~~~rC~YCe~~~~   46 (52)
T PF02748_consen   32 EPIKLRCHYCERIIT   46 (52)
T ss_dssp             TTCEEEETTT--EEE
T ss_pred             CCCEEEeeCCCCEec
Confidence            445567777776654


No 171
>PRK11823 DNA repair protein RadA; Provisional
Probab=32.17  E-value=36  Score=20.66  Aligned_cols=11  Identities=18%  Similarity=0.751  Sum_probs=8.0

Q ss_pred             ceecCCchhhc
Q psy12014         17 LFSCSDCSRVY   27 (78)
Q Consensus        17 ~~~c~~c~~~f   27 (78)
                      .|.|..||...
T Consensus         7 ~y~C~~Cg~~~   17 (446)
T PRK11823          7 AYVCQECGAES   17 (446)
T ss_pred             eEECCcCCCCC
Confidence            58888887654


No 172
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=32.12  E-value=15  Score=19.91  Aligned_cols=26  Identities=12%  Similarity=0.183  Sum_probs=0.0

Q ss_pred             CceecCCchhhcCCHHHHHHHhhcccC
Q psy12014         16 GLFSCSDCSRVYKKKASLTRHQTYECG   42 (78)
Q Consensus        16 ~~~~c~~c~~~f~~~~~l~~h~~~h~~   42 (78)
                      .-..|.+||...+ ...+..|+++...
T Consensus       167 ~~~~cPitGe~IP-~~e~~eHmRi~Ll  192 (229)
T PF12230_consen  167 KMIICPITGEMIP-ADEMDEHMRIELL  192 (229)
T ss_dssp             ---------------------------
T ss_pred             ccccccccccccc-ccccccccccccc
Confidence            3456888877655 3446777777665


No 173
>KOG1842|consensus
Probab=31.83  E-value=30  Score=21.30  Aligned_cols=24  Identities=21%  Similarity=0.278  Sum_probs=16.0

Q ss_pred             CceecCCchhhcCCHHHHHHHhhc
Q psy12014         16 GLFSCSDCSRVYKKKASLTRHQTY   39 (78)
Q Consensus        16 ~~~~c~~c~~~f~~~~~l~~h~~~   39 (78)
                      +-|.|++|..-|..-..|..|.-.
T Consensus        14 egflCPiC~~dl~~~~~L~~H~d~   37 (505)
T KOG1842|consen   14 EGFLCPICLLDLPNLSALNDHLDV   37 (505)
T ss_pred             hcccCchHhhhhhhHHHHHHHHhh
Confidence            346777777777777777666543


No 174
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=31.54  E-value=48  Score=19.51  Aligned_cols=25  Identities=20%  Similarity=0.511  Sum_probs=20.3

Q ss_pred             CcccCCCcccccChhHHHHHHhhhh
Q psy12014         46 KYRCPLCSYRAKQKIHLTTHMAIRH   70 (78)
Q Consensus        46 ~~~c~~c~~~f~~~~~l~~h~~~~~   70 (78)
                      .|+|..|...|-.....-.|...|.
T Consensus       388 rY~Ce~CK~~FC~dCdvfiHe~Lh~  412 (421)
T COG5151         388 RYQCELCKSTFCSDCDVFIHETLHF  412 (421)
T ss_pred             ceechhhhhhhhhhhHHHHHHHHhh
Confidence            4889889888888888878877764


No 175
>KOG1994|consensus
Probab=30.98  E-value=32  Score=19.17  Aligned_cols=23  Identities=26%  Similarity=0.468  Sum_probs=18.6

Q ss_pred             CCceecCCchhhcCCHHHHHHHh
Q psy12014         15 GGLFSCSDCSRVYKKKASLTRHQ   37 (78)
Q Consensus        15 ~~~~~c~~c~~~f~~~~~l~~h~   37 (78)
                      ..-|.|-.||-.|.....|..|-
T Consensus       237 ~eh~YC~fCG~~y~~~edl~ehC  259 (268)
T KOG1994|consen  237 SEHYYCFFCGIKYKDEEDLYEHC  259 (268)
T ss_pred             ccceEEEEeccccCCHHHHHHhC
Confidence            34688999999999998887664


No 176
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=30.73  E-value=15  Score=14.32  Aligned_cols=9  Identities=44%  Similarity=1.136  Sum_probs=3.9

Q ss_pred             cccCCCccc
Q psy12014         47 YRCPLCSYR   55 (78)
Q Consensus        47 ~~c~~c~~~   55 (78)
                      ..|+.|+..
T Consensus        30 ~~CpYCg~~   38 (40)
T PF10276_consen   30 VVCPYCGTR   38 (40)
T ss_dssp             EEETTTTEE
T ss_pred             EECCCCCCE
Confidence            344444443


No 177
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=30.52  E-value=22  Score=18.45  Aligned_cols=18  Identities=17%  Similarity=0.440  Sum_probs=14.7

Q ss_pred             CCceecCCchhhcCCHHH
Q psy12014         15 GGLFSCSDCSRVYKKKAS   32 (78)
Q Consensus        15 ~~~~~c~~c~~~f~~~~~   32 (78)
                      +.|.-|..||+.|++...
T Consensus        66 ~~PsYC~~CGkpyPWt~~   83 (158)
T PF10083_consen   66 EAPSYCHNCGKPYPWTEN   83 (158)
T ss_pred             CCChhHHhCCCCCchHHH
Confidence            478889999999997654


No 178
>COG5539 Predicted cysteine protease (OTU family) [Posttranslational modification, protein turnover, chaperones]
Probab=30.45  E-value=48  Score=19.21  Aligned_cols=27  Identities=11%  Similarity=0.244  Sum_probs=19.1

Q ss_pred             ccCCCceecCCchhhcCCHHHHHHHhh
Q psy12014         12 YKGGGLFSCSDCSRVYKKKASLTRHQT   38 (78)
Q Consensus        12 ~~~~~~~~c~~c~~~f~~~~~l~~h~~   38 (78)
                      .++....+|.+|+..|.....+..|..
T Consensus       270 nT~~~~ik~n~c~~~~~~e~~~~~Ha~  296 (306)
T COG5539         270 NTASPSIKCNICGTGFVGEKDYYAHAL  296 (306)
T ss_pred             ecCCceEEeeccccccchhhHHHHHHH
Confidence            345556789999998887766666643


No 179
>PLN02748 tRNA dimethylallyltransferase
Probab=29.67  E-value=52  Score=20.37  Aligned_cols=24  Identities=17%  Similarity=0.462  Sum_probs=18.5

Q ss_pred             CceecCCchh-hcCCHHHHHHHhhc
Q psy12014         16 GLFSCSDCSR-VYKKKASLTRHQTY   39 (78)
Q Consensus        16 ~~~~c~~c~~-~f~~~~~l~~h~~~   39 (78)
                      +.|.|+.|+. .+........|...
T Consensus       417 ~~~~Ce~C~~~~~~G~~eW~~Hlks  441 (468)
T PLN02748        417 TQYVCEACGNKVLRGAHEWEQHKQG  441 (468)
T ss_pred             ccccccCCCCcccCCHHHHHHHhcc
Confidence            5578999997 78777777777764


No 180
>PRK05978 hypothetical protein; Provisional
Probab=29.13  E-value=34  Score=17.58  Aligned_cols=11  Identities=18%  Similarity=0.458  Sum_probs=7.0

Q ss_pred             cccCCCccccc
Q psy12014         47 YRCPLCSYRAK   57 (78)
Q Consensus        47 ~~c~~c~~~f~   57 (78)
                      -.|..|+..|.
T Consensus        53 ~~C~~CG~~~~   63 (148)
T PRK05978         53 DHCAACGEDFT   63 (148)
T ss_pred             CCccccCCccc
Confidence            46777776554


No 181
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=28.94  E-value=78  Score=17.23  Aligned_cols=12  Identities=33%  Similarity=0.681  Sum_probs=8.9

Q ss_pred             CCcccCCCcccc
Q psy12014         45 PKYRCPLCSYRA   56 (78)
Q Consensus        45 ~~~~c~~c~~~f   56 (78)
                      ...+|..||..+
T Consensus        29 ~lvrC~eCG~V~   40 (201)
T COG1326          29 PLVRCEECGTVH   40 (201)
T ss_pred             eEEEccCCCcEe
Confidence            347899998765


No 182
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=28.83  E-value=30  Score=14.45  Aligned_cols=12  Identities=25%  Similarity=0.819  Sum_probs=7.8

Q ss_pred             cccCCCcccccC
Q psy12014         47 YRCPLCSYRAKQ   58 (78)
Q Consensus        47 ~~c~~c~~~f~~   58 (78)
                      +.|+.|+..+..
T Consensus         3 ~~CP~CG~~iev   14 (54)
T TIGR01206         3 FECPDCGAEIEL   14 (54)
T ss_pred             cCCCCCCCEEec
Confidence            567777765543


No 183
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=28.78  E-value=35  Score=13.03  Aligned_cols=14  Identities=29%  Similarity=0.738  Sum_probs=7.8

Q ss_pred             cCCCceecCCchhh
Q psy12014         13 KGGGLFSCSDCSRV   26 (78)
Q Consensus        13 ~~~~~~~c~~c~~~   26 (78)
                      .+.+.|.|..|+..
T Consensus        20 ~~~~~w~C~~C~~~   33 (40)
T PF04810_consen   20 DGGKTWICNFCGTK   33 (40)
T ss_dssp             TTTTEEEETTT--E
T ss_pred             CCCCEEECcCCCCc
Confidence            34567777777653


No 184
>KOG3507|consensus
Probab=28.55  E-value=26  Score=15.03  Aligned_cols=27  Identities=30%  Similarity=0.754  Sum_probs=16.0

Q ss_pred             eecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcccc
Q psy12014         18 FSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSYRA   56 (78)
Q Consensus        18 ~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~~f   56 (78)
                      |.|..|+..-.          ...  .-+++|..||...
T Consensus        21 YiCgdC~~en~----------lk~--~D~irCReCG~RI   47 (62)
T KOG3507|consen   21 YICGDCGQENT----------LKR--GDVIRCRECGYRI   47 (62)
T ss_pred             EEecccccccc----------ccC--CCcEehhhcchHH
Confidence            77888875321          111  2348899998643


No 185
>KOG0801|consensus
Probab=28.14  E-value=15  Score=19.20  Aligned_cols=11  Identities=27%  Similarity=0.911  Sum_probs=7.4

Q ss_pred             cccCCCccccc
Q psy12014         47 YRCPLCSYRAK   57 (78)
Q Consensus        47 ~~c~~c~~~f~   57 (78)
                      ++|++|.+...
T Consensus       139 ~KCPvC~K~V~  149 (205)
T KOG0801|consen  139 MKCPVCHKVVP  149 (205)
T ss_pred             ccCCccccccC
Confidence            67888876543


No 186
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]
Probab=27.85  E-value=58  Score=18.24  Aligned_cols=34  Identities=18%  Similarity=0.358  Sum_probs=19.0

Q ss_pred             eecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcccc
Q psy12014         18 FSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSYRA   56 (78)
Q Consensus        18 ~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~~f   56 (78)
                      ..|.-|....+... + .-++.  . .....|+.||+-.
T Consensus       198 ~~C~GC~m~l~~~~-~-~~V~~--~-d~iv~CP~CgRIL  231 (239)
T COG1579         198 RVCGGCHMKLPSQT-L-SKVRK--K-DEIVFCPYCGRIL  231 (239)
T ss_pred             CcccCCeeeecHHH-H-HHHhc--C-CCCccCCccchHH
Confidence            45777766554332 2 22232  3 4457899998743


No 187
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=27.77  E-value=70  Score=17.03  Aligned_cols=35  Identities=23%  Similarity=0.643  Sum_probs=21.4

Q ss_pred             ccCCCceecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcccc
Q psy12014         12 YKGGGLFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSYRA   56 (78)
Q Consensus        12 ~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~~f   56 (78)
                      -++..-|.|+.|...++....      ...+    |.|+.||...
T Consensus       108 ~~~~~~y~C~~~~~r~sfdeA------~~~~----F~Cp~Cg~~L  142 (176)
T COG1675         108 ETENNYYVCPNCHVKYSFDEA------MELG----FTCPKCGEDL  142 (176)
T ss_pred             hccCCceeCCCCCCcccHHHH------HHhC----CCCCCCCchh
Confidence            455566889777766553322      2222    8999998644


No 188
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=27.53  E-value=36  Score=13.10  Aligned_cols=9  Identities=44%  Similarity=1.043  Sum_probs=6.5

Q ss_pred             CcccCCCcc
Q psy12014         46 KYRCPLCSY   54 (78)
Q Consensus        46 ~~~c~~c~~   54 (78)
                      |..|+.||.
T Consensus         2 ~~~Cp~Cg~   10 (47)
T PF14690_consen    2 PPRCPHCGS   10 (47)
T ss_pred             CccCCCcCC
Confidence            467888874


No 189
>PRK08222 hydrogenase 4 subunit H; Validated
Probab=27.48  E-value=47  Score=17.48  Aligned_cols=19  Identities=26%  Similarity=0.648  Sum_probs=14.7

Q ss_pred             CceecCCchhhcCCHHHHH
Q psy12014         16 GLFSCSDCSRVYKKKASLT   34 (78)
Q Consensus        16 ~~~~c~~c~~~f~~~~~l~   34 (78)
                      ....|..||+.|.....+.
T Consensus       113 ~~~~C~~Cg~~f~~~k~i~  131 (181)
T PRK08222        113 HLQRCSRCERPFAPQKTVA  131 (181)
T ss_pred             ccCcCcccCCccCcHhHHH
Confidence            5678999999998665544


No 190
>PRK14138 NAD-dependent deacetylase; Provisional
Probab=27.27  E-value=1.1e+02  Score=17.05  Aligned_cols=39  Identities=23%  Similarity=0.430  Sum_probs=22.0

Q ss_pred             hccCCCceecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcc
Q psy12014         11 LYKGGGLFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSY   54 (78)
Q Consensus        11 ~~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~   54 (78)
                      .|..-....|..|+..+.....+..   .... . .-.|+.|+.
T Consensus       113 lHG~~~~~~C~~C~~~~~~~~~~~~---~~~~-~-~p~Cp~Cgg  151 (244)
T PRK14138        113 LHGNVEEYYCVRCGKRYTVEDVIEK---LEKS-D-VPRCDDCSG  151 (244)
T ss_pred             ccCCcCeeEECCCCCcccHHHHHHH---HhcC-C-CCCCCCCCC
Confidence            3444455779889988776544331   1111 2 236888864


No 191
>KOG0227|consensus
Probab=26.96  E-value=39  Score=18.32  Aligned_cols=19  Identities=26%  Similarity=0.543  Sum_probs=8.7

Q ss_pred             cccCCCcccccChhHHHHH
Q psy12014         47 YRCPLCSYRAKQKIHLTTH   65 (78)
Q Consensus        47 ~~c~~c~~~f~~~~~l~~h   65 (78)
                      |.|..|.-......+...|
T Consensus        54 yeCkLClT~H~ne~Syl~H   72 (222)
T KOG0227|consen   54 YECKLCLTLHNNEGSYLAH   72 (222)
T ss_pred             eeehhhhhhhcchhhhhhh
Confidence            4555554444444443333


No 192
>COG1379 PHP family phosphoesterase with a Zn ribbon [General function prediction only]
Probab=26.86  E-value=25  Score=20.79  Aligned_cols=11  Identities=45%  Similarity=1.174  Sum_probs=7.0

Q ss_pred             cccCCCccccc
Q psy12014         47 YRCPLCSYRAK   57 (78)
Q Consensus        47 ~~c~~c~~~f~   57 (78)
                      |+|+.||..+.
T Consensus       266 wrCpkCGg~ik  276 (403)
T COG1379         266 WRCPKCGGKIK  276 (403)
T ss_pred             ccCcccccchh
Confidence            67777776443


No 193
>PF06676 DUF1178:  Protein of unknown function (DUF1178);  InterPro: IPR009562 This family consists of several hypothetical bacterial proteins of around 150 residues in length. The function of this family is unknown.
Probab=26.58  E-value=1e+02  Score=15.90  Aligned_cols=24  Identities=25%  Similarity=0.660  Sum_probs=12.6

Q ss_pred             hcCCHHHHHHHhhcccCCCCCcccCCCcc
Q psy12014         26 VYKKKASLTRHQTYECGQQPKYRCPLCSY   54 (78)
Q Consensus        26 ~f~~~~~l~~h~~~h~~~~~~~~c~~c~~   54 (78)
                      .|.+...+.....     .....|++||.
T Consensus        17 WF~ss~~fd~Q~~-----~glv~CP~Cgs   40 (148)
T PF06676_consen   17 WFRSSAAFDRQQA-----RGLVSCPVCGS   40 (148)
T ss_pred             ecCCHHHHHHHHH-----cCCccCCCCCC
Confidence            4555555544333     23356777764


No 194
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=26.57  E-value=1.2e+02  Score=17.64  Aligned_cols=23  Identities=39%  Similarity=0.713  Sum_probs=15.8

Q ss_pred             CceecCCchhhcCCHHHHHHHhh
Q psy12014         16 GLFSCSDCSRVYKKKASLTRHQT   38 (78)
Q Consensus        16 ~~~~c~~c~~~f~~~~~l~~h~~   38 (78)
                      .-|.|+.|-+-|.....+.+|+.
T Consensus        47 ~lyiCe~Clky~~~~~~l~~H~~   69 (290)
T PLN03238         47 KLYICEYCLKYMRKKKSLLRHLA   69 (290)
T ss_pred             eEEEcCCCcchhCCHHHHHHHHH
Confidence            44667777777777777777765


No 195
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=26.22  E-value=43  Score=18.84  Aligned_cols=15  Identities=20%  Similarity=0.853  Sum_probs=10.5

Q ss_pred             CCcccCCCcccccCh
Q psy12014         45 PKYRCPLCSYRAKQK   59 (78)
Q Consensus        45 ~~~~c~~c~~~f~~~   59 (78)
                      ..+.|+.||..+..+
T Consensus       321 r~~~C~~cg~~~~rD  335 (364)
T COG0675         321 RLFKCPRCGFVHDRD  335 (364)
T ss_pred             eeEECCCCCCeehhh
Confidence            348899998765544


No 196
>PF13821 DUF4187:  Domain of unknown function (DUF4187)
Probab=25.36  E-value=41  Score=14.06  Aligned_cols=20  Identities=25%  Similarity=0.416  Sum_probs=15.2

Q ss_pred             CceecCCchhhcCCHHHHHH
Q psy12014         16 GLFSCSDCSRVYKKKASLTR   35 (78)
Q Consensus        16 ~~~~c~~c~~~f~~~~~l~~   35 (78)
                      +-+-|-+|+..|.....|..
T Consensus        26 ~~~YC~~Cg~~Y~d~~dL~~   45 (55)
T PF13821_consen   26 EHNYCFWCGTKYDDEEDLER   45 (55)
T ss_pred             hCceeeeeCCccCCHHHHHh
Confidence            34568999999998877753


No 197
>KOG2807|consensus
Probab=24.86  E-value=82  Score=18.75  Aligned_cols=22  Identities=27%  Similarity=0.561  Sum_probs=15.4

Q ss_pred             CCcccCCCcccccChhHHHHHH
Q psy12014         45 PKYRCPLCSYRAKQKIHLTTHM   66 (78)
Q Consensus        45 ~~~~c~~c~~~f~~~~~l~~h~   66 (78)
                      .|.+|+.|+-+.-...+|....
T Consensus       289 LP~eCpiC~ltLVss~hLARSy  310 (378)
T KOG2807|consen  289 LPIECPICSLTLVSSPHLARSY  310 (378)
T ss_pred             CCccCCccceeEecchHHHHHH
Confidence            4678888887777776765443


No 198
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=24.66  E-value=49  Score=19.67  Aligned_cols=8  Identities=25%  Similarity=0.908  Sum_probs=4.3

Q ss_pred             eecCCchh
Q psy12014         18 FSCSDCSR   25 (78)
Q Consensus        18 ~~c~~c~~   25 (78)
                      ++|+.|+.
T Consensus        15 g~cp~c~~   22 (372)
T cd01121          15 GKCPECGE   22 (372)
T ss_pred             EECcCCCC
Confidence            45555554


No 199
>KOG3352|consensus
Probab=24.63  E-value=45  Score=17.27  Aligned_cols=14  Identities=36%  Similarity=0.622  Sum_probs=10.4

Q ss_pred             CCcccCCCcccccC
Q psy12014         45 PKYRCPLCSYRAKQ   58 (78)
Q Consensus        45 ~~~~c~~c~~~f~~   58 (78)
                      +..+|.+||.-|..
T Consensus       132 e~~rc~eCG~~fkL  145 (153)
T KOG3352|consen  132 ETQRCPECGHYFKL  145 (153)
T ss_pred             CcccCCcccceEEe
Confidence            34689999987764


No 200
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=24.56  E-value=39  Score=12.76  Aligned_cols=11  Identities=27%  Similarity=0.631  Sum_probs=7.0

Q ss_pred             cccCCCccccc
Q psy12014         47 YRCPLCSYRAK   57 (78)
Q Consensus        47 ~~c~~c~~~f~   57 (78)
                      +.|..||..+.
T Consensus        33 ~~C~~CGE~~~   43 (46)
T TIGR03831        33 LVCPQCGEEYL   43 (46)
T ss_pred             cccccCCCEee
Confidence            56777776543


No 201
>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional
Probab=24.42  E-value=52  Score=17.18  Aligned_cols=18  Identities=22%  Similarity=0.647  Sum_probs=14.0

Q ss_pred             CceecCCchhhcCCHHHH
Q psy12014         16 GLFSCSDCSRVYKKKASL   33 (78)
Q Consensus        16 ~~~~c~~c~~~f~~~~~l   33 (78)
                      ....|..||+.|.....+
T Consensus       113 ~~~~C~~CG~~f~~~~~i  130 (180)
T PRK12387        113 ALCNCRVCGRPFAVQKEI  130 (180)
T ss_pred             CcccchhhCCccccHHHH
Confidence            467899999999866543


No 202
>KOG4727|consensus
Probab=24.39  E-value=54  Score=17.47  Aligned_cols=22  Identities=23%  Similarity=0.439  Sum_probs=17.2

Q ss_pred             ceecCCchhhcCCHHHHHHHhh
Q psy12014         17 LFSCSDCSRVYKKKASLTRHQT   38 (78)
Q Consensus        17 ~~~c~~c~~~f~~~~~l~~h~~   38 (78)
                      -|-|.+|+-++...-++..|+.
T Consensus        75 GyyCdVCdcvvKDSinflDHiN   96 (193)
T KOG4727|consen   75 GYYCDVCDCVVKDSINFLDHIN   96 (193)
T ss_pred             ceeeeecceeehhhHHHHHHhc
Confidence            4899999999887766666654


No 203
>PRK05580 primosome assembly protein PriA; Validated
Probab=24.38  E-value=18  Score=23.18  Aligned_cols=12  Identities=25%  Similarity=0.556  Sum_probs=7.9

Q ss_pred             CCCcccCCCccc
Q psy12014         44 QPKYRCPLCSYR   55 (78)
Q Consensus        44 ~~~~~c~~c~~~   55 (78)
                      ..|..|+.|+..
T Consensus       419 ~~~~~Cp~Cg~~  430 (679)
T PRK05580        419 PIPKACPECGST  430 (679)
T ss_pred             CCCCCCCCCcCC
Confidence            346778888653


No 204
>PLN02925 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
Probab=23.57  E-value=1e+02  Score=20.46  Aligned_cols=26  Identities=12%  Similarity=0.318  Sum_probs=19.2

Q ss_pred             cccCCCcccccChhHHHHHHhhhhcC
Q psy12014         47 YRCPLCSYRAKQKIHLTTHMAIRHHK   72 (78)
Q Consensus        47 ~~c~~c~~~f~~~~~l~~h~~~~~g~   72 (78)
                      ..|+.||++......+...++..++.
T Consensus       635 isCPgCGRT~~dlq~~~~~I~~~~~h  660 (733)
T PLN02925        635 VSCPSCGRTLFDLQEVSAEIREKTSH  660 (733)
T ss_pred             EECCCCCCccccHHHHHHHHHHHhhc
Confidence            46999999877777777777666543


No 205
>PRK01343 zinc-binding protein; Provisional
Probab=23.53  E-value=56  Score=13.92  Aligned_cols=11  Identities=27%  Similarity=0.718  Sum_probs=8.1

Q ss_pred             cccCCCccccc
Q psy12014         47 YRCPLCSYRAK   57 (78)
Q Consensus        47 ~~c~~c~~~f~   57 (78)
                      ..|+.|++.+.
T Consensus        10 ~~CP~C~k~~~   20 (57)
T PRK01343         10 RPCPECGKPST   20 (57)
T ss_pred             CcCCCCCCcCc
Confidence            56888887654


No 206
>PF09943 DUF2175:  Uncharacterized protein conserved in archaea (DUF2175);  InterPro: IPR018686  This family of various hypothetical archaeal proteins has no known function. 
Probab=23.43  E-value=30  Score=16.58  Aligned_cols=11  Identities=18%  Similarity=0.591  Sum_probs=7.2

Q ss_pred             ceecCCchhhc
Q psy12014         17 LFSCSDCSRVY   27 (78)
Q Consensus        17 ~~~c~~c~~~f   27 (78)
                      .|.|..||+..
T Consensus         2 kWkC~iCg~~I   12 (101)
T PF09943_consen    2 KWKCYICGKPI   12 (101)
T ss_pred             ceEEEecCCee
Confidence            46777777644


No 207
>KOG3014|consensus
Probab=23.41  E-value=65  Score=18.25  Aligned_cols=31  Identities=19%  Similarity=0.444  Sum_probs=21.6

Q ss_pred             ccCCCce---ecCCchhhcC--CHHHHHHHhhcccC
Q psy12014         12 YKGGGLF---SCSDCSRVYK--KKASLTRHQTYECG   42 (78)
Q Consensus        12 ~~~~~~~---~c~~c~~~f~--~~~~l~~h~~~h~~   42 (78)
                      ..|.+.+   .|..|+..++  ++.+-..|+..|..
T Consensus        29 d~Gqk~fg~~~C~~Cgm~Yt~~s~EDe~~H~~fH~~   64 (257)
T KOG3014|consen   29 DAGQKDFGAVKCKECGMKYTVTSPEDEALHEKFHNR   64 (257)
T ss_pred             ecCccccCceehhhcCceecCCCHHHHHHHHHHHHh
Confidence            3455555   6999999776  45566678888764


No 208
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=23.04  E-value=40  Score=17.35  Aligned_cols=13  Identities=23%  Similarity=0.329  Sum_probs=10.4

Q ss_pred             cccCCCcccccCh
Q psy12014         47 YRCPLCSYRAKQK   59 (78)
Q Consensus        47 ~~c~~c~~~f~~~   59 (78)
                      -+|..|++.|...
T Consensus        29 ReC~~C~~RFTTy   41 (147)
T TIGR00244        29 RECLECHERFTTF   41 (147)
T ss_pred             ccCCccCCcccee
Confidence            5799999988754


No 209
>COG0846 SIR2 NAD-dependent protein deacetylases, SIR2 family [Transcription]
Probab=22.94  E-value=74  Score=17.92  Aligned_cols=39  Identities=26%  Similarity=0.393  Sum_probs=21.7

Q ss_pred             hccCCCceecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcc
Q psy12014         11 LYKGGGLFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSY   54 (78)
Q Consensus        11 ~~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~   54 (78)
                      .|..=..+.|..|+..+.......   ....  ..+-.|+.|+.
T Consensus       116 lHGsl~~~~C~~C~~~~~~~~~~~---~~~~--~~~p~C~~Cg~  154 (250)
T COG0846         116 LHGSLKRVRCSKCGNQYYDEDVIK---FIED--GLIPRCPKCGG  154 (250)
T ss_pred             eccceeeeEeCCCcCccchhhhhh---hccc--CCCCcCccCCC
Confidence            344446678999987776433111   1111  12347888876


No 210
>PF14447 Prok-RING_4:  Prokaryotic RING finger family 4
Probab=22.48  E-value=50  Score=13.96  Aligned_cols=12  Identities=25%  Similarity=0.722  Sum_probs=8.1

Q ss_pred             ccCCCcccccCh
Q psy12014         48 RCPLCSYRAKQK   59 (78)
Q Consensus        48 ~c~~c~~~f~~~   59 (78)
                      -|+.|++.|...
T Consensus        41 gCPfC~~~~~~~   52 (55)
T PF14447_consen   41 GCPFCGTPFEFD   52 (55)
T ss_pred             CCCCCCCcccCC
Confidence            478888776543


No 211
>PF01194 RNA_pol_N:  RNA polymerases N / 8 kDa subunit;  InterPro: IPR000268 In eukaryotes, there are three different forms of DNA-dependent RNA polymerases (2.7.7.6 from EC) transcribing different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. In archaebacteria, there is generally a single form of RNA polymerase which also consists of an oligomeric assemblage of 10 to 13 polypeptides. Archaebacterial subunit N (gene rpoN) [] is a small protein of about 8 kDa, it is evolutionary related [] to a 8.3 kDa component shared by all three forms of eukaryotic RNA polymerases (gene RPB10 in yeast and POLR2J in mammals) as well as to African swine fever virus (ASFV) protein CP80R []. There is a conserved region which is located at the N-terminal extremity of these polymerase subunits; this region contains two cysteines that binds a zinc ion [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_N 3HKZ_N 1EF4_A 3H0G_V 2Y0S_N 2R92_J 3M4O_J 3S2D_J 1R9S_J 1Y1W_J ....
Probab=22.25  E-value=63  Score=13.93  Aligned_cols=14  Identities=29%  Similarity=0.458  Sum_probs=9.2

Q ss_pred             CcccCCCcccccCh
Q psy12014         46 KYRCPLCSYRAKQK   59 (78)
Q Consensus        46 ~~~c~~c~~~f~~~   59 (78)
                      |.+|..||+.....
T Consensus         4 PVRCFTCGkvi~~~   17 (60)
T PF01194_consen    4 PVRCFTCGKVIGNK   17 (60)
T ss_dssp             SSS-STTTSBTCGH
T ss_pred             ceecCCCCCChhHh
Confidence            67888898866533


No 212
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=22.24  E-value=43  Score=12.35  Aligned_cols=10  Identities=20%  Similarity=0.457  Sum_probs=7.0

Q ss_pred             cccCCCcccc
Q psy12014         47 YRCPLCSYRA   56 (78)
Q Consensus        47 ~~c~~c~~~f   56 (78)
                      +.|..|+..|
T Consensus        22 ~~C~~Cg~~~   31 (33)
T PF08792_consen   22 EVCIFCGSSF   31 (33)
T ss_pred             EEcccCCcEe
Confidence            5677787665


No 213
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=22.08  E-value=43  Score=14.19  Aligned_cols=15  Identities=27%  Similarity=0.561  Sum_probs=7.6

Q ss_pred             CCceecCCchhhcCC
Q psy12014         15 GGLFSCSDCSRVYKK   29 (78)
Q Consensus        15 ~~~~~c~~c~~~f~~   29 (78)
                      .+.+.|..||..|..
T Consensus        23 ~rrhhCr~CG~~vC~   37 (69)
T PF01363_consen   23 RRRHHCRNCGRVVCS   37 (69)
T ss_dssp             S-EEE-TTT--EEEC
T ss_pred             eeeEccCCCCCEECC
Confidence            566778888877664


No 214
>KOG4124|consensus
Probab=21.94  E-value=14  Score=21.86  Aligned_cols=21  Identities=38%  Similarity=0.615  Sum_probs=15.1

Q ss_pred             CCCcccCCCcccccChhHHHH
Q psy12014         44 QPKYRCPLCSYRAKQKIHLTT   64 (78)
Q Consensus        44 ~~~~~c~~c~~~f~~~~~l~~   64 (78)
                      .|+++|.+|.+.......|..
T Consensus       396 nk~~r~~i~~~~~k~~~~l~~  416 (442)
T KOG4124|consen  396 NKPYRCEVCSKRYKNLNGLKY  416 (442)
T ss_pred             cCcccChhhhhhhccCCCCCc
Confidence            577899999887776655543


No 215
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=21.84  E-value=49  Score=12.70  Aligned_cols=7  Identities=43%  Similarity=1.369  Sum_probs=3.8

Q ss_pred             ccCCCcc
Q psy12014         48 RCPLCSY   54 (78)
Q Consensus        48 ~c~~c~~   54 (78)
                      .|+.|+.
T Consensus         2 ~Cp~Cg~    8 (43)
T PF08271_consen    2 KCPNCGS    8 (43)
T ss_dssp             SBTTTSS
T ss_pred             CCcCCcC
Confidence            4555554


No 216
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=21.78  E-value=37  Score=12.91  Aligned_cols=9  Identities=44%  Similarity=0.947  Sum_probs=4.7

Q ss_pred             cccCCCccc
Q psy12014         47 YRCPLCSYR   55 (78)
Q Consensus        47 ~~c~~c~~~   55 (78)
                      |.|..|+..
T Consensus        29 y~C~~C~~~   37 (39)
T PF01096_consen   29 YVCCNCGHR   37 (39)
T ss_dssp             EEESSSTEE
T ss_pred             EEeCCCCCe
Confidence            455555543


No 217
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=21.74  E-value=46  Score=12.75  Aligned_cols=10  Identities=40%  Similarity=0.869  Sum_probs=6.5

Q ss_pred             cccCCCcccc
Q psy12014         47 YRCPLCSYRA   56 (78)
Q Consensus        47 ~~c~~c~~~f   56 (78)
                      |.|..|+..+
T Consensus        29 y~C~~C~~~w   38 (40)
T smart00440       29 YVCTKCGHRW   38 (40)
T ss_pred             EEeCCCCCEe
Confidence            5677777554


No 218
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=21.69  E-value=44  Score=11.76  Aligned_cols=7  Identities=43%  Similarity=1.383  Sum_probs=3.6

Q ss_pred             cccCCCc
Q psy12014         47 YRCPLCS   53 (78)
Q Consensus        47 ~~c~~c~   53 (78)
                      |.|..|.
T Consensus        16 Y~C~~c~   22 (30)
T PF03107_consen   16 YHCSECC   22 (30)
T ss_pred             EEeCCCC
Confidence            5555544


No 219
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=21.63  E-value=37  Score=15.93  Aligned_cols=30  Identities=17%  Similarity=0.584  Sum_probs=18.4

Q ss_pred             ceecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCccccc
Q psy12014         17 LFSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSYRAK   57 (78)
Q Consensus        17 ~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~   57 (78)
                      .|.|+.|++.-.        .+.-.+   -|.|..|++.|.
T Consensus        35 ky~Cp~Cgk~~v--------kR~a~G---IW~C~~C~~~~A   64 (90)
T PF01780_consen   35 KYTCPFCGKTSV--------KRVATG---IWKCKKCGKKFA   64 (90)
T ss_dssp             -BEESSSSSSEE--------EEEETT---EEEETTTTEEEE
T ss_pred             CCcCCCCCCcee--------EEeeeE---EeecCCCCCEEe
Confidence            678888876421        133333   388999987664


No 220
>PRK06260 threonine synthase; Validated
Probab=21.43  E-value=73  Score=18.99  Aligned_cols=10  Identities=30%  Similarity=1.165  Sum_probs=4.4

Q ss_pred             eecCCchhhc
Q psy12014         18 FSCSDCSRVY   27 (78)
Q Consensus        18 ~~c~~c~~~f   27 (78)
                      +.|..|+..+
T Consensus         4 ~~C~~cg~~~   13 (397)
T PRK06260          4 LKCIECGKEY   13 (397)
T ss_pred             EEECCCCCCC
Confidence            3444444443


No 221
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=21.33  E-value=44  Score=14.00  Aligned_cols=19  Identities=11%  Similarity=0.204  Sum_probs=11.9

Q ss_pred             CCCcccCCCcccccChhHH
Q psy12014         44 QPKYRCPLCSYRAKQKIHL   62 (78)
Q Consensus        44 ~~~~~c~~c~~~f~~~~~l   62 (78)
                      +.|+....|+..|....-+
T Consensus        22 ~~PV~s~~C~H~fek~aI~   40 (57)
T PF11789_consen   22 EDPVKSKKCGHTFEKEAIL   40 (57)
T ss_dssp             SSEEEESSS--EEEHHHHH
T ss_pred             hCCcCcCCCCCeecHHHHH
Confidence            4567777899888866544


No 222
>PF08252 Leader_CPA1:  arg-2/CPA1 leader peptide ;  InterPro: IPR013203 In this family there are leaders peptides involved in the regulation of the glutaminase subunit (small subunit) of arginine-specific carbamoyl phosphate synthetase. In Neurospora crassa it is a small upstream ORF of 24 codons above the arg-2 locus []. In yeast it is the leader peptide of the CPA1 gene. The 5' region of CPA1 mRNA contains a 25 codon upstream open reading frame. The leader peptide, the product of the upstream open reading frame, plays an essential, negative role in the specific repression of CPA1 by arginine [].; PDB: 2XL1_A.
Probab=21.07  E-value=59  Score=11.02  Aligned_cols=11  Identities=18%  Similarity=0.546  Sum_probs=3.2

Q ss_pred             hcCCHHHHHHH
Q psy12014         26 VYKKKASLTRH   36 (78)
Q Consensus        26 ~f~~~~~l~~h   36 (78)
                      .|.....+..|
T Consensus         7 ~~t~qDYiSDh   17 (24)
T PF08252_consen    7 VFTSQDYISDH   17 (24)
T ss_dssp             ----HHHHHHH
T ss_pred             hhhHHHHHHHH
Confidence            44444444444


No 223
>PF12773 DZR:  Double zinc ribbon
Probab=20.81  E-value=64  Score=12.63  Aligned_cols=11  Identities=36%  Similarity=0.745  Sum_probs=7.3

Q ss_pred             CcccCCCcccc
Q psy12014         46 KYRCPLCSYRA   56 (78)
Q Consensus        46 ~~~c~~c~~~f   56 (78)
                      ...|+.|+...
T Consensus        29 ~~~C~~Cg~~~   39 (50)
T PF12773_consen   29 KKICPNCGAEN   39 (50)
T ss_pred             CCCCcCCcCCC
Confidence            36788887653


No 224
>PF09855 DUF2082:  Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082);  InterPro: IPR018652  This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins.
Probab=20.65  E-value=52  Score=14.29  Aligned_cols=7  Identities=57%  Similarity=1.872  Sum_probs=3.7

Q ss_pred             cccCCCc
Q psy12014         47 YRCPLCS   53 (78)
Q Consensus        47 ~~c~~c~   53 (78)
                      |.|+.|+
T Consensus         1 y~C~KCg    7 (64)
T PF09855_consen    1 YKCPKCG    7 (64)
T ss_pred             CCCCCCC
Confidence            3455554


No 225
>PLN03239 histone acetyltransferase; Provisional
Probab=20.62  E-value=1.1e+02  Score=18.30  Aligned_cols=24  Identities=25%  Similarity=0.432  Sum_probs=20.5

Q ss_pred             CCceecCCchhhcCCHHHHHHHhh
Q psy12014         15 GGLFSCSDCSRVYKKKASLTRHQT   38 (78)
Q Consensus        15 ~~~~~c~~c~~~f~~~~~l~~h~~   38 (78)
                      ..-|.|..|-+-|.....|.+|+.
T Consensus       104 ~~lYiCE~Clky~~~~~~l~~H~~  127 (351)
T PLN03239        104 DVLYVCEFSFGFFARKSELLRFQA  127 (351)
T ss_pred             ceEEEeccchhhhcCHHHHHHHHH
Confidence            456899999999999999988875


No 226
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=20.60  E-value=1.1e+02  Score=16.13  Aligned_cols=19  Identities=32%  Similarity=0.587  Sum_probs=14.1

Q ss_pred             cccCCCcccccChhHHHHH
Q psy12014         47 YRCPLCSYRAKQKIHLTTH   65 (78)
Q Consensus        47 ~~c~~c~~~f~~~~~l~~h   65 (78)
                      +.|+.|++.|..-++...-
T Consensus       131 ~~C~~CgkiYW~GsHw~~m  149 (165)
T COG1656         131 YRCPKCGKIYWKGSHWRRM  149 (165)
T ss_pred             eECCCCcccccCchHHHHH
Confidence            6799999998776665433


No 227
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=20.58  E-value=58  Score=12.44  Aligned_cols=13  Identities=23%  Similarity=0.434  Sum_probs=6.1

Q ss_pred             ccCCCcccccChh
Q psy12014         48 RCPLCSYRAKQKI   60 (78)
Q Consensus        48 ~c~~c~~~f~~~~   60 (78)
                      .|+.|++.|-..+
T Consensus         4 ~CprC~kg~Hwa~   16 (36)
T PF14787_consen    4 LCPRCGKGFHWAS   16 (36)
T ss_dssp             C-TTTSSSCS-TT
T ss_pred             cCcccCCCcchhh
Confidence            4566666655443


No 228
>KOG1818|consensus
Probab=20.58  E-value=27  Score=22.43  Aligned_cols=37  Identities=19%  Similarity=0.414  Sum_probs=19.1

Q ss_pred             CceecCCchhhcCCHHHHHHHhhcccCCCCCc-ccCCC
Q psy12014         16 GLFSCSDCSRVYKKKASLTRHQTYECGQQPKY-RCPLC   52 (78)
Q Consensus        16 ~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~-~c~~c   52 (78)
                      +.+.|.-||..|........--..+.|-.+|. .|..|
T Consensus       180 rkHHCr~CG~vFC~qcss~s~~lP~~Gi~~~VRVCd~C  217 (634)
T KOG1818|consen  180 RKHHCRNCGQVFCGQCSSKSLTLPKLGIEKPVRVCDSC  217 (634)
T ss_pred             ccccccccchhhccCccccccCcccccccccceehhhh
Confidence            55677778887776544333333334422333 25555


No 229
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=20.51  E-value=47  Score=15.62  Aligned_cols=12  Identities=17%  Similarity=0.944  Sum_probs=8.6

Q ss_pred             ceecCCchhhcC
Q psy12014         17 LFSCSDCSRVYK   28 (78)
Q Consensus        17 ~~~c~~c~~~f~   28 (78)
                      -|.|..|++.|.
T Consensus        53 IW~C~~C~~~~A   64 (91)
T TIGR00280        53 IWTCRKCGAKFA   64 (91)
T ss_pred             EEEcCCCCCEEe
Confidence            377888877665


No 230
>PRK12722 transcriptional activator FlhC; Provisional
Probab=20.50  E-value=85  Score=16.93  Aligned_cols=28  Identities=25%  Similarity=0.503  Sum_probs=16.0

Q ss_pred             eecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcc
Q psy12014         18 FSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSY   54 (78)
Q Consensus        18 ~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~   54 (78)
                      ..|..|+..|....        +.. ...+.|+.|..
T Consensus       135 ~~C~~Cgg~fv~~~--------~e~-~~~f~CplC~~  162 (187)
T PRK12722        135 SSCNCCGGHFVTHA--------HDP-VGSFVCGLCQP  162 (187)
T ss_pred             ccCCCCCCCeeccc--------ccc-CCCCcCCCCCC
Confidence            45777877765221        222 33578888853


No 231
>PRK12860 transcriptional activator FlhC; Provisional
Probab=20.49  E-value=85  Score=16.96  Aligned_cols=27  Identities=19%  Similarity=0.527  Sum_probs=15.4

Q ss_pred             eecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCc
Q psy12014         18 FSCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCS   53 (78)
Q Consensus        18 ~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~   53 (78)
                      ..|..|+..|...        .+.. ...+.|+.|.
T Consensus       135 ~~C~~Cgg~fv~~--------~~e~-~~~f~CplC~  161 (189)
T PRK12860        135 ARCCRCGGKFVTH--------AHDL-RHNFVCGLCQ  161 (189)
T ss_pred             ccCCCCCCCeecc--------cccc-CCCCcCCCCC
Confidence            4577777776522        1222 3347888874


No 232
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=20.27  E-value=60  Score=13.20  Aligned_cols=13  Identities=31%  Similarity=0.856  Sum_probs=9.6

Q ss_pred             cccCCCcccccCh
Q psy12014         47 YRCPLCSYRAKQK   59 (78)
Q Consensus        47 ~~c~~c~~~f~~~   59 (78)
                      ++|..|+..+...
T Consensus        29 W~C~~Cgh~w~~~   41 (55)
T PF14311_consen   29 WKCPKCGHEWKAS   41 (55)
T ss_pred             EECCCCCCeeEcc
Confidence            7888888766554


No 233
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=20.27  E-value=85  Score=18.25  Aligned_cols=31  Identities=29%  Similarity=0.585  Sum_probs=17.0

Q ss_pred             ecCCchhhcCCHHHHHHHhhcccCCCCCcccCCCcccccCh
Q psy12014         19 SCSDCSRVYKKKASLTRHQTYECGQQPKYRCPLCSYRAKQK   59 (78)
Q Consensus        19 ~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~~   59 (78)
                      +|+.|+...-.+. |.         ..-+.|+.|+.-|...
T Consensus        40 kc~~C~~~~~~~~-l~---------~~~~vcp~c~~h~rlt   70 (296)
T CHL00174         40 QCENCYGLNYKKF-LK---------SKMNICEQCGYHLKMS   70 (296)
T ss_pred             ECCCccchhhHHH-HH---------HcCCCCCCCCCCcCCC
Confidence            5888876543221 11         2236788888766533


Done!