Query         psy12015
Match_columns 96
No_of_seqs    110 out of 1272
Neff          10.7
Searched_HMMs 46136
Date          Fri Aug 16 16:29:21 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12015.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12015hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.8 2.2E-19 4.8E-24  106.9   3.3   72   18-94    167-238 (279)
  2 KOG2462|consensus               99.8 1.5E-19 3.2E-24  107.6   2.2   76   15-93    190-265 (279)
  3 KOG3623|consensus               99.5 1.1E-14 2.3E-19   96.5   0.9   72   18-92    900-971 (1007)
  4 KOG3576|consensus               99.4   6E-14 1.3E-18   81.0  -0.6   75   18-95    123-197 (267)
  5 KOG1074|consensus               99.2   3E-12 6.5E-17   86.0   0.8   78   16-95    609-692 (958)
  6 KOG3623|consensus               99.2 5.4E-12 1.2E-16   84.1   1.0   74   16-92    244-330 (1007)
  7 KOG3576|consensus               99.1 7.2E-11 1.6E-15   68.5   3.2   77   16-95    149-236 (267)
  8 PHA02768 hypothetical protein;  99.0 9.8E-11 2.1E-15   54.6   1.6   43   42-87      5-47  (55)
  9 KOG1074|consensus               99.0 5.9E-11 1.3E-15   80.0   0.5   53   42-95    353-405 (958)
 10 PHA00733 hypothetical protein   99.0 5.8E-10 1.3E-14   61.2   4.1   55   38-95     69-123 (128)
 11 PF13465 zf-H2C2_2:  Zinc-finge  98.7 6.1E-09 1.3E-13   41.8   1.7   18   35-52      7-24  (26)
 12 PF13465 zf-H2C2_2:  Zinc-finge  98.7 5.8E-09 1.3E-13   41.9   1.1   26   57-83      1-26  (26)
 13 KOG3608|consensus               98.5 1.1E-08 2.4E-13   63.8  -0.6   74   18-94    185-260 (467)
 14 KOG3608|consensus               98.5   1E-07 2.3E-12   59.6   2.4   72   18-92    269-342 (467)
 15 PHA00732 hypothetical protein   98.4 1.4E-07 3.1E-12   47.6   2.1   44   42-92      1-45  (79)
 16 PHA00616 hypothetical protein   98.3 3.4E-07 7.4E-12   40.9   0.9   34   42-76      1-34  (44)
 17 PF00096 zf-C2H2:  Zinc finger,  98.2 4.9E-07 1.1E-11   35.0   1.2   22   72-93      1-22  (23)
 18 PF13894 zf-C2H2_4:  C2H2-type   98.2   1E-06 2.2E-11   34.2   1.6   24   72-95      1-24  (24)
 19 PHA00616 hypothetical protein   98.1 5.4E-07 1.2E-11   40.2   0.2   25   71-95      1-25  (44)
 20 PF13912 zf-C2H2_6:  C2H2-type   98.0 2.4E-06 5.2E-11   34.3   1.2   24   72-95      2-25  (27)
 21 KOG3993|consensus               98.0 2.1E-06 4.7E-11   54.9   1.4   54   41-95    294-380 (500)
 22 PHA02768 hypothetical protein;  98.0 2.6E-06 5.6E-11   39.9   0.9   42   14-59      7-48  (55)
 23 PF05605 zf-Di19:  Drought indu  97.9 2.2E-05 4.7E-10   36.8   3.3   51   42-95      2-53  (54)
 24 PLN03086 PRLI-interacting fact  97.9 2.2E-05 4.7E-10   52.5   4.0   49   26-81    466-514 (567)
 25 PHA00733 hypothetical protein   97.9 7.4E-06 1.6E-10   45.1   1.6   56   37-93     35-95  (128)
 26 PLN03086 PRLI-interacting fact  97.8 3.3E-05 7.1E-10   51.7   4.2   70   18-93    483-562 (567)
 27 PF13912 zf-C2H2_6:  C2H2-type   97.7   2E-05 4.3E-10   31.5   1.5   26   42-67      1-26  (27)
 28 PF00096 zf-C2H2:  Zinc finger,  97.7 2.4E-05 5.3E-10   30.0   1.6   23   43-65      1-23  (23)
 29 smart00355 ZnF_C2H2 zinc finge  97.5 7.9E-05 1.7E-09   29.0   1.4   23   72-94      1-23  (26)
 30 PF09237 GAGA:  GAGA factor;  I  97.4 0.00011 2.3E-09   33.7   1.8   31   39-69     21-51  (54)
 31 PF12756 zf-C2H2_2:  C2H2 type   97.4 0.00014   3E-09   37.8   2.0   69   18-94      5-73  (100)
 32 PRK04860 hypothetical protein;  97.3 0.00031 6.8E-09   40.1   3.1   39   41-84    118-156 (160)
 33 PF13894 zf-C2H2_4:  C2H2-type   97.2 0.00036 7.9E-09   26.6   1.8   23   43-65      1-23  (24)
 34 PF12874 zf-met:  Zinc-finger o  97.2 0.00022 4.8E-09   27.8   1.1   22   72-93      1-22  (25)
 35 PF09237 GAGA:  GAGA factor;  I  97.1 0.00052 1.1E-08   31.5   2.3   36   61-96     14-49  (54)
 36 COG5189 SFP1 Putative transcri  97.1 0.00026 5.7E-09   44.3   1.6   55   39-94    346-421 (423)
 37 KOG3993|consensus               96.9 0.00017 3.7E-09   46.6  -0.6   52   42-94    267-318 (500)
 38 PF13909 zf-H2C2_5:  C2H2-type   96.8 0.00065 1.4E-08   26.2   1.0   23   72-95      1-23  (24)
 39 smart00355 ZnF_C2H2 zinc finge  96.7  0.0012 2.5E-08   25.4   1.5   24   43-66      1-24  (26)
 40 PF12171 zf-C2H2_jaz:  Zinc-fin  96.7 0.00057 1.2E-08   27.3   0.4   22   72-93      2-23  (27)
 41 PF12874 zf-met:  Zinc-finger o  96.4  0.0026 5.6E-08   24.6   1.5   23   43-65      1-23  (25)
 42 PF13913 zf-C2HC_2:  zinc-finge  96.1  0.0049 1.1E-07   24.2   1.5   20   72-92      3-22  (25)
 43 PHA00732 hypothetical protein   95.9    0.01 2.2E-07   30.0   2.5   45   15-67      4-49  (79)
 44 smart00451 ZnF_U1 U1-like zinc  95.2   0.021 4.6E-07   23.8   1.9   22   72-93      4-25  (35)
 45 cd00350 rubredoxin_like Rubred  93.5   0.064 1.4E-06   22.4   1.5   24   43-79      2-25  (33)
 46 COG5189 SFP1 Putative transcri  92.9   0.043 9.4E-07   34.8   0.7   23   40-62    396-418 (423)
 47 PRK04860 hypothetical protein;  92.8   0.051 1.1E-06   31.2   0.9   31   24-56    127-157 (160)
 48 COG5048 FOG: Zn-finger [Genera  92.8   0.043 9.2E-07   35.2   0.6   52   42-94    289-346 (467)
 49 PF05605 zf-Di19:  Drought indu  92.5    0.12 2.5E-06   24.0   1.7   23   72-95      3-25  (54)
 50 KOG1146|consensus               92.4   0.087 1.9E-06   39.1   1.7   70   22-93    446-540 (1406)
 51 TIGR02098 MJ0042_CXXC MJ0042 f  90.7     0.2 4.3E-06   21.3   1.4   34   43-82      3-36  (38)
 52 COG2888 Predicted Zn-ribbon RN  90.5    0.36 7.7E-06   23.0   2.2   32   42-79     27-58  (61)
 53 COG1592 Rubrerythrin [Energy p  90.4    0.21 4.4E-06   28.9   1.6   24   42-79    134-157 (166)
 54 PF09986 DUF2225:  Uncharacteri  90.3    0.15 3.3E-06   30.6   1.1   45   40-84      3-61  (214)
 55 cd00729 rubredoxin_SM Rubredox  90.2    0.28   6E-06   20.6   1.6   25   42-79      2-26  (34)
 56 PF13717 zinc_ribbon_4:  zinc-r  90.2    0.29 6.2E-06   20.8   1.6   33   43-81      3-35  (36)
 57 COG4049 Uncharacterized protei  90.0    0.12 2.5E-06   24.3   0.4   33   35-67     10-42  (65)
 58 PF13719 zinc_ribbon_5:  zinc-r  90.0    0.52 1.1E-05   20.1   2.4   34   43-82      3-36  (37)
 59 PRK00398 rpoP DNA-directed RNA  88.5    0.41 8.8E-06   21.4   1.6   30   41-81      2-31  (46)
 60 PF12756 zf-C2H2_2:  C2H2 type   88.4    0.42 9.2E-06   24.4   1.9   25   42-66     50-74  (100)
 61 KOG2186|consensus               88.0    0.53 1.1E-05   29.1   2.2   38   43-83      4-41  (276)
 62 smart00531 TFIIE Transcription  87.4    0.95 2.1E-05   25.5   3.0   39   39-82     96-134 (147)
 63 COG5048 FOG: Zn-finger [Genera  87.2    0.42 9.1E-06   30.7   1.6   59   14-75    291-355 (467)
 64 COG1997 RPL43A Ribosomal prote  87.0    0.31 6.8E-06   25.0   0.8   32   40-82     33-64  (89)
 65 TIGR02605 CxxC_CxxC_SSSS putat  86.3    0.36 7.8E-06   22.0   0.7   30   42-79      5-34  (52)
 66 smart00834 CxxC_CXXC_SSSS Puta  86.3    0.42   9E-06   20.5   0.9   31   42-80      5-35  (41)
 67 smart00659 RPOLCX RNA polymera  86.1     1.2 2.7E-05   19.8   2.4   27   42-80      2-28  (44)
 68 PF09723 Zn-ribbon_8:  Zinc rib  86.0    0.35 7.5E-06   21.3   0.6   30   42-79      5-34  (42)
 69 TIGR00373 conserved hypothetic  85.8    0.69 1.5E-05   26.5   1.9   36   38-83    105-140 (158)
 70 KOG2893|consensus               85.7    0.28   6E-06   30.1   0.3   42   40-87      9-50  (341)
 71 PRK14890 putative Zn-ribbon RN  85.1     1.2 2.5E-05   21.3   2.1   32   42-79     25-56  (59)
 72 PRK06266 transcription initiat  85.0    0.92   2E-05   26.5   2.2   36   39-84    114-149 (178)
 73 PF04959 ARS2:  Arsenite-resist  84.8    0.55 1.2E-05   28.3   1.2   26   69-95     76-101 (214)
 74 PF02892 zf-BED:  BED zinc fing  84.5     1.2 2.5E-05   19.6   2.0   22   72-93     17-42  (45)
 75 smart00734 ZnF_Rad18 Rad18-lik  84.0     1.1 2.3E-05   17.6   1.5   19   73-92      3-21  (26)
 76 PHA00626 hypothetical protein   83.0    0.77 1.7E-05   21.6   1.0   12   42-53     23-34  (59)
 77 PF12013 DUF3505:  Protein of u  82.7     1.1 2.3E-05   23.9   1.7   25   72-96     81-109 (109)
 78 PRK00464 nrdR transcriptional   81.6    0.55 1.2E-05   26.9   0.3   13   43-55     29-41  (154)
 79 smart00614 ZnF_BED BED zinc fi  81.1     1.5 3.3E-05   19.9   1.7   21   72-92     19-44  (50)
 80 PF14353 CpXC:  CpXC protein     80.4    0.94   2E-05   24.8   1.0   13   72-84     39-51  (128)
 81 PF09538 FYDLN_acid:  Protein o  79.6     1.7 3.8E-05   23.3   1.8   30   43-84     10-39  (108)
 82 KOG2231|consensus               77.3     3.2   7E-05   29.3   2.9   48   44-96    184-237 (669)
 83 cd00730 rubredoxin Rubredoxin;  76.7     1.2 2.7E-05   20.4   0.6   36   43-79      2-42  (50)
 84 PF00301 Rubredoxin:  Rubredoxi  76.6     2.7 5.9E-05   19.0   1.7   36   43-79      2-42  (47)
 85 PRK03824 hypA hydrogenase nick  76.2     1.6 3.5E-05   24.3   1.1   15   41-55     69-83  (135)
 86 KOG1146|consensus               74.3     1.1 2.4E-05   33.8   0.2   55   39-94   1281-1351(1406)
 87 PF07754 DUF1610:  Domain of un  73.9     2.3   5E-05   16.4   1.0    8   72-79     17-24  (24)
 88 PF04959 ARS2:  Arsenite-resist  73.7     2.7 5.8E-05   25.5   1.7   29   39-67     74-102 (214)
 89 COG3091 SprT Zn-dependent meta  72.9     2.7 5.8E-05   24.1   1.4   36   40-81    115-150 (156)
 90 PF10571 UPF0547:  Uncharacteri  72.5     2.5 5.3E-05   16.6   0.9   10   73-82     16-25  (26)
 91 COG5236 Uncharacterized conser  70.7     4.3 9.3E-05   26.6   2.1   48   44-96    222-276 (493)
 92 PF05443 ROS_MUCR:  ROS/MUCR tr  69.2     2.9 6.2E-05   23.4   1.1   21   72-95     73-93  (132)
 93 COG1996 RPC10 DNA-directed RNA  68.6     5.2 0.00011   18.3   1.6   30   40-80      4-33  (49)
 94 PF08790 zf-LYAR:  LYAR-type C2  66.9     2.7 5.9E-05   16.9   0.5   19   43-62      1-19  (28)
 95 PF07975 C1_4:  TFIIH C1-like d  66.7     2.2 4.8E-05   19.7   0.3   26   40-65     19-44  (51)
 96 KOG3408|consensus               64.0     4.1 8.9E-05   22.4   1.0   22   72-93     58-79  (129)
 97 TIGR00100 hypA hydrogenase nic  63.2     4.9 0.00011   21.8   1.2   27   41-80     69-95  (115)
 98 KOG4167|consensus               62.9    0.95 2.1E-05   32.2  -1.9   23   72-94    793-815 (907)
 99 PRK12380 hydrogenase nickel in  61.4     5.7 0.00012   21.5   1.3   26   41-79     69-94  (113)
100 TIGR02300 FYDLN_acid conserved  60.6     8.1 0.00017   21.5   1.7   30   43-84     10-39  (129)
101 smart00154 ZnF_AN1 AN1-like Zi  60.3     6.6 0.00014   16.9   1.2   13   72-84     13-25  (39)
102 COG1655 Uncharacterized protei  60.0     2.5 5.3E-05   26.0  -0.3   28   40-67     17-44  (267)
103 PF09963 DUF2197:  Uncharacteri  59.6     8.5 0.00018   18.2   1.5   38   43-80      3-40  (56)
104 PF03604 DNA_RNApol_7kD:  DNA d  58.9     6.4 0.00014   16.2   0.9    9   72-80     18-26  (32)
105 cd00924 Cyt_c_Oxidase_Vb Cytoc  58.3     3.9 8.5E-05   21.6   0.3   10   72-81     80-89  (97)
106 PF09845 DUF2072:  Zn-ribbon co  56.9     8.7 0.00019   21.5   1.5   15   42-56      1-15  (131)
107 PF07295 DUF1451:  Protein of u  56.8     8.2 0.00018   22.0   1.4   35   35-80    101-139 (146)
108 KOG2636|consensus               56.7     9.5 0.00021   25.8   1.9   29   63-92    394-423 (497)
109 PF10537 WAC_Acf1_DNA_bd:  ATP-  55.9      23  0.0005   18.9   2.9   38   41-80      2-39  (102)
110 COG3364 Zn-ribbon containing p  55.6     9.3  0.0002   20.4   1.4   15   41-55      1-15  (112)
111 PRK09678 DNA-binding transcrip  54.8     6.9 0.00015   19.5   0.8   17   41-57     26-44  (72)
112 KOG2593|consensus               54.2     9.2  0.0002   25.7   1.5   40   38-81    124-163 (436)
113 KOG1842|consensus               53.6     5.5 0.00012   26.9   0.5   24   72-95     16-39  (505)
114 PF01927 Mut7-C:  Mut7-C RNAse   53.3      13 0.00029   20.9   1.9   48   42-90     91-143 (147)
115 PRK05452 anaerobic nitric oxid  52.7     8.7 0.00019   26.1   1.3   41   39-80    422-467 (479)
116 PF10013 DUF2256:  Uncharacteri  52.5      10 0.00022   16.8   1.1   11   45-55     11-21  (42)
117 TIGR01206 lysW lysine biosynth  52.0      11 0.00024   17.6   1.2   30   43-81      3-32  (54)
118 PRK04351 hypothetical protein;  52.0      11 0.00023   21.6   1.4   33   42-83    112-144 (149)
119 PF01428 zf-AN1:  AN1-like Zinc  50.2       7 0.00015   17.1   0.4   12   72-83     14-25  (43)
120 PF01363 FYVE:  FYVE zinc finge  49.5      11 0.00023   18.1   1.0   28   43-83     10-37  (69)
121 COG1773 Rubredoxin [Energy pro  49.4     8.4 0.00018   18.1   0.6   11   72-82      4-14  (55)
122 PRK00564 hypA hydrogenase nick  49.1      10 0.00022   20.6   1.0   15   40-54     69-83  (117)
123 KOG2785|consensus               48.7      23  0.0005   23.5   2.6   52   42-93    166-242 (390)
124 KOG2893|consensus               47.7      10 0.00022   23.6   0.9   26   69-96     10-35  (341)
125 TIGR00622 ssl1 transcription f  47.5      16 0.00036   19.8   1.6   22   72-93     82-103 (112)
126 PF04780 DUF629:  Protein of un  46.6      16 0.00035   24.9   1.8   28   67-95     54-81  (466)
127 PF13451 zf-trcl:  Probable zin  46.5      12 0.00025   17.2   0.8   18   40-57      2-19  (49)
128 COG0068 HypF Hydrogenase matur  46.3     7.7 0.00017   27.8   0.3   56   15-80    126-182 (750)
129 PF04810 zf-Sec23_Sec24:  Sec23  46.2     6.3 0.00014   17.0  -0.1   32   42-80      2-33  (40)
130 PRK00762 hypA hydrogenase nick  46.1      13 0.00028   20.4   1.1   33   40-79     68-100 (124)
131 PF04423 Rad50_zn_hook:  Rad50   45.7       8 0.00017   17.7   0.2   13   72-84     21-33  (54)
132 PF03811 Zn_Tnp_IS1:  InsA N-te  45.3      17 0.00037   15.4   1.2   19   58-77     17-35  (36)
133 PF10263 SprT-like:  SprT-like   44.0      11 0.00024   21.1   0.7   32   42-82    123-154 (157)
134 PF02176 zf-TRAF:  TRAF-type zi  43.8      27 0.00058   16.0   1.9   41   40-82      7-53  (60)
135 PF02891 zf-MIZ:  MIZ/SP-RING z  43.8      11 0.00024   17.1   0.5   10   69-79     40-49  (50)
136 PF06397 Desulfoferrod_N:  Desu  43.2      11 0.00024   16.1   0.4   10   72-81      7-16  (36)
137 PLN02294 cytochrome c oxidase   43.1      12 0.00027   21.9   0.8   27   26-55    128-154 (174)
138 PF01155 HypA:  Hydrogenase exp  41.9      11 0.00025   20.2   0.5   27   41-80     69-95  (113)
139 cd00065 FYVE FYVE domain; Zinc  41.2      26 0.00056   15.9   1.6    9   44-52     20-28  (57)
140 PRK03681 hypA hydrogenase nick  40.6      15 0.00033   19.9   0.8   28   41-80     69-96  (114)
141 PF07282 OrfB_Zn_ribbon:  Putat  39.7      26 0.00057   16.7   1.6   14   69-83     45-58  (69)
142 smart00064 FYVE Protein presen  39.7      23  0.0005   16.8   1.3   10   44-53     12-21  (68)
143 PF11789 zf-Nse:  Zinc-finger o  39.5      38 0.00083   15.9   2.0   34   39-77     21-54  (57)
144 COG4888 Uncharacterized Zn rib  39.3      11 0.00024   20.0   0.2   38   40-82     20-57  (104)
145 PF13878 zf-C2H2_3:  zinc-finge  39.0      32 0.00068   14.9   1.6   23   43-65     14-38  (41)
146 COG3677 Transposase and inacti  38.8      17 0.00036   20.2   0.8   16   68-84     51-66  (129)
147 KOG2231|consensus               38.2      29 0.00064   24.9   2.0   75   20-96    122-207 (669)
148 smart00731 SprT SprT homologue  38.1      25 0.00053   19.7   1.5   32   42-81    112-143 (146)
149 COG1198 PriA Primosomal protei  37.5      31 0.00067   25.1   2.1    9   72-80    476-484 (730)
150 PF11931 DUF3449:  Domain of un  37.4      11 0.00024   22.6   0.0   27   65-92     96-123 (196)
151 COG1327 Predicted transcriptio  36.8      13 0.00027   21.4   0.2   12   44-55     30-41  (156)
152 COG5188 PRP9 Splicing factor 3  35.8      26 0.00057   23.2   1.5   28   63-91    367-395 (470)
153 PRK00432 30S ribosomal protein  35.6      32  0.0007   15.7   1.4    9   72-80     38-46  (50)
154 PF13824 zf-Mss51:  Zinc-finger  35.5      32 0.00069   16.2   1.4   11   40-50     12-22  (55)
155 PF08274 PhnA_Zn_Ribbon:  PhnA   35.4      32 0.00069   14.0   1.2    8   72-79     20-27  (30)
156 PF02591 DUF164:  Putative zinc  35.1      52  0.0011   15.1   2.6   32   44-80     24-55  (56)
157 PF12907 zf-met2:  Zinc-binding  34.9      15 0.00033   16.0   0.2   22   72-93      2-26  (40)
158 COG4957 Predicted transcriptio  33.7      23 0.00049   20.0   0.8   25   43-70     77-101 (148)
159 cd00974 DSRD Desulforedoxin (D  32.1      26 0.00057   14.3   0.7   10   72-81      5-14  (34)
160 COG1779 C4-type Zn-finger prot  32.0      11 0.00023   22.7  -0.6   40   42-83     14-55  (201)
161 TIGR00319 desulf_FeS4 desulfof  31.9      27 0.00058   14.3   0.7   10   72-81      8-17  (34)
162 KOG0717|consensus               31.5      31 0.00066   23.7   1.3   22   72-93    293-314 (508)
163 PLN02748 tRNA dimethylallyltra  31.4      39 0.00084   23.2   1.8   24   69-93    417-441 (468)
164 KOG0402|consensus               30.8      20 0.00044   18.4   0.3   31   41-82     35-65  (92)
165 KOG2071|consensus               30.6      35 0.00075   24.1   1.5   23   72-94    419-441 (579)
166 KOG2482|consensus               30.1      33 0.00072   22.6   1.2   22   72-93    196-217 (423)
167 PF01215 COX5B:  Cytochrome c o  29.7      27 0.00059   19.7   0.7   24   29-55    102-125 (136)
168 KOG4727|consensus               29.3      31 0.00067   20.4   0.9   21   72-92     76-96  (193)
169 PF13453 zf-TFIIB:  Transcripti  29.3      54  0.0012   14.0   1.5   18   72-89     20-37  (41)
170 COG5216 Uncharacterized conser  29.2      26 0.00056   16.7   0.5   10   72-82     23-32  (67)
171 KOG1994|consensus               29.1      30 0.00064   21.4   0.9   21   41-61    238-258 (268)
172 PF08209 Sgf11:  Sgf11 (transcr  28.8      27 0.00059   14.5   0.5   11   72-82      5-15  (33)
173 COG4391 Uncharacterized protei  28.6      40 0.00087   16.3   1.1   44   35-83     17-60  (62)
174 PRK11032 hypothetical protein;  28.5      42 0.00092   19.5   1.4   35   35-80    113-151 (160)
175 COG3357 Predicted transcriptio  28.0      25 0.00053   18.4   0.3   29   40-79     56-84  (97)
176 smart00440 ZnF_C2C2 C2C2 Zinc   27.8      41 0.00089   14.4   1.0   10   72-81     29-38  (40)
177 PF01286 XPA_N:  XPA protein N-  27.7      28 0.00061   14.6   0.4   12   73-84      5-16  (34)
178 COG1656 Uncharacterized conser  27.3      79  0.0017   18.5   2.3   19   72-90    131-149 (165)
179 COG1571 Predicted DNA-binding   27.2      50  0.0011   22.4   1.7   29   44-84    352-380 (421)
180 PF11672 DUF3268:  Protein of u  26.6      54  0.0012   17.5   1.5    9   42-50      2-10  (102)
181 TIGR03829 YokU_near_AblA uncha  26.3      48   0.001   17.3   1.2   19   69-87     33-51  (89)
182 KOG4173|consensus               26.1      24 0.00052   21.5   0.1   19   73-91    108-126 (253)
183 COG4306 Uncharacterized protei  26.0      33 0.00071   19.2   0.6   12   72-83     69-80  (160)
184 TIGR00244 transcriptional regu  25.9      34 0.00075   19.6   0.7   13   72-84     29-41  (147)
185 KOG2907|consensus               25.6      43 0.00092   18.3   1.0   40   42-83     74-114 (116)
186 COG1379 PHP family phosphoeste  25.5      31 0.00067   22.7   0.5   10   72-81    266-275 (403)
187 PF10083 DUF2321:  Uncharacteri  25.3      22 0.00048   20.5  -0.1   13   72-84     69-81  (158)
188 COG4338 Uncharacterized protei  25.2      23 0.00051   16.2  -0.0   11   74-84     15-25  (54)
189 TIGR00686 phnA alkylphosphonat  24.2      62  0.0013   17.6   1.4   12   42-53     19-30  (109)
190 PF13240 zinc_ribbon_2:  zinc-r  23.6      50  0.0011   12.3   0.8    6   74-79     16-21  (23)
191 PTZ00043 cytochrome c oxidase   23.3      39 0.00085   20.9   0.7   16   40-55    179-194 (268)
192 PF14447 Prok-RING_4:  Prokaryo  23.2      52  0.0011   15.5   0.9   12   73-84     41-52  (55)
193 PRK14892 putative transcriptio  23.1      69  0.0015   17.0   1.5   35   41-83     20-54  (99)
194 PHA02998 RNA polymerase subuni  23.0      36 0.00077   20.3   0.4   39   42-84    143-184 (195)
195 COG1326 Uncharacterized archae  22.1 1.2E+02  0.0026   18.4   2.4   16   67-82     26-41  (201)
196 PF14369 zf-RING_3:  zinc-finge  21.9      49  0.0011   13.8   0.7   32   42-83      2-33  (35)
197 PF05876 Terminase_GpA:  Phage   21.7      46   0.001   23.3   0.8   41   43-84    201-242 (557)
198 KOG0978|consensus               21.7      38 0.00083   24.5   0.4   17   72-88    679-695 (698)
199 PRK10220 hypothetical protein;  21.4      88  0.0019   17.0   1.7   12   42-53     20-31  (111)
200 COG1675 TFA1 Transcription ini  21.3      77  0.0017   18.8   1.6   36   38-83    109-144 (176)
201 smart00661 RPOL9 RNA polymeras  21.3      56  0.0012   14.4   0.9   12   72-83     21-32  (52)
202 KOG0227|consensus               21.2      54  0.0012   19.8   0.9   16   72-87     54-69  (222)
203 COG0675 Transposase and inacti  21.2      64  0.0014   20.3   1.4   14   69-83    321-334 (364)
204 COG5112 UFD2 U1-like Zn-finger  21.0      46 0.00099   18.0   0.6   25   39-63     52-76  (126)
205 PRK12722 transcriptional activ  20.9      76  0.0016   19.0   1.5   29   42-79    134-162 (187)
206 KOG3507|consensus               20.3   1E+02  0.0022   14.8   1.5   29   40-80     18-46  (62)
207 COG0846 SIR2 NAD-dependent pro  20.2      96  0.0021   19.4   1.9   36   39-79    119-154 (250)
208 PLN03238 probable histone acet  20.1   1E+02  0.0022   19.9   2.0   21   72-92     49-69  (290)

No 1  
>KOG2462|consensus
Probab=99.77  E-value=2.2e-19  Score=106.88  Aligned_cols=72  Identities=21%  Similarity=0.472  Sum_probs=36.2

Q ss_pred             cccccccchhhhhhhccccccccCeeeccccccccccchhHHHHhhhhcCCCCceeCCCCCCCCCCchhHHHHHhhc
Q psy12015         18 LDFGVIRNSSVDKSLNTNVLTVHIDLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHRSKHKAHLTTHMAIK   94 (96)
Q Consensus        18 ~~~~~~~~~~~~~h~~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~r~~   94 (96)
                      +++.+.+...|+.|+  ++|+  .+++|..||+.|+..|-|..|+|+|+|++| |.|+.|+++|.++++|.-|+++|
T Consensus       167 C~K~YvSmpALkMHi--rTH~--l~c~C~iCGKaFSRPWLLQGHiRTHTGEKP-F~C~hC~kAFADRSNLRAHmQTH  238 (279)
T KOG2462|consen  167 CGKVYVSMPALKMHI--RTHT--LPCECGICGKAFSRPWLLQGHIRTHTGEKP-FSCPHCGKAFADRSNLRAHMQTH  238 (279)
T ss_pred             CCceeeehHHHhhHh--hccC--CCcccccccccccchHHhhcccccccCCCC-ccCCcccchhcchHHHHHHHHhh
Confidence            444444444455554  4444  344555555555555555555555555444 55555555555555555555544


No 2  
>KOG2462|consensus
Probab=99.77  E-value=1.5e-19  Score=107.61  Aligned_cols=76  Identities=18%  Similarity=0.260  Sum_probs=71.5

Q ss_pred             ccccccccccchhhhhhhccccccccCeeeccccccccccchhHHHHhhhhcCCCCceeCCCCCCCCCCchhHHHHHhh
Q psy12015         15 NTKLDFGVIRNSSVDKSLNTNVLTVHIDLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHRSKHKAHLTTHMAI   93 (96)
Q Consensus        15 ~~~~~~~~~~~~~~~~h~~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~r~   93 (96)
                      +..+|+.|++.=-|+.|+  ++|+|||||.|..|++.|...++|..|+++|.+.++ |+|+.|+|.|...+-|++|...
T Consensus       190 C~iCGKaFSRPWLLQGHi--RTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~-~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  190 CGICGKAFSRPWLLQGHI--RTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKK-HQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             cccccccccchHHhhccc--ccccCCCCccCCcccchhcchHHHHHHHHhhcCCcc-ccCcchhhHHHHHHHHHHhhhh
Confidence            345899999998899999  999999999999999999999999999999999998 9999999999999999999764


No 3  
>KOG3623|consensus
Probab=99.46  E-value=1.1e-14  Score=96.53  Aligned_cols=72  Identities=26%  Similarity=0.540  Sum_probs=69.2

Q ss_pred             cccccccchhhhhhhccccccccCeeeccccccccccchhHHHHhhhhcCCCCceeCCCCCCCCCCchhHHHHHh
Q psy12015         18 LDFGVIRNSSVDKSLNTNVLTVHIDLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHRSKHKAHLTTHMA   92 (96)
Q Consensus        18 ~~~~~~~~~~~~~h~~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~r   92 (96)
                      +++.|...++|..|.  --|+|.+||.|..|.+.|..+..|+.|.|.|.|++| |+|+.|+|.|.......+|+.
T Consensus       900 CDK~FqKqSSLaRHK--YEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKP-fQCdKClKRFSHSGSYSQHMN  971 (1007)
T KOG3623|consen  900 CDKAFQKQSSLARHK--YEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKP-FQCDKCLKRFSHSGSYSQHMN  971 (1007)
T ss_pred             HHHHHHhhHHHHHhh--hhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCc-chhhhhhhhcccccchHhhhc
Confidence            889999999999999  999999999999999999999999999999999999 999999999999999999875


No 4  
>KOG3576|consensus
Probab=99.36  E-value=6e-14  Score=81.03  Aligned_cols=75  Identities=21%  Similarity=0.408  Sum_probs=68.5

Q ss_pred             cccccccchhhhhhhccccccccCeeeccccccccccchhHHHHhhhhcCCCCceeCCCCCCCCCCchhHHHHHhhcC
Q psy12015         18 LDFGVIRNSSVDKSLNTNVLTVHIDLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHRSKHKAHLTTHMAIKH   95 (96)
Q Consensus        18 ~~~~~~~~~~~~~h~~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~r~~h   95 (96)
                      +++.|....-|..|+  ..|...+.+.|..||+.|...-+|.+|.++|+|.+| |+|..|+++|.++..|..|.+--|
T Consensus       123 CgK~F~lQRmlnrh~--kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrp-ykc~~c~kaftqrcsleshl~kvh  197 (267)
T KOG3576|consen  123 CGKKFGLQRMLNRHL--KCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRP-YKCSLCEKAFTQRCSLESHLKKVH  197 (267)
T ss_pred             hhhhhhHHHHHHHHh--hhccHHHHHHHhhccCcccchhhhhhhhccccCccc-cchhhhhHHHHhhccHHHHHHHHc
Confidence            888899888899999  889988999999999999999999999999999888 999999999999999998887543


No 5  
>KOG1074|consensus
Probab=99.21  E-value=3e-12  Score=86.02  Aligned_cols=78  Identities=19%  Similarity=0.358  Sum_probs=68.5

Q ss_pred             cccccccccchhhhhhhccccccccCeeeccccccccccchhHHHHhhhhcCCCC---ceeCC---CCCCCCCCchhHHH
Q psy12015         16 TKLDFGVIRNSSVDKSLNTNVLTVHIDLKCDVCEKGYRYKTGLWRHKKFECGQEP---KYQCP---HCPHRSKHKAHLTT   89 (96)
Q Consensus        16 ~~~~~~~~~~~~~~~h~~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~---~~~C~---~c~~~f~~~~~l~~   89 (96)
                      .-|.+-.+..+.|+.|+  ++|+||+||+|..|++.|..+.+|..|+.+|...-+   .+.|+   +|.+.|.....+..
T Consensus       609 iiC~rVlSC~saLqmHy--rtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn~V~lpQ  686 (958)
T KOG1074|consen  609 IICLRVLSCPSALQMHY--RTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTNAVTLPQ  686 (958)
T ss_pred             eeeeecccchhhhhhhh--hcccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhcccccccccccc
Confidence            33667788999999999  999999999999999999999999999998876322   27798   89999999999999


Q ss_pred             HHhhcC
Q psy12015         90 HMAIKH   95 (96)
Q Consensus        90 h~r~~h   95 (96)
                      |+|+|.
T Consensus       687 hIriH~  692 (958)
T KOG1074|consen  687 HIRIHL  692 (958)
T ss_pred             eEEeec
Confidence            999874


No 6  
>KOG3623|consensus
Probab=99.18  E-value=5.4e-12  Score=84.05  Aligned_cols=74  Identities=22%  Similarity=0.628  Sum_probs=64.7

Q ss_pred             cccccccccchhhhhhhcccccc-------------ccCeeeccccccccccchhHHHHhhhhcCCCCceeCCCCCCCCC
Q psy12015         16 TKLDFGVIRNSSVDKSLNTNVLT-------------VHIDLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHRSK   82 (96)
Q Consensus        16 ~~~~~~~~~~~~~~~h~~~~~~~-------------~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~   82 (96)
                      .-+.-+|.++..|..|+  .+|.             ..+.|+|..|++.|..+..|..|+|+|.|++| |+|+.|+|.|.
T Consensus       244 ~lCsytFAyRtQLErhm--~~hkpg~dqa~sltqsa~lRKFKCtECgKAFKfKHHLKEHlRIHSGEKP-feCpnCkKRFS  320 (1007)
T KOG3623|consen  244 MLCSYTFAYRTQLERHM--QLHKPGGDQAISLTQSALLRKFKCTECGKAFKFKHHLKEHLRIHSGEKP-FECPNCKKRFS  320 (1007)
T ss_pred             hhhhhhhhhHHHHHHHH--HhhcCCCcccccccchhhhccccccccchhhhhHHHHHhhheeecCCCC-cCCcccccccc
Confidence            33667889999999998  5555             24579999999999999999999999999999 99999999999


Q ss_pred             CchhHHHHHh
Q psy12015         83 HKAHLTTHMA   92 (96)
Q Consensus        83 ~~~~l~~h~r   92 (96)
                      ....+..|+-
T Consensus       321 HSGSySSHmS  330 (1007)
T KOG3623|consen  321 HSGSYSSHMS  330 (1007)
T ss_pred             cCCccccccc
Confidence            9999888874


No 7  
>KOG3576|consensus
Probab=99.10  E-value=7.2e-11  Score=68.50  Aligned_cols=77  Identities=23%  Similarity=0.350  Sum_probs=66.7

Q ss_pred             cccccccccchhhhhhhccccccccCeeeccccccccccchhHHHHhhhhcC-----------CCCceeCCCCCCCCCCc
Q psy12015         16 TKLDFGVIRNSSVDKSLNTNVLTVHIDLKCDVCEKGYRYKTGLWRHKKFECG-----------QEPKYQCPHCPHRSKHK   84 (96)
Q Consensus        16 ~~~~~~~~~~~~~~~h~~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~-----------~~~~~~C~~c~~~f~~~   84 (96)
                      +.++++|.-..+|+.|.  ++|+|.+||+|..|++.|.....|..|.+--.|           .+- |.|..||..-...
T Consensus       149 t~cgkgfndtfdlkrh~--rthtgvrpykc~~c~kaftqrcsleshl~kvhgv~~~yaykerr~kl-~vcedcg~t~~~~  225 (267)
T KOG3576|consen  149 TFCGKGFNDTFDLKRHT--RTHTGVRPYKCSLCEKAFTQRCSLESHLKKVHGVQHQYAYKERRAKL-YVCEDCGYTSERP  225 (267)
T ss_pred             hhccCcccchhhhhhhh--ccccCccccchhhhhHHHHhhccHHHHHHHHcCchHHHHHHHhhhhe-eeecccCCCCCCh
Confidence            45889999999999999  999999999999999999999999999874333           234 8999999998888


Q ss_pred             hhHHHHHhhcC
Q psy12015         85 AHLTTHMAIKH   95 (96)
Q Consensus        85 ~~l~~h~r~~h   95 (96)
                      ..+..|...+|
T Consensus       226 e~~~~h~~~~h  236 (267)
T KOG3576|consen  226 EVYYLHLKLHH  236 (267)
T ss_pred             hHHHHHHHhcC
Confidence            88888888766


No 8  
>PHA02768 hypothetical protein; Provisional
Probab=99.04  E-value=9.8e-11  Score=54.64  Aligned_cols=43  Identities=14%  Similarity=0.336  Sum_probs=38.3

Q ss_pred             eeeccccccccccchhHHHHhhhhcCCCCceeCCCCCCCCCCchhH
Q psy12015         42 DLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHRSKHKAHL   87 (96)
Q Consensus        42 ~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l   87 (96)
                      -|+|+.|++.|+..+.|..|++.|.  ++ ++|..|++.|.+.+.|
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~-~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TN-LKLSNCKRISLRTGEY   47 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--Cc-ccCCcccceeccccee
Confidence            3789999999999999999999988  46 9999999999887665


No 9  
>KOG1074|consensus
Probab=99.02  E-value=5.9e-11  Score=80.01  Aligned_cols=53  Identities=28%  Similarity=0.582  Sum_probs=48.8

Q ss_pred             eeeccccccccccchhHHHHhhhhcCCCCceeCCCCCCCCCCchhHHHHHhhcC
Q psy12015         42 DLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHRSKHKAHLTTHMAIKH   95 (96)
Q Consensus        42 ~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~r~~h   95 (96)
                      +++|..|++.|.+.+.|..|.|.|+|++| |+|.+||..|.++.+|..|...|+
T Consensus       353 khkCr~CakvfgS~SaLqiHlRSHTGERP-fqCnvCG~~FSTkGNLKvH~~rH~  405 (958)
T KOG1074|consen  353 KHKCRFCAKVFGSDSALQIHLRSHTGERP-FQCNVCGNRFSTKGNLKVHFQRHR  405 (958)
T ss_pred             cchhhhhHhhcCchhhhhhhhhccCCCCC-eeecccccccccccceeeeeeecc
Confidence            57799999999999999999999999999 999999999999999998887764


No 10 
>PHA00733 hypothetical protein
Probab=99.01  E-value=5.8e-10  Score=61.19  Aligned_cols=55  Identities=18%  Similarity=0.423  Sum_probs=49.0

Q ss_pred             cccCeeeccccccccccchhHHHHhhhhcCCCCceeCCCCCCCCCCchhHHHHHhhcC
Q psy12015         38 TVHIDLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHRSKHKAHLTTHMAIKH   95 (96)
Q Consensus        38 ~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~r~~h   95 (96)
                      .+++||.|..|++.|.....|..|++.+  ..+ |.|..|++.|.....|.+|++..|
T Consensus        69 ~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~-~~C~~CgK~F~~~~sL~~H~~~~h  123 (128)
T PHA00733         69 KAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHS-KVCPVCGKEFRNTDSTLDHVCKKH  123 (128)
T ss_pred             CCCCCccCCCCCCcCCCHHHHHHHHhcC--CcC-ccCCCCCCccCCHHHHHHHHHHhc
Confidence            3478999999999999999999999875  246 999999999999999999998766


No 11 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.75  E-value=6.1e-09  Score=41.81  Aligned_cols=18  Identities=28%  Similarity=0.510  Sum_probs=8.8

Q ss_pred             ccccccCeeecccccccc
Q psy12015         35 NVLTVHIDLKCDVCEKGY   52 (96)
Q Consensus        35 ~~~~~~~~~~c~~c~~~f   52 (96)
                      ++|++++||.|+.|++.|
T Consensus         7 ~~H~~~k~~~C~~C~k~F   24 (26)
T PF13465_consen    7 RTHTGEKPYKCPYCGKSF   24 (26)
T ss_dssp             HHHSSSSSEEESSSSEEE
T ss_pred             hhcCCCCCCCCCCCcCee
Confidence            445555555555554444


No 12 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.71  E-value=5.8e-09  Score=41.88  Aligned_cols=26  Identities=35%  Similarity=0.828  Sum_probs=23.2

Q ss_pred             hHHHHhhhhcCCCCceeCCCCCCCCCC
Q psy12015         57 GLWRHKKFECGQEPKYQCPHCPHRSKH   83 (96)
Q Consensus        57 ~l~~h~~~~~~~~~~~~C~~c~~~f~~   83 (96)
                      +|..|++.|+|+++ |.|+.|++.|.+
T Consensus         1 ~l~~H~~~H~~~k~-~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKP-YKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSS-EEESSSSEEESS
T ss_pred             CHHHHhhhcCCCCC-CCCCCCcCeeCc
Confidence            47899999999999 999999998863


No 13 
>KOG3608|consensus
Probab=98.53  E-value=1.1e-08  Score=63.83  Aligned_cols=74  Identities=18%  Similarity=0.324  Sum_probs=60.7

Q ss_pred             cccccccchhhhhhhccccccccCeeeccccccccccchhHHHHhhhhcC--CCCceeCCCCCCCCCCchhHHHHHhhc
Q psy12015         18 LDFGVIRNSSVDKSLNTNVLTVHIDLKCDVCEKGYRYKTGLWRHKKFECG--QEPKYQCPHCPHRSKHKAHLTTHMAIK   94 (96)
Q Consensus        18 ~~~~~~~~~~~~~h~~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~--~~~~~~C~~c~~~f~~~~~l~~h~r~~   94 (96)
                      +.+.+..++.|..|+  ++|++|+-..|..|++-|.....|-+|.+..+.  ..+ |.|..|.|.|.+...|..|.+.|
T Consensus       185 Ct~~~~~k~~LreH~--r~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~-fqC~~C~KrFaTeklL~~Hv~rH  260 (467)
T KOG3608|consen  185 CTKHMGNKYRLREHI--RTHSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNS-FQCAQCFKRFATEKLLKSHVVRH  260 (467)
T ss_pred             hhhhhccHHHHHHHH--HhcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCc-hHHHHHHHHHhHHHHHHHHHHHh
Confidence            566788899999999  999999999999999999999999999875333  334 88888888888877777776654


No 14 
>KOG3608|consensus
Probab=98.46  E-value=1e-07  Score=59.63  Aligned_cols=72  Identities=21%  Similarity=0.399  Sum_probs=39.1

Q ss_pred             cccccccchhhhhhhccccccccCeeeccccccccccchhHHHHhhhhcCCCCceeCCC--CCCCCCCchhHHHHHh
Q psy12015         18 LDFGVIRNSSVDKSLNTNVLTVHIDLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPH--CPHRSKHKAHLTTHMA   92 (96)
Q Consensus        18 ~~~~~~~~~~~~~h~~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~--c~~~f~~~~~l~~h~r   92 (96)
                      ++.+.+..++|..|+. ..|...+||+|+.|...+..+++|.+|...|.. .. |+|..  |...+.....+.+|.+
T Consensus       269 Cdmtc~~~ssL~~H~r-~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS~-~~-y~C~h~~C~~s~r~~~q~~~H~~  342 (467)
T KOG3608|consen  269 CDMTCSSASSLTTHIR-YRHSKDKPFKCDECDTRCVRESDLAKHVQVHSK-TV-YQCEHPDCHYSVRTYTQMRRHFL  342 (467)
T ss_pred             cccCCCChHHHHHHHH-hhhccCCCccccchhhhhccHHHHHHHHHhccc-cc-eecCCCCCcHHHHHHHHHHHHHH
Confidence            4455556666666663 345556666666666666666666666655542 22 44443  4444444444444443


No 15 
>PHA00732 hypothetical protein
Probab=98.44  E-value=1.4e-07  Score=47.62  Aligned_cols=44  Identities=23%  Similarity=0.429  Sum_probs=29.0

Q ss_pred             eeeccccccccccchhHHHHhhh-hcCCCCceeCCCCCCCCCCchhHHHHHh
Q psy12015         42 DLKCDVCEKGYRYKTGLWRHKKF-ECGQEPKYQCPHCPHRSKHKAHLTTHMA   92 (96)
Q Consensus        42 ~~~c~~c~~~f~~~~~l~~h~~~-~~~~~~~~~C~~c~~~f~~~~~l~~h~r   92 (96)
                      ||.|..|++.|.....+..|++. |.   + +.|+.|++.|.   .+..|.+
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~-~~C~~CgKsF~---~l~~H~~   45 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---L-TKCPVCNKSYR---RLNQHFY   45 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---C-CccCCCCCEeC---Chhhhhc
Confidence            46677777777777777777763 43   2 56777777776   3455554


No 16 
>PHA00616 hypothetical protein
Probab=98.26  E-value=3.4e-07  Score=40.88  Aligned_cols=34  Identities=18%  Similarity=0.131  Sum_probs=28.9

Q ss_pred             eeeccccccccccchhHHHHhhhhcCCCCceeCCC
Q psy12015         42 DLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPH   76 (96)
Q Consensus        42 ~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~   76 (96)
                      ||.|..||..|....++..|++.++|.++ +.|+.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~-~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNK-LTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCc-cceeE
Confidence            57899999999999999999999998877 77653


No 17 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.25  E-value=4.9e-07  Score=35.01  Aligned_cols=22  Identities=36%  Similarity=0.762  Sum_probs=17.5

Q ss_pred             eeCCCCCCCCCCchhHHHHHhh
Q psy12015         72 YQCPHCPHRSKHKAHLTTHMAI   93 (96)
Q Consensus        72 ~~C~~c~~~f~~~~~l~~h~r~   93 (96)
                      |.|+.|++.|.++..|.+|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            5778888888888888888776


No 18 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.20  E-value=1e-06  Score=34.19  Aligned_cols=24  Identities=38%  Similarity=0.818  Sum_probs=18.8

Q ss_pred             eeCCCCCCCCCCchhHHHHHhhcC
Q psy12015         72 YQCPHCPHRSKHKAHLTTHMAIKH   95 (96)
Q Consensus        72 ~~C~~c~~~f~~~~~l~~h~r~~h   95 (96)
                      |.|+.|++.|.+...|..|++++|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            678888888999888888888876


No 19 
>PHA00616 hypothetical protein
Probab=98.14  E-value=5.4e-07  Score=40.24  Aligned_cols=25  Identities=28%  Similarity=0.533  Sum_probs=23.6

Q ss_pred             ceeCCCCCCCCCCchhHHHHHhhcC
Q psy12015         71 KYQCPHCPHRSKHKAHLTTHMAIKH   95 (96)
Q Consensus        71 ~~~C~~c~~~f~~~~~l~~h~r~~h   95 (96)
                      ||+|..||+.|...+.+..|++.||
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~h   25 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVH   25 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhc
Confidence            3899999999999999999999987


No 20 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.04  E-value=2.4e-06  Score=34.30  Aligned_cols=24  Identities=17%  Similarity=0.401  Sum_probs=17.9

Q ss_pred             eeCCCCCCCCCCchhHHHHHhhcC
Q psy12015         72 YQCPHCPHRSKHKAHLTTHMAIKH   95 (96)
Q Consensus        72 ~~C~~c~~~f~~~~~l~~h~r~~h   95 (96)
                      |+|..|++.|....+|..|++.|+
T Consensus         2 ~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    2 FECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             EEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCccCCccCChhHHHHHhHHhc
Confidence            777777777777777777777654


No 21 
>KOG3993|consensus
Probab=98.03  E-value=2.1e-06  Score=54.93  Aligned_cols=54  Identities=19%  Similarity=0.519  Sum_probs=44.8

Q ss_pred             CeeeccccccccccchhHHHHhhhhcC---------------------------------CCCceeCCCCCCCCCCchhH
Q psy12015         41 IDLKCDVCEKGYRYKTGLWRHKKFECG---------------------------------QEPKYQCPHCPHRSKHKAHL   87 (96)
Q Consensus        41 ~~~~c~~c~~~f~~~~~l~~h~~~~~~---------------------------------~~~~~~C~~c~~~f~~~~~l   87 (96)
                      ..|+|.+|++.|+...+|..|.|.|--                                 +.. |.|..|++.|.+..-|
T Consensus       294 vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg~dss~gi-~~C~~C~KkFrRqAYL  372 (500)
T KOG3993|consen  294 VEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAERSGDDSSSGI-FSCHTCGKKFRRQAYL  372 (500)
T ss_pred             eeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccccCCcccCce-eecHHhhhhhHHHHHH
Confidence            368999999999999999988875532                                 113 8899999999999999


Q ss_pred             HHHHhhcC
Q psy12015         88 TTHMAIKH   95 (96)
Q Consensus        88 ~~h~r~~h   95 (96)
                      ..|+-+||
T Consensus       373 rKHqlthq  380 (500)
T KOG3993|consen  373 RKHQLTHQ  380 (500)
T ss_pred             HHhHHhhh
Confidence            99988876


No 22 
>PHA02768 hypothetical protein; Provisional
Probab=97.98  E-value=2.6e-06  Score=39.86  Aligned_cols=42  Identities=14%  Similarity=0.006  Sum_probs=35.7

Q ss_pred             cccccccccccchhhhhhhccccccccCeeeccccccccccchhHH
Q psy12015         14 TNTKLDFGVIRNSSVDKSLNTNVLTVHIDLKCDVCEKGYRYKTGLW   59 (96)
Q Consensus        14 ~~~~~~~~~~~~~~~~~h~~~~~~~~~~~~~c~~c~~~f~~~~~l~   59 (96)
                      .+..+++.|+..+.|..|+  ++|+  +++.|..|++.|...+.+.
T Consensus         7 ~C~~CGK~Fs~~~~L~~H~--r~H~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          7 ECPICGEIYIKRKSMITHL--RKHN--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             CcchhCCeeccHHHHHHHH--HhcC--CcccCCcccceecccceeE
Confidence            4566899999999999999  8888  6889999999998766553


No 23 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.90  E-value=2.2e-05  Score=36.84  Aligned_cols=51  Identities=25%  Similarity=0.597  Sum_probs=38.2

Q ss_pred             eeeccccccccccchhHHHHhhh-hcCCCCceeCCCCCCCCCCchhHHHHHhhcC
Q psy12015         42 DLKCDVCEKGYRYKTGLWRHKKF-ECGQEPKYQCPHCPHRSKHKAHLTTHMAIKH   95 (96)
Q Consensus        42 ~~~c~~c~~~f~~~~~l~~h~~~-~~~~~~~~~C~~c~~~f~~~~~l~~h~r~~h   95 (96)
                      .|.|+.|++.|. ...|..|... |..+...+.|++|...+.  .+|..|+..+|
T Consensus         2 ~f~CP~C~~~~~-~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    2 SFTCPYCGKGFS-ESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             CcCCCCCCCccC-HHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            478999999544 6778899775 444333489999987644  48889998877


No 24 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=97.87  E-value=2.2e-05  Score=52.53  Aligned_cols=49  Identities=20%  Similarity=0.438  Sum_probs=24.5

Q ss_pred             hhhhhhhccccccccCeeeccccccccccchhHHHHhhhhcCCCCceeCCCCCCCC
Q psy12015         26 SSVDKSLNTNVLTVHIDLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHRS   81 (96)
Q Consensus        26 ~~~~~h~~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f   81 (96)
                      ..+..|+  ..+.  +++.|. |+..+ ....|..|+..+.+.++ +.|..|+..+
T Consensus       466 s~LekH~--~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kp-i~C~fC~~~v  514 (567)
T PLN03086        466 GEMEKHM--KVFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRL-ITCRFCGDMV  514 (567)
T ss_pred             HHHHHHH--HhcC--CCccCC-CCCCc-chhHHHhhhhccCCCCc-eeCCCCCCcc
Confidence            3455555  3332  455555 55433 33455555555555555 5555555555


No 25 
>PHA00733 hypothetical protein
Probab=97.87  E-value=7.4e-06  Score=45.08  Aligned_cols=56  Identities=18%  Similarity=0.134  Sum_probs=42.0

Q ss_pred             ccccCeeeccccccccccchhHHHH--h---hhhcCCCCceeCCCCCCCCCCchhHHHHHhh
Q psy12015         37 LTVHIDLKCDVCEKGYRYKTGLWRH--K---KFECGQEPKYQCPHCPHRSKHKAHLTTHMAI   93 (96)
Q Consensus        37 ~~~~~~~~c~~c~~~f~~~~~l~~h--~---~~~~~~~~~~~C~~c~~~f~~~~~l~~h~r~   93 (96)
                      ....+++.|..|...|.....+..+  +   ....+.++ |.|+.||+.|.....|..|++.
T Consensus        35 ~~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kP-y~C~~Cgk~Fss~s~L~~H~r~   95 (128)
T PHA00733         35 TPEQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSP-YVCPLCLMPFSSSVSLKQHIRY   95 (128)
T ss_pred             ChhhhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCC-ccCCCCCCcCCCHHHHHHHHhc
Confidence            3446788999998877776655544  1   12334566 9999999999999999999985


No 26 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=97.82  E-value=3.3e-05  Score=51.72  Aligned_cols=70  Identities=13%  Similarity=0.213  Sum_probs=54.1

Q ss_pred             cccccccchhhhhhhccccccccCeeecccccccccc----------chhHHHHhhhhcCCCCceeCCCCCCCCCCchhH
Q psy12015         18 LDFGVIRNSSVDKSLNTNVLTVHIDLKCDVCEKGYRY----------KTGLWRHKKFECGQEPKYQCPHCPHRSKHKAHL   87 (96)
Q Consensus        18 ~~~~~~~~~~~~~h~~~~~~~~~~~~~c~~c~~~f~~----------~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l   87 (96)
                      ++..+ .+..+..|+  .++.+++++.|..|+..+..          ...|..|+... |.++ +.|..||+.+..+ .+
T Consensus       483 Cg~~~-~R~~L~~H~--~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G~rt-~~C~~Cgk~Vrlr-dm  556 (567)
T PLN03086        483 CGVVL-EKEQMVQHQ--ASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC-GSRT-APCDSCGRSVMLK-EM  556 (567)
T ss_pred             CCCCc-chhHHHhhh--hccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHhc-CCcc-eEccccCCeeeeh-hH
Confidence            44433 557889998  88999999999999998852          34788998875 7788 9999999988776 44


Q ss_pred             HHHHhh
Q psy12015         88 TTHMAI   93 (96)
Q Consensus        88 ~~h~r~   93 (96)
                      ..|.-.
T Consensus       557 ~~H~~~  562 (567)
T PLN03086        557 DIHQIA  562 (567)
T ss_pred             HHHHHH
Confidence            555544


No 27 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.74  E-value=2e-05  Score=31.55  Aligned_cols=26  Identities=31%  Similarity=0.727  Sum_probs=23.1

Q ss_pred             eeeccccccccccchhHHHHhhhhcC
Q psy12015         42 DLKCDVCEKGYRYKTGLWRHKKFECG   67 (96)
Q Consensus        42 ~~~c~~c~~~f~~~~~l~~h~~~~~~   67 (96)
                      ||.|..|++.|....++..|++.|..
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhcC
Confidence            68999999999999999999987643


No 28 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.73  E-value=2.4e-05  Score=30.04  Aligned_cols=23  Identities=35%  Similarity=0.713  Sum_probs=20.4

Q ss_pred             eeccccccccccchhHHHHhhhh
Q psy12015         43 LKCDVCEKGYRYKTGLWRHKKFE   65 (96)
Q Consensus        43 ~~c~~c~~~f~~~~~l~~h~~~~   65 (96)
                      |.|..|++.|.....|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            67999999999999999998763


No 29 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.46  E-value=7.9e-05  Score=28.98  Aligned_cols=23  Identities=39%  Similarity=0.793  Sum_probs=18.2

Q ss_pred             eeCCCCCCCCCCchhHHHHHhhc
Q psy12015         72 YQCPHCPHRSKHKAHLTTHMAIK   94 (96)
Q Consensus        72 ~~C~~c~~~f~~~~~l~~h~r~~   94 (96)
                      |+|..|++.|.....+..|++.|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            46888888888888888888754


No 30 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.44  E-value=0.00011  Score=33.74  Aligned_cols=31  Identities=19%  Similarity=0.313  Sum_probs=15.0

Q ss_pred             ccCeeeccccccccccchhHHHHhhhhcCCC
Q psy12015         39 VHIDLKCDVCEKGYRYKTGLWRHKKFECGQE   69 (96)
Q Consensus        39 ~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~   69 (96)
                      .+.|..|+.|+..+....+|.+|+....+.+
T Consensus        21 S~~PatCP~C~a~~~~srnLrRHle~~H~~k   51 (54)
T PF09237_consen   21 SEQPATCPICGAVIRQSRNLRRHLEIRHFKK   51 (54)
T ss_dssp             TS--EE-TTT--EESSHHHHHHHHHHHTTTS
T ss_pred             cCCCCCCCcchhhccchhhHHHHHHHHhccc
Confidence            3455666666666666666666665554443


No 31 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.37  E-value=0.00014  Score=37.82  Aligned_cols=69  Identities=17%  Similarity=0.219  Sum_probs=21.1

Q ss_pred             cccccccchhhhhhhccccccccCeeeccccccccccchhHHHHhhhhcCCCCceeCCCCCCCCCCchhHHHHHhhc
Q psy12015         18 LDFGVIRNSSVDKSLNTNVLTVHIDLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHRSKHKAHLTTHMAIK   94 (96)
Q Consensus        18 ~~~~~~~~~~~~~h~~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~r~~   94 (96)
                      ++..|.....+..|+. ..|....+     ....+.....+..+.+.... .. +.|..|++.|.....|..|++.+
T Consensus         5 C~~~f~~~~~l~~H~~-~~H~~~~~-----~~~~l~~~~~~~~~~~~~~~-~~-~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    5 CDESFSSVDDLLQHMK-KKHGFDIP-----DQKYLVDPNRLLNYLRKKVK-ES-FRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             ---------------------------------------------------SS-EEBSSSS-EESSHHHHHHHHHHT
T ss_pred             cccccccccccccccc-cccccccc-----cccccccccccccccccccC-CC-CCCCccCCCCcCHHHHHHHHcCc
Confidence            4456777788888884 34443332     01111122233333332222 35 89999999999999999999864


No 32 
>PRK04860 hypothetical protein; Provisional
Probab=97.31  E-value=0.00031  Score=40.10  Aligned_cols=39  Identities=23%  Similarity=0.625  Sum_probs=32.9

Q ss_pred             CeeeccccccccccchhHHHHhhhhcCCCCceeCCCCCCCCCCc
Q psy12015         41 IDLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHRSKHK   84 (96)
Q Consensus        41 ~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~   84 (96)
                      -+|.|. |+.   ....+.+|.+++.+.++ |.|..|++.|...
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~-YrC~~C~~~l~~~  156 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAV-YRCRRCGETLVFK  156 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCcc-EECCCCCceeEEe
Confidence            379998 987   56678999999999888 9999999987654


No 33 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.17  E-value=0.00036  Score=26.58  Aligned_cols=23  Identities=30%  Similarity=0.767  Sum_probs=18.7

Q ss_pred             eeccccccccccchhHHHHhhhh
Q psy12015         43 LKCDVCEKGYRYKTGLWRHKKFE   65 (96)
Q Consensus        43 ~~c~~c~~~f~~~~~l~~h~~~~   65 (96)
                      |.|+.|+..|.....+..|++.+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            57999999999999999998865


No 34 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.15  E-value=0.00022  Score=27.83  Aligned_cols=22  Identities=18%  Similarity=0.471  Sum_probs=15.2

Q ss_pred             eeCCCCCCCCCCchhHHHHHhh
Q psy12015         72 YQCPHCPHRSKHKAHLTTHMAI   93 (96)
Q Consensus        72 ~~C~~c~~~f~~~~~l~~h~r~   93 (96)
                      |.|.+|+..|.....+..|.+.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            4577777777777777777664


No 35 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.14  E-value=0.00052  Score=31.51  Aligned_cols=36  Identities=25%  Similarity=0.542  Sum_probs=23.4

Q ss_pred             HhhhhcCCCCceeCCCCCCCCCCchhHHHHHhhcCC
Q psy12015         61 HKKFECGQEPKYQCPHCPHRSKHKAHLTTHMAIKHY   96 (96)
Q Consensus        61 h~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~r~~h~   96 (96)
                      +.+.+.....|-.|++|+..+.+..+|.+|+.+.|+
T Consensus        14 ~~k~~~~S~~PatCP~C~a~~~~srnLrRHle~~H~   49 (54)
T PF09237_consen   14 KPKSKSQSEQPATCPICGAVIRQSRNLRRHLEIRHF   49 (54)
T ss_dssp             --CCCCTTS--EE-TTT--EESSHHHHHHHHHHHTT
T ss_pred             HHHHhhccCCCCCCCcchhhccchhhHHHHHHHHhc
Confidence            333344434448999999999999999999998875


No 36 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.11  E-value=0.00026  Score=44.30  Aligned_cols=55  Identities=31%  Similarity=0.547  Sum_probs=42.4

Q ss_pred             ccCeeeccc--cccccccchhHHHHhhh-h------------------cCCCCceeCCCCCCCCCCchhHHHHHhhc
Q psy12015         39 VHIDLKCDV--CEKGYRYKTGLWRHKKF-E------------------CGQEPKYQCPHCPHRSKHKAHLTTHMAIK   94 (96)
Q Consensus        39 ~~~~~~c~~--c~~~f~~~~~l~~h~~~-~------------------~~~~~~~~C~~c~~~f~~~~~l~~h~r~~   94 (96)
                      +++||+|.+  |.+.+...-.|.-|+.- |                  ..++| |.|.+|+|.+....-|.-|+...
T Consensus       346 d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KP-YrCevC~KRYKNlNGLKYHr~Hs  421 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKP-YRCEVCDKRYKNLNGLKYHRKHS  421 (423)
T ss_pred             cCceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCc-eeccccchhhccCccceeccccc
Confidence            469999975  99999998888877652 2                  11356 99999999999988887776543


No 37 
>KOG3993|consensus
Probab=96.90  E-value=0.00017  Score=46.58  Aligned_cols=52  Identities=25%  Similarity=0.498  Sum_probs=44.5

Q ss_pred             eeeccccccccccchhHHHHhhhhcCCCCceeCCCCCCCCCCchhHHHHHhhc
Q psy12015         42 DLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHRSKHKAHLTTHMAIK   94 (96)
Q Consensus        42 ~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~r~~   94 (96)
                      .|.|..|-..|...-.|..|.-....... |.|+.|+|.|+=..+|..|+|=|
T Consensus       267 dyiCqLCK~kYeD~F~LAQHrC~RIV~vE-YrCPEC~KVFsCPANLASHRRWH  318 (500)
T KOG3993|consen  267 DYICQLCKEKYEDAFALAQHRCPRIVHVE-YRCPECDKVFSCPANLASHRRWH  318 (500)
T ss_pred             HHHHHHHHHhhhhHHHHhhccCCeeEEee-ecCCcccccccCchhhhhhhccc
Confidence            47899999999988889888765555556 99999999999999999999865


No 38 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.81  E-value=0.00065  Score=26.25  Aligned_cols=23  Identities=39%  Similarity=0.977  Sum_probs=14.8

Q ss_pred             eeCCCCCCCCCCchhHHHHHhhcC
Q psy12015         72 YQCPHCPHRSKHKAHLTTHMAIKH   95 (96)
Q Consensus        72 ~~C~~c~~~f~~~~~l~~h~r~~h   95 (96)
                      |.|+.|+.... ...|.+|++.+|
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            56777776666 667777777765


No 39 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.73  E-value=0.0012  Score=25.44  Aligned_cols=24  Identities=25%  Similarity=0.549  Sum_probs=20.3

Q ss_pred             eeccccccccccchhHHHHhhhhc
Q psy12015         43 LKCDVCEKGYRYKTGLWRHKKFEC   66 (96)
Q Consensus        43 ~~c~~c~~~f~~~~~l~~h~~~~~   66 (96)
                      +.|..|++.|.....+..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            468999999999999999988553


No 40 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.68  E-value=0.00057  Score=27.27  Aligned_cols=22  Identities=23%  Similarity=0.522  Sum_probs=15.2

Q ss_pred             eeCCCCCCCCCCchhHHHHHhh
Q psy12015         72 YQCPHCPHRSKHKAHLTTHMAI   93 (96)
Q Consensus        72 ~~C~~c~~~f~~~~~l~~h~r~   93 (96)
                      |.|..|++.|.+...+..|+++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            5677777777777777766654


No 41 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.40  E-value=0.0026  Score=24.65  Aligned_cols=23  Identities=26%  Similarity=0.713  Sum_probs=20.1

Q ss_pred             eeccccccccccchhHHHHhhhh
Q psy12015         43 LKCDVCEKGYRYKTGLWRHKKFE   65 (96)
Q Consensus        43 ~~c~~c~~~f~~~~~l~~h~~~~   65 (96)
                      |.|..|...|.....+..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            57999999999999999998753


No 42 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=96.08  E-value=0.0049  Score=24.17  Aligned_cols=20  Identities=25%  Similarity=0.576  Sum_probs=12.3

Q ss_pred             eeCCCCCCCCCCchhHHHHHh
Q psy12015         72 YQCPHCPHRSKHKAHLTTHMA   92 (96)
Q Consensus        72 ~~C~~c~~~f~~~~~l~~h~r   92 (96)
                      ..|+.||+.| ....+.+|+.
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHH
Confidence            3566777776 4555666654


No 43 
>PHA00732 hypothetical protein
Probab=95.90  E-value=0.01  Score=30.02  Aligned_cols=45  Identities=24%  Similarity=0.345  Sum_probs=33.9

Q ss_pred             ccccccccccchhhhhhhccc-cccccCeeeccccccccccchhHHHHhhhhcC
Q psy12015         15 NTKLDFGVIRNSSVDKSLNTN-VLTVHIDLKCDVCEKGYRYKTGLWRHKKFECG   67 (96)
Q Consensus        15 ~~~~~~~~~~~~~~~~h~~~~-~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~   67 (96)
                      ...+++.|.....+..|+  + .|.+   +.|..|++.|.   .+..|..+...
T Consensus         4 C~~Cgk~F~s~s~Lk~H~--r~~H~~---~~C~~CgKsF~---~l~~H~~~~~~   49 (79)
T PHA00732          4 CPICGFTTVTLFALKQHA--RRNHTL---TKCPVCNKSYR---RLNQHFYSQYD   49 (79)
T ss_pred             CCCCCCccCCHHHHHHHh--hcccCC---CccCCCCCEeC---ChhhhhcccCC
Confidence            345788899999999999  5 3553   57999999997   46777765443


No 44 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=95.16  E-value=0.021  Score=23.81  Aligned_cols=22  Identities=14%  Similarity=0.378  Sum_probs=16.2

Q ss_pred             eeCCCCCCCCCCchhHHHHHhh
Q psy12015         72 YQCPHCPHRSKHKAHLTTHMAI   93 (96)
Q Consensus        72 ~~C~~c~~~f~~~~~l~~h~r~   93 (96)
                      |.|..|+..|.....+..|...
T Consensus         4 ~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        4 FYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             eEccccCCccCCHHHHHHHHCh
Confidence            7788888888777777777654


No 45 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=93.55  E-value=0.064  Score=22.36  Aligned_cols=24  Identities=33%  Similarity=0.800  Sum_probs=16.6

Q ss_pred             eeccccccccccchhHHHHhhhhcCCCCceeCCCCCC
Q psy12015         43 LKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPH   79 (96)
Q Consensus        43 ~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~   79 (96)
                      |.|..||..+....            .+ +.|+.||.
T Consensus         2 ~~C~~CGy~y~~~~------------~~-~~CP~Cg~   25 (33)
T cd00350           2 YVCPVCGYIYDGEE------------AP-WVCPVCGA   25 (33)
T ss_pred             EECCCCCCEECCCc------------CC-CcCcCCCC
Confidence            67888887654322            44 88999975


No 46 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=92.86  E-value=0.043  Score=34.79  Aligned_cols=23  Identities=35%  Similarity=0.809  Sum_probs=19.3

Q ss_pred             cCeeeccccccccccchhHHHHh
Q psy12015         40 HIDLKCDVCEKGYRYKTGLWRHK   62 (96)
Q Consensus        40 ~~~~~c~~c~~~f~~~~~l~~h~   62 (96)
                      ++||+|.+|++.+...-.|.-|.
T Consensus       396 ~KPYrCevC~KRYKNlNGLKYHr  418 (423)
T COG5189         396 DKPYRCEVCDKRYKNLNGLKYHR  418 (423)
T ss_pred             CCceeccccchhhccCccceecc
Confidence            58999999999999887776653


No 47 
>PRK04860 hypothetical protein; Provisional
Probab=92.84  E-value=0.051  Score=31.18  Aligned_cols=31  Identities=16%  Similarity=0.323  Sum_probs=26.0

Q ss_pred             cchhhhhhhccccccccCeeeccccccccccch
Q psy12015         24 RNSSVDKSLNTNVLTVHIDLKCDVCEKGYRYKT   56 (96)
Q Consensus        24 ~~~~~~~h~~~~~~~~~~~~~c~~c~~~f~~~~   56 (96)
                      ....+..|.  ++++++++|.|..|+..|....
T Consensus       127 ~~~~~rrH~--ri~~g~~~YrC~~C~~~l~~~~  157 (160)
T PRK04860        127 HQLTVRRHN--RVVRGEAVYRCRRCGETLVFKG  157 (160)
T ss_pred             eeCHHHHHH--HHhcCCccEECCCCCceeEEec
Confidence            566678888  8999999999999999887543


No 48 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=92.77  E-value=0.043  Score=35.20  Aligned_cols=52  Identities=23%  Similarity=0.562  Sum_probs=32.1

Q ss_pred             eeeccccccccccchhHHHHhh--hhcCC--CCceeCC--CCCCCCCCchhHHHHHhhc
Q psy12015         42 DLKCDVCEKGYRYKTGLWRHKK--FECGQ--EPKYQCP--HCPHRSKHKAHLTTHMAIK   94 (96)
Q Consensus        42 ~~~c~~c~~~f~~~~~l~~h~~--~~~~~--~~~~~C~--~c~~~f~~~~~l~~h~r~~   94 (96)
                      ++.|..|...|.....+..|.+  .|.+.  ++ +.|.  .|++.|.....+..|...|
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~-~~~p~~~~~~~~~~~~~~~~~~~~~  346 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKP-FSCPYSLCGKLFSRNDALKRHILLH  346 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCc-eeeeccCCCccccccccccCCcccc
Confidence            4556666666666666666666  56665  55 6666  5666666666665555443


No 49 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=92.50  E-value=0.12  Score=24.03  Aligned_cols=23  Identities=26%  Similarity=0.616  Sum_probs=18.6

Q ss_pred             eeCCCCCCCCCCchhHHHHHhhcC
Q psy12015         72 YQCPHCPHRSKHKAHLTTHMAIKH   95 (96)
Q Consensus        72 ~~C~~c~~~f~~~~~l~~h~r~~h   95 (96)
                      |.|+.|++. .+...|..|....|
T Consensus         3 f~CP~C~~~-~~~~~L~~H~~~~H   25 (54)
T PF05605_consen    3 FTCPYCGKG-FSESSLVEHCEDEH   25 (54)
T ss_pred             cCCCCCCCc-cCHHHHHHHHHhHC
Confidence            899999995 55678999987765


No 50 
>KOG1146|consensus
Probab=92.39  E-value=0.087  Score=39.12  Aligned_cols=70  Identities=20%  Similarity=0.389  Sum_probs=51.0

Q ss_pred             cccchhhhhhhccccccccCeeeccccccccccchhHHHHhhhhc-------------------------CCCCceeCCC
Q psy12015         22 VIRNSSVDKSLNTNVLTVHIDLKCDVCEKGYRYKTGLWRHKKFEC-------------------------GQEPKYQCPH   76 (96)
Q Consensus        22 ~~~~~~~~~h~~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~-------------------------~~~~~~~C~~   76 (96)
                      +.+...+..++. ..+...+.+.|..|+..|.....|..|+|..+                         +.++ |.|..
T Consensus       446 ~~s~r~~~~~t~-~L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p-~~C~~  523 (1406)
T KOG1146|consen  446 LESKRSLEGQTV-VLHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKP-YPCRA  523 (1406)
T ss_pred             hhhhccccccee-eeecccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCc-cccee
Confidence            334444444442 45566688999999999999999999988611                         1234 88999


Q ss_pred             CCCCCCCchhHHHHHhh
Q psy12015         77 CPHRSKHKAHLTTHMAI   93 (96)
Q Consensus        77 c~~~f~~~~~l~~h~r~   93 (96)
                      |...+....+|.+|+..
T Consensus       524 C~~stttng~LsihlqS  540 (1406)
T KOG1146|consen  524 CNYSTTTNGNLSIHLQS  540 (1406)
T ss_pred             eeeeeecchHHHHHHHH
Confidence            99999999999888764


No 51 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=90.73  E-value=0.2  Score=21.34  Aligned_cols=34  Identities=21%  Similarity=0.520  Sum_probs=22.5

Q ss_pred             eeccccccccccchhHHHHhhhhcCCCCceeCCCCCCCCC
Q psy12015         43 LKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHRSK   82 (96)
Q Consensus        43 ~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~   82 (96)
                      ..|+.|+..|....+...    ..+ .. ..|+.|+..|.
T Consensus         3 ~~CP~C~~~~~v~~~~~~----~~~-~~-v~C~~C~~~~~   36 (38)
T TIGR02098         3 IQCPNCKTSFRVVDSQLG----ANG-GK-VRCGKCGHVWY   36 (38)
T ss_pred             EECCCCCCEEEeCHHHcC----CCC-CE-EECCCCCCEEE
Confidence            679999988876654321    112 34 78999998764


No 52 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=90.52  E-value=0.36  Score=23.00  Aligned_cols=32  Identities=28%  Similarity=0.682  Sum_probs=19.4

Q ss_pred             eeeccccccccccchhHHHHhhhhcCCCCceeCCCCCC
Q psy12015         42 DLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPH   79 (96)
Q Consensus        42 ~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~   79 (96)
                      .|.|..||+......     .+-.....+ |.|+.||.
T Consensus        27 ~F~CPnCGe~~I~Rc-----~~CRk~g~~-Y~Cp~CGF   58 (61)
T COG2888          27 KFPCPNCGEVEIYRC-----AKCRKLGNP-YRCPKCGF   58 (61)
T ss_pred             EeeCCCCCceeeehh-----hhHHHcCCc-eECCCcCc
Confidence            578999986543322     222222356 99999984


No 53 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=90.42  E-value=0.21  Score=28.91  Aligned_cols=24  Identities=33%  Similarity=0.632  Sum_probs=17.8

Q ss_pred             eeeccccccccccchhHHHHhhhhcCCCCceeCCCCCC
Q psy12015         42 DLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPH   79 (96)
Q Consensus        42 ~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~   79 (96)
                      -|.|.+||..             +.| .+|.+|++||-
T Consensus       134 ~~vC~vCGy~-------------~~g-e~P~~CPiCga  157 (166)
T COG1592         134 VWVCPVCGYT-------------HEG-EAPEVCPICGA  157 (166)
T ss_pred             EEEcCCCCCc-------------ccC-CCCCcCCCCCC
Confidence            6999999864             345 34489999984


No 54 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=90.29  E-value=0.15  Score=30.61  Aligned_cols=45  Identities=24%  Similarity=0.518  Sum_probs=28.0

Q ss_pred             cCeeeccccccccccchhHHHHhhh----------hcCCCCc----eeCCCCCCCCCCc
Q psy12015         40 HIDLKCDVCEKGYRYKTGLWRHKKF----------ECGQEPK----YQCPHCPHRSKHK   84 (96)
Q Consensus        40 ~~~~~c~~c~~~f~~~~~l~~h~~~----------~~~~~~~----~~C~~c~~~f~~~   84 (96)
                      ++...|++|+..|....-.....+.          ..+..|.    ..|+.||.++...
T Consensus         3 ~k~~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             CCceECCCCCCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCCCccccc
Confidence            3567899999999886554444432          1111221    4799999876544


No 55 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=90.22  E-value=0.28  Score=20.61  Aligned_cols=25  Identities=28%  Similarity=0.494  Sum_probs=16.2

Q ss_pred             eeeccccccccccchhHHHHhhhhcCCCCceeCCCCCC
Q psy12015         42 DLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPH   79 (96)
Q Consensus        42 ~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~   79 (96)
                      .|.|..||..+..             ..+|..|++||.
T Consensus         2 ~~~C~~CG~i~~g-------------~~~p~~CP~Cg~   26 (34)
T cd00729           2 VWVCPVCGYIHEG-------------EEAPEKCPICGA   26 (34)
T ss_pred             eEECCCCCCEeEC-------------CcCCCcCcCCCC
Confidence            4778888865432             123368888875


No 56 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=90.20  E-value=0.29  Score=20.84  Aligned_cols=33  Identities=18%  Similarity=0.451  Sum_probs=22.6

Q ss_pred             eeccccccccccchhHHHHhhhhcCCCCceeCCCCCCCC
Q psy12015         43 LKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHRS   81 (96)
Q Consensus        43 ~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f   81 (96)
                      ..|+.|...|.......     ...... .+|+.|+..|
T Consensus         3 i~Cp~C~~~y~i~d~~i-----p~~g~~-v~C~~C~~~f   35 (36)
T PF13717_consen    3 ITCPNCQAKYEIDDEKI-----PPKGRK-VRCSKCGHVF   35 (36)
T ss_pred             EECCCCCCEEeCCHHHC-----CCCCcE-EECCCCCCEe
Confidence            57889998887765432     122245 8899998876


No 57 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=90.04  E-value=0.12  Score=24.32  Aligned_cols=33  Identities=21%  Similarity=0.279  Sum_probs=23.4

Q ss_pred             ccccccCeeeccccccccccchhHHHHhhhhcC
Q psy12015         35 NVLTVHIDLKCDVCEKGYRYKTGLWRHKKFECG   67 (96)
Q Consensus        35 ~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~   67 (96)
                      .+-.||.-+.|+-|+..|....+..+|..-..+
T Consensus        10 ~~RDGE~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          10 RDRDGEEFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             eccCCceeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            444567777888888888888777777764444


No 58 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=89.98  E-value=0.52  Score=20.11  Aligned_cols=34  Identities=24%  Similarity=0.698  Sum_probs=23.0

Q ss_pred             eeccccccccccchhHHHHhhhhcCCCCceeCCCCCCCCC
Q psy12015         43 LKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHRSK   82 (96)
Q Consensus        43 ~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~   82 (96)
                      ..|+.|+..|....+-     +..+... ..|+.|+..|.
T Consensus         3 i~CP~C~~~f~v~~~~-----l~~~~~~-vrC~~C~~~f~   36 (37)
T PF13719_consen    3 ITCPNCQTRFRVPDDK-----LPAGGRK-VRCPKCGHVFR   36 (37)
T ss_pred             EECCCCCceEEcCHHH-----cccCCcE-EECCCCCcEee
Confidence            4688999888766542     2233345 89999988764


No 59 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=88.48  E-value=0.41  Score=21.39  Aligned_cols=30  Identities=23%  Similarity=0.494  Sum_probs=20.5

Q ss_pred             CeeeccccccccccchhHHHHhhhhcCCCCceeCCCCCCCC
Q psy12015         41 IDLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHRS   81 (96)
Q Consensus        41 ~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f   81 (96)
                      ..|.|..|+..+......          .. +.|+.||..+
T Consensus         2 ~~y~C~~CG~~~~~~~~~----------~~-~~Cp~CG~~~   31 (46)
T PRK00398          2 AEYKCARCGREVELDEYG----------TG-VRCPYCGYRI   31 (46)
T ss_pred             CEEECCCCCCEEEECCCC----------Cc-eECCCCCCeE
Confidence            368899999877653221          14 7899998754


No 60 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=88.40  E-value=0.42  Score=24.43  Aligned_cols=25  Identities=24%  Similarity=0.620  Sum_probs=21.6

Q ss_pred             eeeccccccccccchhHHHHhhhhc
Q psy12015         42 DLKCDVCEKGYRYKTGLWRHKKFEC   66 (96)
Q Consensus        42 ~~~c~~c~~~f~~~~~l~~h~~~~~   66 (96)
                      .+.|..|+..|.....+..|++.+.
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~~~   74 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRSKH   74 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHHTT
T ss_pred             CCCCCccCCCCcCHHHHHHHHcCcc
Confidence            6899999999999999999999643


No 61 
>KOG2186|consensus
Probab=87.95  E-value=0.53  Score=29.06  Aligned_cols=38  Identities=18%  Similarity=0.467  Sum_probs=17.5

Q ss_pred             eeccccccccccchhHHHHhhhhcCCCCceeCCCCCCCCCC
Q psy12015         43 LKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHRSKH   83 (96)
Q Consensus        43 ~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~   83 (96)
                      |.|..||.... ...+..|+....+ .. |.|--|++.|..
T Consensus         4 FtCnvCgEsvK-Kp~vekH~srCrn-~~-fSCIDC~k~F~~   41 (276)
T KOG2186|consen    4 FTCNVCGESVK-KPQVEKHMSRCRN-AY-FSCIDCGKTFER   41 (276)
T ss_pred             Eehhhhhhhcc-ccchHHHHHhccC-Ce-eEEeeccccccc
Confidence            44555554433 2233444444333 33 555555555544


No 62 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=87.41  E-value=0.95  Score=25.55  Aligned_cols=39  Identities=18%  Similarity=0.468  Sum_probs=26.5

Q ss_pred             ccCeeeccccccccccchhHHHHhhhhcCCCCceeCCCCCCCCC
Q psy12015         39 VHIDLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHRSK   82 (96)
Q Consensus        39 ~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~   82 (96)
                      ...-|.|+.|+..|.....+...   . .... |.|+.||....
T Consensus        96 ~~~~Y~Cp~C~~~y~~~ea~~~~---d-~~~~-f~Cp~Cg~~l~  134 (147)
T smart00531       96 NNAYYKCPNCQSKYTFLEANQLL---D-MDGT-FTCPRCGEELE  134 (147)
T ss_pred             CCcEEECcCCCCEeeHHHHHHhc---C-CCCc-EECCCCCCEEE
Confidence            45579999999998865443221   1 1345 99999998653


No 63 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=87.18  E-value=0.42  Score=30.68  Aligned_cols=59  Identities=17%  Similarity=0.290  Sum_probs=48.9

Q ss_pred             cccccccccccchhhhhhhccc--ccccc--Ceeecc--ccccccccchhHHHHhhhhcCCCCceeCC
Q psy12015         14 TNTKLDFGVIRNSSVDKSLNTN--VLTVH--IDLKCD--VCEKGYRYKTGLWRHKKFECGQEPKYQCP   75 (96)
Q Consensus        14 ~~~~~~~~~~~~~~~~~h~~~~--~~~~~--~~~~c~--~c~~~f~~~~~l~~h~~~~~~~~~~~~C~   75 (96)
                      ....+...|.....+..|.  +  .|.++  +|+.|.  .|++.|.....+..|...+.+..+ +.+.
T Consensus       291 ~~~~~~~~~s~~~~l~~~~--~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~  355 (467)
T COG5048         291 KSKQCNISFSRSSPLTRHL--RSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISP-AKEK  355 (467)
T ss_pred             CCccccCCccccccccccc--cccccccccCCceeeeccCCCccccccccccCCcccccCCCc-cccc
Confidence            3445667788888899998  7  79999  999999  799999999999999998888765 5553


No 64 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=86.96  E-value=0.31  Score=25.04  Aligned_cols=32  Identities=19%  Similarity=0.558  Sum_probs=22.6

Q ss_pred             cCeeeccccccccccchhHHHHhhhhcCCCCceeCCCCCCCCC
Q psy12015         40 HIDLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHRSK   82 (96)
Q Consensus        40 ~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~   82 (96)
                      ...|.|+.|++.        ...+.-.|  . |.|..||..|.
T Consensus        33 ~~~~~Cp~C~~~--------~VkR~a~G--I-W~C~kCg~~fA   64 (89)
T COG1997          33 RAKHVCPFCGRT--------TVKRIATG--I-WKCRKCGAKFA   64 (89)
T ss_pred             hcCCcCCCCCCc--------ceeeeccC--e-EEcCCCCCeec
Confidence            347899999874        23344444  5 99999998774


No 65 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=86.28  E-value=0.36  Score=22.05  Aligned_cols=30  Identities=17%  Similarity=0.542  Sum_probs=19.3

Q ss_pred             eeeccccccccccchhHHHHhhhhcCCCCceeCCCCCC
Q psy12015         42 DLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPH   79 (96)
Q Consensus        42 ~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~   79 (96)
                      .|.|..|+..|.......      . ... -.|+.||.
T Consensus         5 ey~C~~Cg~~fe~~~~~~------~-~~~-~~CP~Cg~   34 (52)
T TIGR02605         5 EYRCTACGHRFEVLQKMS------D-DPL-ATCPECGG   34 (52)
T ss_pred             EEEeCCCCCEeEEEEecC------C-CCC-CCCCCCCC
Confidence            378999998887543221      1 233 57999986


No 66 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=86.28  E-value=0.42  Score=20.53  Aligned_cols=31  Identities=16%  Similarity=0.508  Sum_probs=20.5

Q ss_pred             eeeccccccccccchhHHHHhhhhcCCCCceeCCCCCCC
Q psy12015         42 DLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHR   80 (96)
Q Consensus        42 ~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~   80 (96)
                      .|.|..|+..|.......      .+ .. -.|+.||..
T Consensus         5 ~y~C~~Cg~~fe~~~~~~------~~-~~-~~CP~Cg~~   35 (41)
T smart00834        5 EYRCEDCGHTFEVLQKIS------DD-PL-ATCPECGGD   35 (41)
T ss_pred             EEEcCCCCCEEEEEEecC------CC-CC-CCCCCCCCc
Confidence            478999999886544321      12 34 579999873


No 67 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=86.13  E-value=1.2  Score=19.82  Aligned_cols=27  Identities=22%  Similarity=0.550  Sum_probs=18.8

Q ss_pred             eeeccccccccccchhHHHHhhhhcCCCCceeCCCCCCC
Q psy12015         42 DLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHR   80 (96)
Q Consensus        42 ~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~   80 (96)
                      .|.|..|+..+...           ...+ ..|+.||..
T Consensus         2 ~Y~C~~Cg~~~~~~-----------~~~~-irC~~CG~r   28 (44)
T smart00659        2 IYICGECGRENEIK-----------SKDV-VRCRECGYR   28 (44)
T ss_pred             EEECCCCCCEeecC-----------CCCc-eECCCCCce
Confidence            47899999876543           1234 789999864


No 68 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=85.99  E-value=0.35  Score=21.27  Aligned_cols=30  Identities=20%  Similarity=0.739  Sum_probs=20.5

Q ss_pred             eeeccccccccccchhHHHHhhhhcCCCCceeCCCCCC
Q psy12015         42 DLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPH   79 (96)
Q Consensus        42 ~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~   79 (96)
                      .|.|..|+..|.....+.      . ..+ -.|+.||.
T Consensus         5 ey~C~~Cg~~fe~~~~~~------~-~~~-~~CP~Cg~   34 (42)
T PF09723_consen    5 EYRCEECGHEFEVLQSIS------E-DDP-VPCPECGS   34 (42)
T ss_pred             EEEeCCCCCEEEEEEEcC------C-CCC-CcCCCCCC
Confidence            378999998887654322      1 234 68999987


No 69 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=85.80  E-value=0.69  Score=26.49  Aligned_cols=36  Identities=14%  Similarity=0.333  Sum_probs=27.1

Q ss_pred             cccCeeeccccccccccchhHHHHhhhhcCCCCceeCCCCCCCCCC
Q psy12015         38 TVHIDLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHRSKH   83 (96)
Q Consensus        38 ~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~   83 (96)
                      ....-|.|+.|+..|+....+.         .. |.|+.||.....
T Consensus       105 ~~~~~Y~Cp~c~~r~tf~eA~~---------~~-F~Cp~Cg~~L~~  140 (158)
T TIGR00373       105 TNNMFFICPNMCVRFTFNEAME---------LN-FTCPRCGAMLDY  140 (158)
T ss_pred             cCCCeEECCCCCcEeeHHHHHH---------cC-CcCCCCCCEeee
Confidence            3456789999999988776653         24 999999986543


No 70 
>KOG2893|consensus
Probab=85.73  E-value=0.28  Score=30.09  Aligned_cols=42  Identities=19%  Similarity=0.393  Sum_probs=30.6

Q ss_pred             cCeeeccccccccccchhHHHHhhhhcCCCCceeCCCCCCCCCCchhH
Q psy12015         40 HIDLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHRSKHKAHL   87 (96)
Q Consensus        40 ~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l   87 (96)
                      .+| .|=.|.+.|..+..|..|++.    +. |+|-+|-+.+.+-.-|
T Consensus         9 ~kp-wcwycnrefddekiliqhqka----kh-fkchichkkl~sgpgl   50 (341)
T KOG2893|consen    9 DKP-WCWYCNREFDDEKILIQHQKA----KH-FKCHICHKKLFSGPGL   50 (341)
T ss_pred             CCc-eeeecccccchhhhhhhhhhh----cc-ceeeeehhhhccCCCc
Confidence            344 477888999999999888774    66 9999997765444333


No 71 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=85.15  E-value=1.2  Score=21.26  Aligned_cols=32  Identities=28%  Similarity=0.716  Sum_probs=18.2

Q ss_pred             eeeccccccccccchhHHHHhhhhcCCCCceeCCCCCC
Q psy12015         42 DLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPH   79 (96)
Q Consensus        42 ~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~   79 (96)
                      .|.|..||........     +-.....+ |.|+.||.
T Consensus        25 ~F~CPnCG~~~I~RC~-----~CRk~~~~-Y~CP~CGF   56 (59)
T PRK14890         25 KFLCPNCGEVIIYRCE-----KCRKQSNP-YTCPKCGF   56 (59)
T ss_pred             EeeCCCCCCeeEeech-----hHHhcCCc-eECCCCCC
Confidence            5788888875322221     11112256 89988874


No 72 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=85.05  E-value=0.92  Score=26.55  Aligned_cols=36  Identities=14%  Similarity=0.474  Sum_probs=26.7

Q ss_pred             ccCeeeccccccccccchhHHHHhhhhcCCCCceeCCCCCCCCCCc
Q psy12015         39 VHIDLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHRSKHK   84 (96)
Q Consensus        39 ~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~   84 (96)
                      ...-|.|+.|+..|+....+.         .. |.|+.||.....-
T Consensus       114 ~~~~Y~Cp~C~~rytf~eA~~---------~~-F~Cp~Cg~~L~~~  149 (178)
T PRK06266        114 NNMFFFCPNCHIRFTFDEAME---------YG-FRCPQCGEMLEEY  149 (178)
T ss_pred             CCCEEECCCCCcEEeHHHHhh---------cC-CcCCCCCCCCeec
Confidence            345789999999988776542         24 9999999875443


No 73 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=84.82  E-value=0.55  Score=28.32  Aligned_cols=26  Identities=27%  Similarity=0.588  Sum_probs=19.1

Q ss_pred             CCceeCCCCCCCCCCchhHHHHHhhcC
Q psy12015         69 EPKYQCPHCPHRSKHKAHLTTHMAIKH   95 (96)
Q Consensus        69 ~~~~~C~~c~~~f~~~~~l~~h~r~~h   95 (96)
                      .. |.|..|+|.|.-..-+..|+...|
T Consensus        76 ~K-~~C~lc~KlFkg~eFV~KHI~nKH  101 (214)
T PF04959_consen   76 DK-WRCPLCGKLFKGPEFVRKHIFNKH  101 (214)
T ss_dssp             EE-EEE-SSS-EESSHHHHHHHHHHH-
T ss_pred             CE-ECCCCCCcccCChHHHHHHHhhcC
Confidence            44 899999999999888888887655


No 74 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=84.48  E-value=1.2  Score=19.57  Aligned_cols=22  Identities=23%  Similarity=0.430  Sum_probs=11.2

Q ss_pred             eeCCCCCCCCCCc----hhHHHHHhh
Q psy12015         72 YQCPHCPHRSKHK----AHLTTHMAI   93 (96)
Q Consensus        72 ~~C~~c~~~f~~~----~~l~~h~r~   93 (96)
                      ..|..|++.+...    +.|.+|++.
T Consensus        17 a~C~~C~~~~~~~~~~ts~l~~HL~~   42 (45)
T PF02892_consen   17 AKCKYCGKVIKYSSGGTSNLKRHLKK   42 (45)
T ss_dssp             EEETTTTEE-----SSTHHHHHHHHH
T ss_pred             EEeCCCCeEEeeCCCcHHHHHHhhhh
Confidence            5677776655442    556666643


No 75 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=84.04  E-value=1.1  Score=17.60  Aligned_cols=19  Identities=26%  Similarity=0.679  Sum_probs=12.8

Q ss_pred             eCCCCCCCCCCchhHHHHHh
Q psy12015         73 QCPHCPHRSKHKAHLTTHMA   92 (96)
Q Consensus        73 ~C~~c~~~f~~~~~l~~h~r   92 (96)
                      .|++|++.+ ....+++|..
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            578888777 4456667654


No 76 
>PHA00626 hypothetical protein
Probab=83.04  E-value=0.77  Score=21.62  Aligned_cols=12  Identities=25%  Similarity=0.401  Sum_probs=5.9

Q ss_pred             eeeccccccccc
Q psy12015         42 DLKCDVCEKGYR   53 (96)
Q Consensus        42 ~~~c~~c~~~f~   53 (96)
                      .|.|..|+..|+
T Consensus        23 rYkCkdCGY~ft   34 (59)
T PHA00626         23 DYVCCDCGYNDS   34 (59)
T ss_pred             ceEcCCCCCeec
Confidence            455555554443


No 77 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=82.68  E-value=1.1  Score=23.92  Aligned_cols=25  Identities=32%  Similarity=0.725  Sum_probs=22.8

Q ss_pred             eeC----CCCCCCCCCchhHHHHHhhcCC
Q psy12015         72 YQC----PHCPHRSKHKAHLTTHMAIKHY   96 (96)
Q Consensus        72 ~~C----~~c~~~f~~~~~l~~h~r~~h~   96 (96)
                      |.|    ..|+....+...+.+|.+.+|.
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            889    8999999999999999998873


No 78 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=81.61  E-value=0.55  Score=26.86  Aligned_cols=13  Identities=23%  Similarity=0.493  Sum_probs=6.5

Q ss_pred             eeccccccccccc
Q psy12015         43 LKCDVCEKGYRYK   55 (96)
Q Consensus        43 ~~c~~c~~~f~~~   55 (96)
                      +.|+.|+..|...
T Consensus        29 ~~c~~c~~~f~~~   41 (154)
T PRK00464         29 RECLACGKRFTTF   41 (154)
T ss_pred             eeccccCCcceEe
Confidence            4455555555443


No 79 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=81.07  E-value=1.5  Score=19.87  Aligned_cols=21  Identities=19%  Similarity=0.540  Sum_probs=13.4

Q ss_pred             eeCCCCCCCCCCc-----hhHHHHHh
Q psy12015         72 YQCPHCPHRSKHK-----AHLTTHMA   92 (96)
Q Consensus        72 ~~C~~c~~~f~~~-----~~l~~h~r   92 (96)
                      -.|..|++.+...     ++|.+|++
T Consensus        19 a~C~~C~~~l~~~~~~gTs~L~rHl~   44 (50)
T smart00614       19 AKCKYCGKKLSRSSKGGTSNLRRHLR   44 (50)
T ss_pred             EEecCCCCEeeeCCCCCcHHHHHHHH
Confidence            4577777666444     46777776


No 80 
>PF14353 CpXC:  CpXC protein
Probab=80.37  E-value=0.94  Score=24.81  Aligned_cols=13  Identities=31%  Similarity=1.071  Sum_probs=8.8

Q ss_pred             eeCCCCCCCCCCc
Q psy12015         72 YQCPHCPHRSKHK   84 (96)
Q Consensus        72 ~~C~~c~~~f~~~   84 (96)
                      |.|+.||..|.-.
T Consensus        39 ~~CP~Cg~~~~~~   51 (128)
T PF14353_consen   39 FTCPSCGHKFRLE   51 (128)
T ss_pred             EECCCCCCceecC
Confidence            7777777766543


No 81 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=79.60  E-value=1.7  Score=23.34  Aligned_cols=30  Identities=20%  Similarity=0.575  Sum_probs=20.2

Q ss_pred             eeccccccccccchhHHHHhhhhcCCCCceeCCCCCCCCCCc
Q psy12015         43 LKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHRSKHK   84 (96)
Q Consensus        43 ~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~   84 (96)
                      ..|..||..|--.           +..| ..|+.||..|.-.
T Consensus        10 R~Cp~CG~kFYDL-----------nk~P-ivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCPSCGAKFYDL-----------NKDP-IVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCcchhccC-----------CCCC-ccCCCCCCccCcc
Confidence            3688888877431           2245 7899998887655


No 82 
>KOG2231|consensus
Probab=77.33  E-value=3.2  Score=29.34  Aligned_cols=48  Identities=23%  Similarity=0.555  Sum_probs=35.8

Q ss_pred             eccccccccccchhHHHHhhhhcCCCCceeCCCC------CCCCCCchhHHHHHhhcCC
Q psy12015         44 KCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHC------PHRSKHKAHLTTHMAIKHY   96 (96)
Q Consensus        44 ~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c------~~~f~~~~~l~~h~r~~h~   96 (96)
                      .|..|...|.....+..|++.+.     |.|..|      +.-|.....|+.|.|.+||
T Consensus       184 ~C~~C~~~fld~~el~rH~~~~h-----~~chfC~~~~~~neyy~~~~dLe~HfR~~Hf  237 (669)
T KOG2231|consen  184 LCKFCHERFLDDDELYRHLRFDH-----EFCHFCDYKTGQNEYYNDYDDLEEHFRKGHF  237 (669)
T ss_pred             cchhhhhhhccHHHHHHhhccce-----eheeecCcccccchhcccchHHHHHhhhcCc
Confidence            58889999998888888887543     444444      2346777889999998886


No 83 
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=76.72  E-value=1.2  Score=20.43  Aligned_cols=36  Identities=25%  Similarity=0.487  Sum_probs=19.1

Q ss_pred             eeccccccccccchhHHH-----HhhhhcCCCCceeCCCCCC
Q psy12015         43 LKCDVCEKGYRYKTGLWR-----HKKFECGQEPKYQCPHCPH   79 (96)
Q Consensus        43 ~~c~~c~~~f~~~~~l~~-----h~~~~~~~~~~~~C~~c~~   79 (96)
                      |.|..|+..+.....-..     -.....-... |.|+.|+.
T Consensus         2 y~C~~CgyiYd~~~Gd~~~~i~pGt~f~~Lp~~-w~CP~C~a   42 (50)
T cd00730           2 YECRICGYIYDPAEGDPDEGIPPGTPFEDLPDD-WVCPVCGA   42 (50)
T ss_pred             cCCCCCCeEECCCCCCcccCcCCCCCHhHCCCC-CCCCCCCC
Confidence            678899887765322111     0011111234 88999974


No 84 
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=76.61  E-value=2.7  Score=19.04  Aligned_cols=36  Identities=28%  Similarity=0.547  Sum_probs=17.5

Q ss_pred             eeccccccccccchhHHHH-----hhhhcCCCCceeCCCCCC
Q psy12015         43 LKCDVCEKGYRYKTGLWRH-----KKFECGQEPKYQCPHCPH   79 (96)
Q Consensus        43 ~~c~~c~~~f~~~~~l~~h-----~~~~~~~~~~~~C~~c~~   79 (96)
                      |.|..|+..+.....-...     .....-... |.|+.|+.
T Consensus         2 y~C~~CgyvYd~~~Gd~~~~i~pGt~F~~Lp~~-w~CP~C~a   42 (47)
T PF00301_consen    2 YQCPVCGYVYDPEKGDPENGIPPGTPFEDLPDD-WVCPVCGA   42 (47)
T ss_dssp             EEETTTSBEEETTTBBGGGTB-TT--GGGS-TT--B-TTTSS
T ss_pred             cCCCCCCEEEcCCcCCcccCcCCCCCHHHCCCC-CcCcCCCC
Confidence            6788888776654332111     111111234 88999975


No 85 
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=76.22  E-value=1.6  Score=24.35  Aligned_cols=15  Identities=33%  Similarity=0.673  Sum_probs=11.9

Q ss_pred             Ceeeccccccccccc
Q psy12015         41 IDLKCDVCEKGYRYK   55 (96)
Q Consensus        41 ~~~~c~~c~~~f~~~   55 (96)
                      ..+.|..|+..|...
T Consensus        69 ~~~~C~~CG~~~~~~   83 (135)
T PRK03824         69 AVLKCRNCGNEWSLK   83 (135)
T ss_pred             eEEECCCCCCEEecc
Confidence            468999999887654


No 86 
>KOG1146|consensus
Probab=74.29  E-value=1.1  Score=33.83  Aligned_cols=55  Identities=20%  Similarity=0.320  Sum_probs=42.1

Q ss_pred             ccCeeeccccccccccchhHHHHhhhhc----------------CCCCceeCCCCCCCCCCchhHHHHHhhc
Q psy12015         39 VHIDLKCDVCEKGYRYKTGLWRHKKFEC----------------GQEPKYQCPHCPHRSKHKAHLTTHMAIK   94 (96)
Q Consensus        39 ~~~~~~c~~c~~~f~~~~~l~~h~~~~~----------------~~~~~~~C~~c~~~f~~~~~l~~h~r~~   94 (96)
                      .+.+|.|..|--.|.....+..|.+.-.                -+...| |..|...|+....|+.|+++-
T Consensus      1281 ~~~~~~~~~~~~~~~~~~~l~~~~~k~~~~~~~~~~~~~~~l~~~d~~~~-c~~c~~~~~~~~alqihm~~~ 1351 (1406)
T KOG1146|consen 1281 VTHRYLCRQCKMAFDGEAPLTAHQRKFCFAGRGSGGSMPPPLRVPDCTYH-CLACEVLLSGREALQIHMRSS 1351 (1406)
T ss_pred             cchhHHHHHHHhhhcchhHHHHHHHHHHhccCccccCCCCcccCcccccc-chHHHhhcchhHHHHHHHHHh
Confidence            4567899999999999988888875211                112215 999999999999999999863


No 87 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=73.93  E-value=2.3  Score=16.41  Aligned_cols=8  Identities=38%  Similarity=1.456  Sum_probs=5.8

Q ss_pred             eeCCCCCC
Q psy12015         72 YQCPHCPH   79 (96)
Q Consensus        72 ~~C~~c~~   79 (96)
                      |.|+.||.
T Consensus        17 f~CPnCG~   24 (24)
T PF07754_consen   17 FPCPNCGF   24 (24)
T ss_pred             EeCCCCCC
Confidence            77777763


No 88 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=73.73  E-value=2.7  Score=25.46  Aligned_cols=29  Identities=14%  Similarity=0.173  Sum_probs=21.5

Q ss_pred             ccCeeeccccccccccchhHHHHhhhhcC
Q psy12015         39 VHIDLKCDVCEKGYRYKTGLWRHKKFECG   67 (96)
Q Consensus        39 ~~~~~~c~~c~~~f~~~~~l~~h~~~~~~   67 (96)
                      .+..|.|..|++.|.....+..|+...+.
T Consensus        74 ~~~K~~C~lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   74 DEDKWRCPLCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             SSEEEEE-SSS-EESSHHHHHHHHHHH-H
T ss_pred             cCCEECCCCCCcccCChHHHHHHHhhcCH
Confidence            34569999999999999999999976443


No 89 
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=72.86  E-value=2.7  Score=24.07  Aligned_cols=36  Identities=25%  Similarity=0.668  Sum_probs=25.1

Q ss_pred             cCeeeccccccccccchhHHHHhhhhcCCCCceeCCCCCCCC
Q psy12015         40 HIDLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHRS   81 (96)
Q Consensus        40 ~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f   81 (96)
                      .-+|.|. |+..+...   .+|-..-.|+ . |.|..|+...
T Consensus       115 ~~~Y~C~-C~q~~l~~---RRhn~~~~g~-~-YrC~~C~gkL  150 (156)
T COG3091         115 TYPYRCQ-CQQHYLRI---RRHNTVRRGE-V-YRCGKCGGKL  150 (156)
T ss_pred             ceeEEee-cCCccchh---hhcccccccc-e-EEeccCCceE
Confidence            3479999 99876543   4555555665 6 9999997643


No 90 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=72.47  E-value=2.5  Score=16.59  Aligned_cols=10  Identities=40%  Similarity=0.943  Sum_probs=7.2

Q ss_pred             eCCCCCCCCC
Q psy12015         73 QCPHCPHRSK   82 (96)
Q Consensus        73 ~C~~c~~~f~   82 (96)
                      .|+.||..|.
T Consensus        16 ~Cp~CG~~F~   25 (26)
T PF10571_consen   16 FCPHCGYDFE   25 (26)
T ss_pred             cCCCCCCCCc
Confidence            5777887764


No 91 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=70.73  E-value=4.3  Score=26.56  Aligned_cols=48  Identities=25%  Similarity=0.432  Sum_probs=28.3

Q ss_pred             eccccccccccchhHHHHhhhhcCCCCceeCCCCCC-------CCCCchhHHHHHhhcCC
Q psy12015         44 KCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPH-------RSKHKAHLTTHMAIKHY   96 (96)
Q Consensus        44 ~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~-------~f~~~~~l~~h~r~~h~   96 (96)
                      .|..|...|-....|.+|.|....     .|-+|++       -|..-..|.+|.+..||
T Consensus       222 ~C~FC~~~FYdDDEL~~HcR~~HE-----~ChICD~v~p~~~QYFK~Y~~Le~HF~~~hy  276 (493)
T COG5236         222 LCIFCKIYFYDDDELRRHCRLRHE-----ACHICDMVGPIRYQYFKSYEDLEAHFRNAHY  276 (493)
T ss_pred             hhhhccceecChHHHHHHHHhhhh-----hhhhhhccCccchhhhhCHHHHHHHhhcCce
Confidence            477777777777777777775333     2333332       25555666677666554


No 92 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=69.23  E-value=2.9  Score=23.37  Aligned_cols=21  Identities=24%  Similarity=0.513  Sum_probs=13.9

Q ss_pred             eeCCCCCCCCCCchhHHHHHhhcC
Q psy12015         72 YQCPHCPHRSKHKAHLTTHMAIKH   95 (96)
Q Consensus        72 ~~C~~c~~~f~~~~~l~~h~r~~h   95 (96)
                      ..|-.||+.|...   .+|.+.||
T Consensus        73 i~clecGk~~k~L---krHL~~~~   93 (132)
T PF05443_consen   73 IICLECGKKFKTL---KRHLRTHH   93 (132)
T ss_dssp             EE-TBT--EESBH---HHHHHHTT
T ss_pred             eEEccCCcccchH---HHHHHHcc
Confidence            6788899977654   78888876


No 93 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=68.56  E-value=5.2  Score=18.34  Aligned_cols=30  Identities=23%  Similarity=0.627  Sum_probs=19.2

Q ss_pred             cCeeeccccccccccchhHHHHhhhhcCCCCceeCCCCCCC
Q psy12015         40 HIDLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHR   80 (96)
Q Consensus        40 ~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~   80 (96)
                      ...|.|..|++.+...          ..... ..|+.||..
T Consensus         4 ~~~Y~C~~Cg~~~~~~----------~~~~~-irCp~Cg~r   33 (49)
T COG1996           4 MMEYKCARCGREVELD----------QETRG-IRCPYCGSR   33 (49)
T ss_pred             eEEEEhhhcCCeeehh----------hccCc-eeCCCCCcE
Confidence            3468999999887211          11133 789988853


No 94 
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=66.94  E-value=2.7  Score=16.87  Aligned_cols=19  Identities=21%  Similarity=0.448  Sum_probs=9.9

Q ss_pred             eeccccccccccchhHHHHh
Q psy12015         43 LKCDVCEKGYRYKTGLWRHK   62 (96)
Q Consensus        43 ~~c~~c~~~f~~~~~l~~h~   62 (96)
                      +.|..|++.|.. .....|.
T Consensus         1 ~sCiDC~~~F~~-~~y~~Ht   19 (28)
T PF08790_consen    1 FSCIDCSKDFDG-DSYKSHT   19 (28)
T ss_dssp             EEETTTTEEEEG-GGTTT--
T ss_pred             CeeecCCCCcCc-CCcCCCC
Confidence            457777777743 3344443


No 95 
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=66.72  E-value=2.2  Score=19.71  Aligned_cols=26  Identities=12%  Similarity=0.470  Sum_probs=15.7

Q ss_pred             cCeeeccccccccccchhHHHHhhhh
Q psy12015         40 HIDLKCDVCEKGYRYKTGLWRHKKFE   65 (96)
Q Consensus        40 ~~~~~c~~c~~~f~~~~~l~~h~~~~   65 (96)
                      ...|.|..|...|-..-++-.|+..|
T Consensus        19 ~~~y~C~~C~~~FC~dCD~fiHE~LH   44 (51)
T PF07975_consen   19 SSRYRCPKCKNHFCIDCDVFIHETLH   44 (51)
T ss_dssp             -EEE--TTTT--B-HHHHHTTTTTS-
T ss_pred             CCeEECCCCCCccccCcChhhhcccc
Confidence            34799999999999999988876643


No 96 
>KOG3408|consensus
Probab=64.01  E-value=4.1  Score=22.42  Aligned_cols=22  Identities=23%  Similarity=0.461  Sum_probs=16.1

Q ss_pred             eeCCCCCCCCCCchhHHHHHhh
Q psy12015         72 YQCPHCPHRSKHKAHLTTHMAI   93 (96)
Q Consensus        72 ~~C~~c~~~f~~~~~l~~h~r~   93 (96)
                      |.|-.|.+-|.+..+|..|.++
T Consensus        58 fyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   58 FYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             eehhhhhhhhcchHHHHHHHhc
Confidence            6777777777777777777664


No 97 
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=63.23  E-value=4.9  Score=21.78  Aligned_cols=27  Identities=22%  Similarity=0.722  Sum_probs=18.4

Q ss_pred             CeeeccccccccccchhHHHHhhhhcCCCCceeCCCCCCC
Q psy12015         41 IDLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHR   80 (96)
Q Consensus        41 ~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~   80 (96)
                      -...|..|+..|.....            . +.|+.||..
T Consensus        69 ~~~~C~~Cg~~~~~~~~------------~-~~CP~Cgs~   95 (115)
T TIGR00100        69 VECECEDCSEEVSPEID------------L-YRCPKCHGI   95 (115)
T ss_pred             cEEEcccCCCEEecCCc------------C-ccCcCCcCC
Confidence            35789999977654321            3 678888853


No 98 
>KOG4167|consensus
Probab=62.93  E-value=0.95  Score=32.17  Aligned_cols=23  Identities=17%  Similarity=0.364  Sum_probs=20.5

Q ss_pred             eeCCCCCCCCCCchhHHHHHhhc
Q psy12015         72 YQCPHCPHRSKHKAHLTTHMAIK   94 (96)
Q Consensus        72 ~~C~~c~~~f~~~~~l~~h~r~~   94 (96)
                      |.|..|++.|..-..++.|+++|
T Consensus       793 FpCreC~kvF~KiKSrNAHMK~H  815 (907)
T KOG4167|consen  793 FPCRECGKVFFKIKSRNAHMKTH  815 (907)
T ss_pred             eehHHHHHHHHHHhhhhHHHHHH
Confidence            88999999998888888888876


No 99 
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=61.44  E-value=5.7  Score=21.45  Aligned_cols=26  Identities=27%  Similarity=0.542  Sum_probs=17.5

Q ss_pred             CeeeccccccccccchhHHHHhhhhcCCCCceeCCCCCC
Q psy12015         41 IDLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPH   79 (96)
Q Consensus        41 ~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~   79 (96)
                      ....|..|+..|....            .. +.|+.||.
T Consensus        69 ~~~~C~~Cg~~~~~~~------------~~-~~CP~Cgs   94 (113)
T PRK12380         69 AQAWCWDCSQVVEIHQ------------HD-AQCPHCHG   94 (113)
T ss_pred             cEEEcccCCCEEecCC------------cC-ccCcCCCC
Confidence            3578999997665422            23 67988884


No 100
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=60.60  E-value=8.1  Score=21.49  Aligned_cols=30  Identities=13%  Similarity=0.165  Sum_probs=19.0

Q ss_pred             eeccccccccccchhHHHHhhhhcCCCCceeCCCCCCCCCCc
Q psy12015         43 LKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHRSKHK   84 (96)
Q Consensus        43 ~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~   84 (96)
                      ..|..|+..|--   |        +..| ..|+.||..|...
T Consensus        10 r~Cp~cg~kFYD---L--------nk~p-~vcP~cg~~~~~~   39 (129)
T TIGR02300        10 RICPNTGSKFYD---L--------NRRP-AVSPYTGEQFPPE   39 (129)
T ss_pred             ccCCCcCccccc---c--------CCCC-ccCCCcCCccCcc
Confidence            358888877642   1        2234 7888888876554


No 101
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=60.31  E-value=6.6  Score=16.90  Aligned_cols=13  Identities=23%  Similarity=0.674  Sum_probs=9.9

Q ss_pred             eeCCCCCCCCCCc
Q psy12015         72 YQCPHCPHRSKHK   84 (96)
Q Consensus        72 ~~C~~c~~~f~~~   84 (96)
                      |.|..|++.|-..
T Consensus        13 f~C~~C~~~FC~~   25 (39)
T smart00154       13 FKCRHCGNLFCGE   25 (39)
T ss_pred             eECCccCCccccc
Confidence            8899888877543


No 102
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=59.99  E-value=2.5  Score=25.97  Aligned_cols=28  Identities=14%  Similarity=0.368  Sum_probs=20.9

Q ss_pred             cCeeeccccccccccchhHHHHhhhhcC
Q psy12015         40 HIDLKCDVCEKGYRYKTGLWRHKKFECG   67 (96)
Q Consensus        40 ~~~~~c~~c~~~f~~~~~l~~h~~~~~~   67 (96)
                      ++...|++|+-.|....-.....|+-.|
T Consensus        17 kk~ieCPvC~tkFkkeev~tgsiRiiag   44 (267)
T COG1655          17 KKTIECPVCNTKFKKEEVKTGSIRIIAG   44 (267)
T ss_pred             hceeccCcccchhhhhheeccceeEecc
Confidence            5678999999999887766666665444


No 103
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=59.57  E-value=8.5  Score=18.18  Aligned_cols=38  Identities=24%  Similarity=0.503  Sum_probs=19.5

Q ss_pred             eeccccccccccchhHHHHhhhhcCCCCceeCCCCCCC
Q psy12015         43 LKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHR   80 (96)
Q Consensus        43 ~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~   80 (96)
                      ..|..|++.+....+-....+.......+|-|+.|...
T Consensus         3 vkC~lCdk~~~Id~~~~~aKrLrnrPi~tYmC~eC~~R   40 (56)
T PF09963_consen    3 VKCILCDKKEEIDEDTPEAKRLRNRPIHTYMCDECKER   40 (56)
T ss_pred             eEEEecCCEEEeccCCHHHHHhhcCCCcceeChhHHHH
Confidence            35677776655544433333332222334777777543


No 104
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=58.94  E-value=6.4  Score=16.25  Aligned_cols=9  Identities=56%  Similarity=1.512  Sum_probs=5.5

Q ss_pred             eeCCCCCCC
Q psy12015         72 YQCPHCPHR   80 (96)
Q Consensus        72 ~~C~~c~~~   80 (96)
                      ..|+.||..
T Consensus        18 irC~~CG~R   26 (32)
T PF03604_consen   18 IRCPECGHR   26 (32)
T ss_dssp             SSBSSSS-S
T ss_pred             EECCcCCCe
Confidence            567777753


No 105
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=58.26  E-value=3.9  Score=21.57  Aligned_cols=10  Identities=40%  Similarity=0.999  Sum_probs=5.2

Q ss_pred             eeCCCCCCCC
Q psy12015         72 YQCPHCPHRS   81 (96)
Q Consensus        72 ~~C~~c~~~f   81 (96)
                      ..|..||..|
T Consensus        80 ~rC~eCG~~f   89 (97)
T cd00924          80 KRCPECGHVF   89 (97)
T ss_pred             eeCCCCCcEE
Confidence            5555555544


No 106
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=56.88  E-value=8.7  Score=21.47  Aligned_cols=15  Identities=13%  Similarity=0.488  Sum_probs=10.2

Q ss_pred             eeeccccccccccch
Q psy12015         42 DLKCDVCEKGYRYKT   56 (96)
Q Consensus        42 ~~~c~~c~~~f~~~~   56 (96)
                      |+.|..|++.|...+
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            567777887776543


No 107
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=56.77  E-value=8.2  Score=21.97  Aligned_cols=35  Identities=23%  Similarity=0.560  Sum_probs=21.1

Q ss_pred             ccccccC----eeeccccccccccchhHHHHhhhhcCCCCceeCCCCCCC
Q psy12015         35 NVLTVHI----DLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHR   80 (96)
Q Consensus        35 ~~~~~~~----~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~   80 (96)
                      ..++|++    .+.|..|+......         +.+.-|  .|+.||..
T Consensus       101 ~Y~sGE~~g~G~l~C~~Cg~~~~~~---------~~~~l~--~Cp~C~~~  139 (146)
T PF07295_consen  101 VYHSGEVVGPGTLVCENCGHEVELT---------HPERLP--PCPKCGHT  139 (146)
T ss_pred             CeecCcEecCceEecccCCCEEEec---------CCCcCC--CCCCCCCC
Confidence            3455655    58899999754321         222233  69999865


No 108
>KOG2636|consensus
Probab=56.65  E-value=9.5  Score=25.83  Aligned_cols=29  Identities=21%  Similarity=0.351  Sum_probs=20.8

Q ss_pred             hhhcCCCCceeCCCCC-CCCCCchhHHHHHh
Q psy12015         63 KFECGQEPKYQCPHCP-HRSKHKAHLTTHMA   92 (96)
Q Consensus        63 ~~~~~~~~~~~C~~c~-~~f~~~~~l~~h~r   92 (96)
                      +.|.-+.. |.|.+|| +.+.-+.++.+|..
T Consensus       394 KLHGL~~e-y~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  394 KLHGLDIE-YNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             hhcCCCcc-cceeeccCccccCcHHHHHHhH
Confidence            34555566 9999998 67777777777753


No 109
>PF10537 WAC_Acf1_DNA_bd:  ATP-utilising chromatin assembly and remodelling N-terminal;  InterPro: IPR013136 ACF (for ATP-utilising chromatin assembly and remodeling factor) is a chromatin-remodeling complex that catalyzes the ATP-dependent assembly of periodic nucleosome arrays. This reaction utilises the energy of ATP hydrolysis by ISWI, the smaller of the two subunits of ACF. Acf1, the large subunit of ACF, is essential for the full activity of the complex. The WAC (WSTF/Acf1/cbp146) domain is an ~110-residue module present at the N-termini of Acf1-related proteins in a variety of organisms. It is found in association with other domains such as the bromodomain, the PHD-type zinc finger, DDT or WAKS. The DNA-binding region of Acf1 includes the WAC domain, which is necessary for the efficient binding of ACF complex to DNA. It seems probable that the WAC domain will be involved in DNA binding in other related factors [, ].   Some proteins known to contain a WAC domain are the Drosophila melanogaster (Fruit fly) ATP-dependent chromatin assembly factor large subunit Acf1, human WSTF (Williams syndrome transcription factor), mouse cbp146, yeast imitation switch two complex protein 1 (ITC1 or YGL133w), and yeast protein YPL216w. 
Probab=55.93  E-value=23  Score=18.87  Aligned_cols=38  Identities=5%  Similarity=-0.020  Sum_probs=25.9

Q ss_pred             CeeeccccccccccchhHHHHhhhhcCCCCceeCCCCCCC
Q psy12015         41 IDLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHR   80 (96)
Q Consensus        41 ~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~   80 (96)
                      ..|.|..-+..|..-.+....+..... +. |.|...|+.
T Consensus         2 eVf~i~~T~EiF~dYe~Y~~R~~~y~~-~v-wtC~~TGk~   39 (102)
T PF10537_consen    2 EVFYIPFTGEIFRDYEEYLKRMILYNQ-RV-WTCEITGKS   39 (102)
T ss_pred             ceEEeCCCCcccCCHHHHHHHHHHHhC-Ce-eEEecCCCC
Confidence            346677778888887776665554444 55 888887763


No 110
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=55.64  E-value=9.3  Score=20.42  Aligned_cols=15  Identities=13%  Similarity=0.454  Sum_probs=10.9

Q ss_pred             Ceeeccccccccccc
Q psy12015         41 IDLKCDVCEKGYRYK   55 (96)
Q Consensus        41 ~~~~c~~c~~~f~~~   55 (96)
                      +|+.|..||..|..-
T Consensus         1 MpH~CtrCG~vf~~g   15 (112)
T COG3364           1 MPHQCTRCGEVFDDG   15 (112)
T ss_pred             CCceecccccccccc
Confidence            367788888887763


No 111
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=54.83  E-value=6.9  Score=19.47  Aligned_cols=17  Identities=12%  Similarity=0.272  Sum_probs=8.7

Q ss_pred             Ceeecc--ccccccccchh
Q psy12015         41 IDLKCD--VCEKGYRYKTG   57 (96)
Q Consensus        41 ~~~~c~--~c~~~f~~~~~   57 (96)
                      .-+.|.  .|+..|.....
T Consensus        26 ~Y~qC~N~eCg~tF~t~es   44 (72)
T PRK09678         26 RYHQCQNVNCSATFITYES   44 (72)
T ss_pred             eeeecCCCCCCCEEEEEEE
Confidence            344555  56655555443


No 112
>KOG2593|consensus
Probab=54.20  E-value=9.2  Score=25.69  Aligned_cols=40  Identities=20%  Similarity=0.409  Sum_probs=26.9

Q ss_pred             cccCeeeccccccccccchhHHHHhhhhcCCCCceeCCCCCCCC
Q psy12015         38 TVHIDLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHRS   81 (96)
Q Consensus        38 ~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f   81 (96)
                      +...-|.|+.|.+.|.....+..   .....-. |.|..|+...
T Consensus       124 t~~~~Y~Cp~C~kkyt~Lea~~L---~~~~~~~-F~C~~C~gel  163 (436)
T KOG2593|consen  124 TNVAGYVCPNCQKKYTSLEALQL---LDNETGE-FHCENCGGEL  163 (436)
T ss_pred             cccccccCCccccchhhhHHHHh---hcccCce-EEEecCCCch
Confidence            34557999999999988765432   2221234 9999998654


No 113
>KOG1842|consensus
Probab=53.63  E-value=5.5  Score=26.88  Aligned_cols=24  Identities=25%  Similarity=0.659  Sum_probs=16.6

Q ss_pred             eeCCCCCCCCCCchhHHHHHhhcC
Q psy12015         72 YQCPHCPHRSKHKAHLTTHMAIKH   95 (96)
Q Consensus        72 ~~C~~c~~~f~~~~~l~~h~r~~h   95 (96)
                      |.|++|...|.+...|..|...-|
T Consensus        16 flCPiC~~dl~~~~~L~~H~d~eH   39 (505)
T KOG1842|consen   16 FLCPICLLDLPNLSALNDHLDVEH   39 (505)
T ss_pred             ccCchHhhhhhhHHHHHHHHhhhc
Confidence            667777777777777777766544


No 114
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=53.31  E-value=13  Score=20.92  Aligned_cols=48  Identities=19%  Similarity=0.279  Sum_probs=26.9

Q ss_pred             eeeccccccccccchh--HHHHh--hh-hcCCCCceeCCCCCCCCCCchhHHHH
Q psy12015         42 DLKCDVCEKGYRYKTG--LWRHK--KF-ECGQEPKYQCPHCPHRSKHKAHLTTH   90 (96)
Q Consensus        42 ~~~c~~c~~~f~~~~~--l~~h~--~~-~~~~~~~~~C~~c~~~f~~~~~l~~h   90 (96)
                      ...|..|+..+..-+.  +..-.  .+ ....+- +.|+.||+.|..-+.+.+-
T Consensus        91 ~sRC~~CN~~L~~v~~~~v~~~vp~~v~~~~~~f-~~C~~C~kiyW~GsH~~~~  143 (147)
T PF01927_consen   91 FSRCPKCNGPLRPVSKEEVKDRVPPYVYETYDEF-WRCPGCGKIYWEGSHWRRM  143 (147)
T ss_pred             CCccCCCCcEeeechhhccccccCccccccCCeE-EECCCCCCEecccccHHHH
Confidence            3579999976543221  11000  01 111223 7899999999877666543


No 115
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=52.73  E-value=8.7  Score=26.13  Aligned_cols=41  Identities=20%  Similarity=0.451  Sum_probs=23.1

Q ss_pred             ccCeeeccccccccccchhHHHH-----hhhhcCCCCceeCCCCCCC
Q psy12015         39 VHIDLKCDVCEKGYRYKTGLWRH-----KKFECGQEPKYQCPHCPHR   80 (96)
Q Consensus        39 ~~~~~~c~~c~~~f~~~~~l~~h-----~~~~~~~~~~~~C~~c~~~   80 (96)
                      ....|.|..|+..+.....-...     .....-... |.|+.|+..
T Consensus       422 ~~~~~~c~~c~~~yd~~~g~~~~~~~~gt~~~~lp~~-~~cp~c~~~  467 (479)
T PRK05452        422 LGPRMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDN-FLCPECSLG  467 (479)
T ss_pred             CCCeEEECCCCeEECCCCCCcccCCCCCCChhhCCCC-CcCcCCCCc
Confidence            34579999999887654321111     011111133 899999853


No 116
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=52.54  E-value=10  Score=16.79  Aligned_cols=11  Identities=27%  Similarity=1.141  Sum_probs=6.1

Q ss_pred             ccccccccccc
Q psy12015         45 CDVCEKGYRYK   55 (96)
Q Consensus        45 c~~c~~~f~~~   55 (96)
                      |..|++.|+..
T Consensus        11 C~~C~rpf~WR   21 (42)
T PF10013_consen   11 CPVCGRPFTWR   21 (42)
T ss_pred             CcccCCcchHH
Confidence            55666555543


No 117
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=52.03  E-value=11  Score=17.62  Aligned_cols=30  Identities=20%  Similarity=0.441  Sum_probs=19.1

Q ss_pred             eeccccccccccchhHHHHhhhhcCCCCceeCCCCCCCC
Q psy12015         43 LKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHRS   81 (96)
Q Consensus        43 ~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f   81 (96)
                      +.|..|+..+....+.       .| .. ..|+.||..+
T Consensus         3 ~~CP~CG~~iev~~~~-------~G-ei-V~Cp~CGael   32 (54)
T TIGR01206         3 FECPDCGAEIELENPE-------LG-EL-VICDECGAEL   32 (54)
T ss_pred             cCCCCCCCEEecCCCc-------cC-CE-EeCCCCCCEE
Confidence            5788888876543321       23 34 7888888754


No 118
>PRK04351 hypothetical protein; Provisional
Probab=52.02  E-value=11  Score=21.55  Aligned_cols=33  Identities=24%  Similarity=0.558  Sum_probs=21.1

Q ss_pred             eeeccccccccccchhHHHHhhhhcCCCCceeCCCCCCCCCC
Q psy12015         42 DLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHRSKH   83 (96)
Q Consensus        42 ~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~   83 (96)
                      .|.|..|+..+...       +.+ .... |.|..|+..+..
T Consensus       112 ~Y~C~~Cg~~~~r~-------Rr~-n~~~-yrCg~C~g~L~~  144 (149)
T PRK04351        112 LYECQSCGQQYLRK-------RRI-NTKR-YRCGKCRGKLKL  144 (149)
T ss_pred             EEECCCCCCEeeee-------eec-CCCc-EEeCCCCcEeee
Confidence            58898898765432       112 2255 999999876544


No 119
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=50.20  E-value=7  Score=17.09  Aligned_cols=12  Identities=25%  Similarity=0.730  Sum_probs=6.8

Q ss_pred             eeCCCCCCCCCC
Q psy12015         72 YQCPHCPHRSKH   83 (96)
Q Consensus        72 ~~C~~c~~~f~~   83 (96)
                      +.|..|++.|-.
T Consensus        14 ~~C~~C~~~FC~   25 (43)
T PF01428_consen   14 FKCKHCGKSFCL   25 (43)
T ss_dssp             EE-TTTS-EE-T
T ss_pred             eECCCCCcccCc
Confidence            888888877643


No 120
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=49.46  E-value=11  Score=18.09  Aligned_cols=28  Identities=18%  Similarity=0.489  Sum_probs=10.9

Q ss_pred             eeccccccccccchhHHHHhhhhcCCCCceeCCCCCCCCCC
Q psy12015         43 LKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHRSKH   83 (96)
Q Consensus        43 ~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~   83 (96)
                      -.|..|++.|...            .+. +-|..||..|-.
T Consensus        10 ~~C~~C~~~F~~~------------~rr-hhCr~CG~~vC~   37 (69)
T PF01363_consen   10 SNCMICGKKFSLF------------RRR-HHCRNCGRVVCS   37 (69)
T ss_dssp             SB-TTT--B-BSS------------S-E-EE-TTT--EEEC
T ss_pred             CcCcCcCCcCCCc------------eee-EccCCCCCEECC
Confidence            3577777777431            134 667777666543


No 121
>COG1773 Rubredoxin [Energy production and conversion]
Probab=49.38  E-value=8.4  Score=18.13  Aligned_cols=11  Identities=18%  Similarity=0.600  Sum_probs=7.3

Q ss_pred             eeCCCCCCCCC
Q psy12015         72 YQCPHCPHRSK   82 (96)
Q Consensus        72 ~~C~~c~~~f~   82 (96)
                      |+|..||..|.
T Consensus         4 ~~C~~CG~vYd   14 (55)
T COG1773           4 WRCSVCGYVYD   14 (55)
T ss_pred             eEecCCceEec
Confidence            67777776653


No 122
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=49.07  E-value=10  Score=20.62  Aligned_cols=15  Identities=20%  Similarity=0.764  Sum_probs=10.6

Q ss_pred             cCeeecccccccccc
Q psy12015         40 HIDLKCDVCEKGYRY   54 (96)
Q Consensus        40 ~~~~~c~~c~~~f~~   54 (96)
                      .-...|..|+..|..
T Consensus        69 p~~~~C~~Cg~~~~~   83 (117)
T PRK00564         69 KVELECKDCSHVFKP   83 (117)
T ss_pred             CCEEEhhhCCCcccc
Confidence            335789999976654


No 123
>KOG2785|consensus
Probab=48.68  E-value=23  Score=23.52  Aligned_cols=52  Identities=19%  Similarity=0.254  Sum_probs=35.9

Q ss_pred             eeeccccccccccchhHHHHhhhhcCCCCc----------------------eeCCCCC---CCCCCchhHHHHHhh
Q psy12015         42 DLKCDVCEKGYRYKTGLWRHKKFECGQEPK----------------------YQCPHCP---HRSKHKAHLTTHMAI   93 (96)
Q Consensus        42 ~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~----------------------~~C~~c~---~~f~~~~~l~~h~r~   93 (96)
                      |--|-.|+..+........|+..++|-..|                      |.|-.|.   +.|....+...|+..
T Consensus       166 Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  166 PTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             CcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            456777887777776667777655542111                      5676676   889999998888874


No 124
>KOG2893|consensus
Probab=47.66  E-value=10  Score=23.56  Aligned_cols=26  Identities=27%  Similarity=0.603  Sum_probs=21.6

Q ss_pred             CCceeCCCCCCCCCCchhHHHHHhhcCC
Q psy12015         69 EPKYQCPHCPHRSKHKAHLTTHMAIKHY   96 (96)
Q Consensus        69 ~~~~~C~~c~~~f~~~~~l~~h~r~~h~   96 (96)
                      ++ | |=.|++.|.....|.+|++..||
T Consensus        10 kp-w-cwycnrefddekiliqhqkakhf   35 (341)
T KOG2893|consen   10 KP-W-CWYCNREFDDEKILIQHQKAKHF   35 (341)
T ss_pred             Cc-e-eeecccccchhhhhhhhhhhccc
Confidence            45 6 44699999999999999998876


No 125
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=47.52  E-value=16  Score=19.83  Aligned_cols=22  Identities=18%  Similarity=0.418  Sum_probs=13.5

Q ss_pred             eeCCCCCCCCCCchhHHHHHhh
Q psy12015         72 YQCPHCPHRSKHKAHLTTHMAI   93 (96)
Q Consensus        72 ~~C~~c~~~f~~~~~l~~h~r~   93 (96)
                      |+|+.|...|-....+-.|...
T Consensus        82 y~C~~C~~~FC~dCD~fiHe~L  103 (112)
T TIGR00622        82 YVCAVCKNVFCVDCDVFVHESL  103 (112)
T ss_pred             eeCCCCCCccccccchhhhhhc
Confidence            7777777777665555455443


No 126
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=46.59  E-value=16  Score=24.94  Aligned_cols=28  Identities=21%  Similarity=0.510  Sum_probs=21.4

Q ss_pred             CCCCceeCCCCCCCCCCchhHHHHHhhcC
Q psy12015         67 GQEPKYQCPHCPHRSKHKAHLTTHMAIKH   95 (96)
Q Consensus        67 ~~~~~~~C~~c~~~f~~~~~l~~h~r~~h   95 (96)
                      .++= |.|+.|.+.|.....+..|+..-|
T Consensus        54 sWrF-WiCp~CskkF~d~~~~~~H~~~eH   81 (466)
T PF04780_consen   54 SWRF-WICPRCSKKFSDAESCLSHMEQEH   81 (466)
T ss_pred             ceeE-eeCCcccceeCCHHHHHHHHHHhh
Confidence            3344 678889888999888888887655


No 127
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=46.53  E-value=12  Score=17.21  Aligned_cols=18  Identities=22%  Similarity=0.676  Sum_probs=13.6

Q ss_pred             cCeeeccccccccccchh
Q psy12015         40 HIDLKCDVCEKGYRYKTG   57 (96)
Q Consensus        40 ~~~~~c~~c~~~f~~~~~   57 (96)
                      ++++.|..||..|.....
T Consensus         2 Dk~l~C~dCg~~FvfTa~   19 (49)
T PF13451_consen    2 DKTLTCKDCGAEFVFTAG   19 (49)
T ss_pred             CeeEEcccCCCeEEEehh
Confidence            467889999988776543


No 128
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=46.35  E-value=7.7  Score=27.84  Aligned_cols=56  Identities=21%  Similarity=0.423  Sum_probs=32.3

Q ss_pred             ccccccccccchhhhhhhccccccccCeee-ccccccccccchhHHHHhhhhcCCCCceeCCCCCCC
Q psy12015         15 NTKLDFGVIRNSSVDKSLNTNVLTVHIDLK-CDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHR   80 (96)
Q Consensus        15 ~~~~~~~~~~~~~~~~h~~~~~~~~~~~~~-c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~   80 (96)
                      ++.||-.|+--..+.=-   |.++....|. |+.|.+.+....+-    |.|.  .+ ..|+.||..
T Consensus       126 CT~CGPRfTIi~alPYD---R~nTsM~~F~lC~~C~~EY~dP~nR----RfHA--Qp-~aCp~CGP~  182 (750)
T COG0068         126 CTNCGPRFTIIEALPYD---RENTSMADFPLCPFCDKEYKDPLNR----RFHA--QP-IACPKCGPH  182 (750)
T ss_pred             cCCCCcceeeeccCCCC---cccCccccCcCCHHHHHHhcCcccc----cccc--cc-ccCcccCCC
Confidence            35566666655444332   3444444444 88888777766553    2232  35 789999874


No 129
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=46.22  E-value=6.3  Score=16.99  Aligned_cols=32  Identities=19%  Similarity=0.570  Sum_probs=13.1

Q ss_pred             eeeccccccccccchhHHHHhhhhcCCCCceeCCCCCCC
Q psy12015         42 DLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHR   80 (96)
Q Consensus        42 ~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~   80 (96)
                      |.+|..|+..+..      ......+.+. |.|..|+..
T Consensus         2 p~rC~~C~aylNp------~~~~~~~~~~-w~C~~C~~~   33 (40)
T PF04810_consen    2 PVRCRRCRAYLNP------FCQFDDGGKT-WICNFCGTK   33 (40)
T ss_dssp             S-B-TTT--BS-T------TSEEETTTTE-EEETTT--E
T ss_pred             ccccCCCCCEECC------cceEcCCCCE-EECcCCCCc
Confidence            3456666543322      2223334456 888888764


No 130
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=46.08  E-value=13  Score=20.45  Aligned_cols=33  Identities=18%  Similarity=0.485  Sum_probs=18.7

Q ss_pred             cCeeeccccccccccchhHHHHhhhhcCCCCceeCCCCCC
Q psy12015         40 HIDLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPH   79 (96)
Q Consensus        40 ~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~   79 (96)
                      .....| .|+..|.....-..+    .  .+.+.|+.||.
T Consensus        68 p~~~~C-~Cg~~~~~~~~~~~~----~--~~~~~CP~Cgs  100 (124)
T PRK00762         68 PVEIEC-ECGYEGVVDEDEIDH----Y--AAVIECPVCGN  100 (124)
T ss_pred             CeeEEe-eCcCcccccccchhc----c--ccCCcCcCCCC
Confidence            335789 999877654211111    1  11157999984


No 131
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=45.71  E-value=8  Score=17.74  Aligned_cols=13  Identities=23%  Similarity=0.524  Sum_probs=6.4

Q ss_pred             eeCCCCCCCCCCc
Q psy12015         72 YQCPHCPHRSKHK   84 (96)
Q Consensus        72 ~~C~~c~~~f~~~   84 (96)
                      -.|++|++.|...
T Consensus        21 ~~CPlC~r~l~~e   33 (54)
T PF04423_consen   21 GCCPLCGRPLDEE   33 (54)
T ss_dssp             EE-TTT--EE-HH
T ss_pred             CcCCCCCCCCCHH
Confidence            3799999887654


No 132
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=45.33  E-value=17  Score=15.39  Aligned_cols=19  Identities=26%  Similarity=0.733  Sum_probs=9.9

Q ss_pred             HHHHhhhhcCCCCceeCCCC
Q psy12015         58 LWRHKKFECGQEPKYQCPHC   77 (96)
Q Consensus        58 l~~h~~~~~~~~~~~~C~~c   77 (96)
                      +..|=....|... |.|..|
T Consensus        17 v~k~G~~~~G~qr-yrC~~C   35 (36)
T PF03811_consen   17 VKKNGKSPSGHQR-YRCKDC   35 (36)
T ss_pred             ceeCCCCCCCCEe-EecCcC
Confidence            3344444455455 666655


No 133
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=43.98  E-value=11  Score=21.15  Aligned_cols=32  Identities=25%  Similarity=0.732  Sum_probs=19.6

Q ss_pred             eeeccccccccccchhHHHHhhhhcCCCCceeCCCCCCCCC
Q psy12015         42 DLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHRSK   82 (96)
Q Consensus        42 ~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~   82 (96)
                      .|.|..|+..+.      .+.+.  .... |.|..|+..+.
T Consensus       123 ~~~C~~C~~~~~------r~~~~--~~~~-~~C~~C~~~l~  154 (157)
T PF10263_consen  123 VYRCPSCGREYK------RHRRS--KRKR-YRCGRCGGPLV  154 (157)
T ss_pred             EEEcCCCCCEee------eeccc--chhh-EECCCCCCEEE
Confidence            577888887653      22232  2234 88998886543


No 134
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=43.83  E-value=27  Score=16.02  Aligned_cols=41  Identities=27%  Similarity=0.575  Sum_probs=21.5

Q ss_pred             cCeeeccc--cccccccchhHHHHhhhhcCCCCceeCCC----CCCCCC
Q psy12015         40 HIDLKCDV--CEKGYRYKTGLWRHKKFECGQEPKYQCPH----CPHRSK   82 (96)
Q Consensus        40 ~~~~~c~~--c~~~f~~~~~l~~h~~~~~~~~~~~~C~~----c~~~f~   82 (96)
                      ..+..|+.  |...+. ...+..|....-..++ ..|+.    |+..+.
T Consensus         7 ~~~v~C~~~cc~~~i~-r~~l~~H~~~~C~~~~-v~C~~~~~GC~~~~~   53 (60)
T PF02176_consen    7 FRPVPCPNGCCNEMIP-RKELDDHLENECPKRP-VPCPYSPYGCKERVP   53 (60)
T ss_dssp             TSEEE-TT--S-BEEE-CCCHHHHHHTTSTTSE-EE-SS----S--EEE
T ss_pred             CCEeeCCCCCccccee-HHHHHHHHHccCCCCc-EECCCCCCCCCCccc
Confidence            34566766  333343 5567788876556555 77877    665443


No 135
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=43.82  E-value=11  Score=17.13  Aligned_cols=10  Identities=30%  Similarity=1.085  Sum_probs=3.7

Q ss_pred             CCceeCCCCCC
Q psy12015         69 EPKYQCPHCPH   79 (96)
Q Consensus        69 ~~~~~C~~c~~   79 (96)
                      .. |.|++|++
T Consensus        40 ~~-W~CPiC~~   49 (50)
T PF02891_consen   40 PK-WKCPICNK   49 (50)
T ss_dssp             ----B-TTT--
T ss_pred             CC-eECcCCcC
Confidence            44 89999975


No 136
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=43.17  E-value=11  Score=16.06  Aligned_cols=10  Identities=40%  Similarity=1.132  Sum_probs=4.7

Q ss_pred             eeCCCCCCCC
Q psy12015         72 YQCPHCPHRS   81 (96)
Q Consensus        72 ~~C~~c~~~f   81 (96)
                      |.|..||...
T Consensus         7 YkC~~CGniV   16 (36)
T PF06397_consen    7 YKCEHCGNIV   16 (36)
T ss_dssp             EE-TTT--EE
T ss_pred             EEccCCCCEE
Confidence            7777777643


No 137
>PLN02294 cytochrome c oxidase subunit Vb
Probab=43.10  E-value=12  Score=21.88  Aligned_cols=27  Identities=11%  Similarity=0.185  Sum_probs=18.6

Q ss_pred             hhhhhhhccccccccCeeeccccccccccc
Q psy12015         26 SSVDKSLNTNVLTVHIDLKCDVCEKGYRYK   55 (96)
Q Consensus        26 ~~~~~h~~~~~~~~~~~~~c~~c~~~f~~~   55 (96)
                      +....++  ..+.| +|.+|..|+..|...
T Consensus       128 sh~v~Wf--~L~kG-kp~RCpeCG~~fkL~  154 (174)
T PLN02294        128 EHDVVWF--WLEKG-KSFECPVCTQYFELE  154 (174)
T ss_pred             CceeEEE--EecCC-CceeCCCCCCEEEEE
Confidence            3444455  45554 689999999988754


No 138
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=41.91  E-value=11  Score=20.23  Aligned_cols=27  Identities=19%  Similarity=0.616  Sum_probs=15.9

Q ss_pred             CeeeccccccccccchhHHHHhhhhcCCCCceeCCCCCCC
Q psy12015         41 IDLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHR   80 (96)
Q Consensus        41 ~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~   80 (96)
                      -...|..|+..|.....            . +.|+.||..
T Consensus        69 ~~~~C~~Cg~~~~~~~~------------~-~~CP~Cgs~   95 (113)
T PF01155_consen   69 ARARCRDCGHEFEPDEF------------D-FSCPRCGSP   95 (113)
T ss_dssp             -EEEETTTS-EEECHHC------------C-HH-SSSSSS
T ss_pred             CcEECCCCCCEEecCCC------------C-CCCcCCcCC
Confidence            35789999988764321            2 458888764


No 139
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=41.17  E-value=26  Score=15.90  Aligned_cols=9  Identities=22%  Similarity=0.873  Sum_probs=3.6

Q ss_pred             ecccccccc
Q psy12015         44 KCDVCEKGY   52 (96)
Q Consensus        44 ~c~~c~~~f   52 (96)
                      .|..||+.|
T Consensus        20 ~Cr~Cg~~~   28 (57)
T cd00065          20 HCRNCGRIF   28 (57)
T ss_pred             ccCcCcCCc
Confidence            344444433


No 140
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=40.61  E-value=15  Score=19.85  Aligned_cols=28  Identities=21%  Similarity=0.562  Sum_probs=17.1

Q ss_pred             CeeeccccccccccchhHHHHhhhhcCCCCceeCCCCCCC
Q psy12015         41 IDLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHR   80 (96)
Q Consensus        41 ~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~   80 (96)
                      -...|..|+..|.....           .. +.|+.||..
T Consensus        69 ~~~~C~~Cg~~~~~~~~-----------~~-~~CP~Cgs~   96 (114)
T PRK03681         69 AECWCETCQQYVTLLTQ-----------RV-RRCPQCHGD   96 (114)
T ss_pred             cEEEcccCCCeeecCCc-----------cC-CcCcCcCCC
Confidence            35789999975543211           12 568888853


No 141
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=39.73  E-value=26  Score=16.71  Aligned_cols=14  Identities=21%  Similarity=0.807  Sum_probs=10.0

Q ss_pred             CCceeCCCCCCCCCC
Q psy12015         69 EPKYQCPHCPHRSKH   83 (96)
Q Consensus        69 ~~~~~C~~c~~~f~~   83 (96)
                      +. |.|+.||.....
T Consensus        45 r~-~~C~~Cg~~~~r   58 (69)
T PF07282_consen   45 RV-FTCPNCGFEMDR   58 (69)
T ss_pred             ce-EEcCCCCCEECc
Confidence            45 899999876443


No 142
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=39.51  E-value=38  Score=15.85  Aligned_cols=34  Identities=15%  Similarity=0.256  Sum_probs=17.3

Q ss_pred             ccCeeeccccccccccchhHHHHhhhhcCCCCceeCCCC
Q psy12015         39 VHIDLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHC   77 (96)
Q Consensus        39 ~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c   77 (96)
                      -+.|.....|+..|.....+ ...   ..... ..|+.-
T Consensus        21 ~~~PV~s~~C~H~fek~aI~-~~i---~~~~~-~~CPv~   54 (57)
T PF11789_consen   21 FEDPVKSKKCGHTFEKEAIL-QYI---QRNGS-KRCPVA   54 (57)
T ss_dssp             -SSEEEESSS--EEEHHHHH-HHC---TTTS--EE-SCC
T ss_pred             hhCCcCcCCCCCeecHHHHH-HHH---HhcCC-CCCCCC
Confidence            35678888888888765433 333   12234 788873


No 144
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=39.27  E-value=11  Score=20.05  Aligned_cols=38  Identities=11%  Similarity=0.162  Sum_probs=21.9

Q ss_pred             cCeeeccccccccccchhHHHHhhhhcCCCCceeCCCCCCCCC
Q psy12015         40 HIDLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHRSK   82 (96)
Q Consensus        40 ~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~   82 (96)
                      ++.|.|..|+..-.....+..-     ...-...|..||..|.
T Consensus        20 ~k~FtCp~Cghe~vs~ctvkk~-----~~~g~~~Cg~CGls~e   57 (104)
T COG4888          20 PKTFTCPRCGHEKVSSCTVKKT-----VNIGTAVCGNCGLSFE   57 (104)
T ss_pred             CceEecCccCCeeeeEEEEEec-----CceeEEEcccCcceEE
Confidence            4678999998755443332211     1111257888887664


No 145
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=39.01  E-value=32  Score=14.92  Aligned_cols=23  Identities=26%  Similarity=0.404  Sum_probs=14.8

Q ss_pred             eecccccccccc--chhHHHHhhhh
Q psy12015         43 LKCDVCEKGYRY--KTGLWRHKKFE   65 (96)
Q Consensus        43 ~~c~~c~~~f~~--~~~l~~h~~~~   65 (96)
                      -.|..|+-.|..  .++...|.+-|
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~~yH   38 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHKKYH   38 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHHHHH
Confidence            468888865443  56666776654


No 146
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=38.79  E-value=17  Score=20.22  Aligned_cols=16  Identities=19%  Similarity=0.584  Sum_probs=12.2

Q ss_pred             CCCceeCCCCCCCCCCc
Q psy12015         68 QEPKYQCPHCPHRSKHK   84 (96)
Q Consensus        68 ~~~~~~C~~c~~~f~~~   84 (96)
                      ... |.|+.|++.|...
T Consensus        51 ~qR-yrC~~C~~tf~~~   66 (129)
T COG3677          51 HQR-YKCKSCGSTFTVE   66 (129)
T ss_pred             ccc-cccCCcCcceeee
Confidence            345 9999999988654


No 147
>KOG2231|consensus
Probab=38.18  E-value=29  Score=24.91  Aligned_cols=75  Identities=17%  Similarity=0.196  Sum_probs=43.0

Q ss_pred             cccccchhhhhhhccccccccCeeecccccccccc------chhHHHHhhhhcC-CC----CceeCCCCCCCCCCchhHH
Q psy12015         20 FGVIRNSSVDKSLNTNVLTVHIDLKCDVCEKGYRY------KTGLWRHKKFECG-QE----PKYQCPHCPHRSKHKAHLT   88 (96)
Q Consensus        20 ~~~~~~~~~~~h~~~~~~~~~~~~~c~~c~~~f~~------~~~l~~h~~~~~~-~~----~~~~C~~c~~~f~~~~~l~   88 (96)
                      ..|.....|+.|+. ..|..-....|..-.+.|..      ...|..|+..... ++    . -.|..|...|-....+.
T Consensus       122 ~~~~s~~~Lk~H~~-~~H~~~~c~lC~~~~kif~~e~k~Yt~~el~~h~~~gd~d~~s~rGh-p~C~~C~~~fld~~el~  199 (669)
T KOG2231|consen  122 TEFKSVENLKNHMR-DQHKLHLCSLCLQNLKIFINERKLYTRAELNLHLMFGDPDDESCRGH-PLCKFCHERFLDDDELY  199 (669)
T ss_pred             cchhHHHHHHHHHH-HhhhhhccccccccceeeeeeeehehHHHHHHHHhcCCCccccccCC-ccchhhhhhhccHHHHH
Confidence            45567788899982 33433222233221122222      3445566543211 11    1 25888999999999999


Q ss_pred             HHHhhcCC
Q psy12015         89 THMAIKHY   96 (96)
Q Consensus        89 ~h~r~~h~   96 (96)
                      +|.+.+|+
T Consensus       200 rH~~~~h~  207 (669)
T KOG2231|consen  200 RHLRFDHE  207 (669)
T ss_pred             Hhhcccee
Confidence            99998775


No 148
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=38.08  E-value=25  Score=19.75  Aligned_cols=32  Identities=22%  Similarity=0.606  Sum_probs=18.7

Q ss_pred             eeeccccccccccchhHHHHhhhhcCCCCceeCCCCCCCC
Q psy12015         42 DLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHRS   81 (96)
Q Consensus        42 ~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f   81 (96)
                      .|.|..|+..+.      .+.+... ... |.|..|+..+
T Consensus       112 ~y~C~~C~~~~~------~~rr~~~-~~~-y~C~~C~g~l  143 (146)
T smart00731      112 PYRCTGCGQRYL------RVRRSNN-VSR-YRCGKCGGKL  143 (146)
T ss_pred             EEECCCCCCCCc------eEccccC-cce-EEcCCCCCEE
Confidence            678888886543      2222111 144 8888887654


No 149
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=37.54  E-value=31  Score=25.11  Aligned_cols=9  Identities=33%  Similarity=1.039  Sum_probs=6.3

Q ss_pred             eeCCCCCCC
Q psy12015         72 YQCPHCPHR   80 (96)
Q Consensus        72 ~~C~~c~~~   80 (96)
                      ..|+.||..
T Consensus       476 ~~Cp~Cgs~  484 (730)
T COG1198         476 QSCPECGSE  484 (730)
T ss_pred             CCCCCCCCC
Confidence            777777754


No 150
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=37.36  E-value=11  Score=22.59  Aligned_cols=27  Identities=19%  Similarity=0.377  Sum_probs=0.0

Q ss_pred             hcCCCCceeCCCCCC-CCCCchhHHHHHh
Q psy12015         65 ECGQEPKYQCPHCPH-RSKHKAHLTTHMA   92 (96)
Q Consensus        65 ~~~~~~~~~C~~c~~-~f~~~~~l~~h~r   92 (96)
                      |.-... |.|.+||. .+.=+.++.+|..
T Consensus        96 hGL~~e-y~CEICGN~~Y~GrkaFekHF~  123 (196)
T PF11931_consen   96 HGLGVE-YKCEICGNQSYKGRKAFEKHFQ  123 (196)
T ss_dssp             -----------------------------
T ss_pred             hCCCCe-eeeEeCCCcceecHHHHHHhcC
Confidence            333456 89999985 3445556666543


No 151
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=36.77  E-value=13  Score=21.41  Aligned_cols=12  Identities=17%  Similarity=0.484  Sum_probs=6.6

Q ss_pred             eccccccccccc
Q psy12015         44 KCDVCEKGYRYK   55 (96)
Q Consensus        44 ~c~~c~~~f~~~   55 (96)
                      +|..|+..|...
T Consensus        30 eC~~C~~RFTTf   41 (156)
T COG1327          30 ECLECGERFTTF   41 (156)
T ss_pred             cccccccccchh
Confidence            456666555543


No 152
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=35.81  E-value=26  Score=23.17  Aligned_cols=28  Identities=14%  Similarity=0.301  Sum_probs=19.3

Q ss_pred             hhhcCCCCceeCCCCC-CCCCCchhHHHHH
Q psy12015         63 KFECGQEPKYQCPHCP-HRSKHKAHLTTHM   91 (96)
Q Consensus        63 ~~~~~~~~~~~C~~c~-~~f~~~~~l~~h~   91 (96)
                      +.|.-++. |.|.+|| +.+.-+..+.+|.
T Consensus       367 klhgLd~e-f~CEICgNyvy~GR~~FdrHF  395 (470)
T COG5188         367 KLHGLDIE-FECEICGNYVYYGRDRFDRHF  395 (470)
T ss_pred             HhcCCCcc-eeeeecccccccchHHHHhhh
Confidence            45555677 9999998 5666666666654


No 153
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=35.62  E-value=32  Score=15.68  Aligned_cols=9  Identities=22%  Similarity=0.862  Sum_probs=7.0

Q ss_pred             eeCCCCCCC
Q psy12015         72 YQCPHCPHR   80 (96)
Q Consensus        72 ~~C~~c~~~   80 (96)
                      +.|..||..
T Consensus        38 ~~C~~Cgyt   46 (50)
T PRK00432         38 WHCGKCGYT   46 (50)
T ss_pred             EECCCcCCE
Confidence            888888864


No 154
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=35.53  E-value=32  Score=16.20  Aligned_cols=11  Identities=27%  Similarity=0.939  Sum_probs=5.6

Q ss_pred             cCeeecccccc
Q psy12015         40 HIDLKCDVCEK   50 (96)
Q Consensus        40 ~~~~~c~~c~~   50 (96)
                      ...|.|..||.
T Consensus        12 ~v~~~Cp~cGi   22 (55)
T PF13824_consen   12 HVNFECPDCGI   22 (55)
T ss_pred             ccCCcCCCCCC
Confidence            33455555554


No 155
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=35.40  E-value=32  Score=13.95  Aligned_cols=8  Identities=50%  Similarity=1.410  Sum_probs=5.4

Q ss_pred             eeCCCCCC
Q psy12015         72 YQCPHCPH   79 (96)
Q Consensus        72 ~~C~~c~~   79 (96)
                      +.|+.|+.
T Consensus        20 ~vCp~C~~   27 (30)
T PF08274_consen   20 LVCPECGH   27 (30)
T ss_dssp             EEETTTTE
T ss_pred             EeCCcccc
Confidence            77777764


No 156
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=35.10  E-value=52  Score=15.08  Aligned_cols=32  Identities=22%  Similarity=0.499  Sum_probs=18.0

Q ss_pred             eccccccccccchhHHHHhhhhcCCCCceeCCCCCCC
Q psy12015         44 KCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHR   80 (96)
Q Consensus        44 ~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~   80 (96)
                      .|..|.-......    ..+...+++. ..|+.||+.
T Consensus        24 ~C~gC~~~l~~~~----~~~i~~~~~i-~~Cp~CgRi   55 (56)
T PF02591_consen   24 TCSGCHMELPPQE----LNEIRKGDEI-VFCPNCGRI   55 (56)
T ss_pred             ccCCCCEEcCHHH----HHHHHcCCCe-EECcCCCcc
Confidence            5777765544322    1223334455 789999874


No 157
>PF12907 zf-met2:  Zinc-binding
Probab=34.86  E-value=15  Score=16.01  Aligned_cols=22  Identities=18%  Similarity=0.386  Sum_probs=9.4

Q ss_pred             eeCCCCCCCC---CCchhHHHHHhh
Q psy12015         72 YQCPHCPHRS---KHKAHLTTHMAI   93 (96)
Q Consensus        72 ~~C~~c~~~f---~~~~~l~~h~r~   93 (96)
                      +.|.+|...|   .....|..|...
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~en   26 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAEN   26 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHc
Confidence            3455554322   223345555443


No 158
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=33.66  E-value=23  Score=20.04  Aligned_cols=25  Identities=28%  Similarity=0.397  Sum_probs=19.7

Q ss_pred             eeccccccccccchhHHHHhhhhcCCCC
Q psy12015         43 LKCDVCEKGYRYKTGLWRHKKFECGQEP   70 (96)
Q Consensus        43 ~~c~~c~~~f~~~~~l~~h~~~~~~~~~   70 (96)
                      ..|-++|+.|.+   |.+|+.+|.|..|
T Consensus        77 IicLEDGkkfKS---LKRHL~t~~gmTP  101 (148)
T COG4957          77 IICLEDGKKFKS---LKRHLTTHYGLTP  101 (148)
T ss_pred             EEEeccCcchHH---HHHHHhcccCCCH
Confidence            458889998875   7899999888654


No 159
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=32.07  E-value=26  Score=14.30  Aligned_cols=10  Identities=30%  Similarity=0.859  Sum_probs=7.1

Q ss_pred             eeCCCCCCCC
Q psy12015         72 YQCPHCPHRS   81 (96)
Q Consensus        72 ~~C~~c~~~f   81 (96)
                      |+|..||...
T Consensus         5 ykC~~CGniv   14 (34)
T cd00974           5 YKCEICGNIV   14 (34)
T ss_pred             EEcCCCCcEE
Confidence            7788877654


No 160
>COG1779 C4-type Zn-finger protein [General function prediction only]
Probab=31.97  E-value=11  Score=22.67  Aligned_cols=40  Identities=23%  Similarity=0.391  Sum_probs=21.2

Q ss_pred             eeeccccccccccchhHHHHhhhhcCCCC--ceeCCCCCCCCCC
Q psy12015         42 DLKCDVCEKGYRYKTGLWRHKKFECGQEP--KYQCPHCPHRSKH   83 (96)
Q Consensus        42 ~~~c~~c~~~f~~~~~l~~h~~~~~~~~~--~~~C~~c~~~f~~   83 (96)
                      ...|+.|+..+.....+.  .-.+.|+.-  .+.|..||..+..
T Consensus        14 ~~~CPvCg~~l~~~~~~~--~IPyFG~V~i~t~~C~~CgYR~~D   55 (201)
T COG1779          14 RIDCPVCGGTLKAHMYLY--DIPYFGEVLISTGVCERCGYRSTD   55 (201)
T ss_pred             eecCCcccceeeEEEeee--cCCccceEEEEEEEccccCCcccc
Confidence            456888887544332211  113444221  2568888877654


No 161
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=31.91  E-value=27  Score=14.25  Aligned_cols=10  Identities=30%  Similarity=0.866  Sum_probs=7.1

Q ss_pred             eeCCCCCCCC
Q psy12015         72 YQCPHCPHRS   81 (96)
Q Consensus        72 ~~C~~c~~~f   81 (96)
                      |+|..||..+
T Consensus         8 ykC~~Cgniv   17 (34)
T TIGR00319         8 YKCEVCGNIV   17 (34)
T ss_pred             EEcCCCCcEE
Confidence            7788777654


No 162
>KOG0717|consensus
Probab=31.55  E-value=31  Score=23.73  Aligned_cols=22  Identities=23%  Similarity=0.391  Sum_probs=18.4

Q ss_pred             eeCCCCCCCCCCchhHHHHHhh
Q psy12015         72 YQCPHCPHRSKHKAHLTTHMAI   93 (96)
Q Consensus        72 ~~C~~c~~~f~~~~~l~~h~r~   93 (96)
                      +.|.+|.+.|.+...+..|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            6789999999999888888754


No 163
>PLN02748 tRNA dimethylallyltransferase
Probab=31.43  E-value=39  Score=23.21  Aligned_cols=24  Identities=17%  Similarity=0.318  Sum_probs=18.4

Q ss_pred             CCceeCCCCCC-CCCCchhHHHHHhh
Q psy12015         69 EPKYQCPHCPH-RSKHKAHLTTHMAI   93 (96)
Q Consensus        69 ~~~~~C~~c~~-~f~~~~~l~~h~r~   93 (96)
                      +. |.|..|++ .+.-...+..|.+.
T Consensus       417 ~~-~~Ce~C~~~~~~G~~eW~~Hlks  441 (468)
T PLN02748        417 TQ-YVCEACGNKVLRGAHEWEQHKQG  441 (468)
T ss_pred             cc-ccccCCCCcccCCHHHHHHHhcc
Confidence            44 78999997 68877778777764


No 164
>KOG0402|consensus
Probab=30.77  E-value=20  Score=18.39  Aligned_cols=31  Identities=23%  Similarity=0.547  Sum_probs=18.8

Q ss_pred             CeeeccccccccccchhHHHHhhhhcCCCCceeCCCCCCCCC
Q psy12015         41 IDLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHRSK   82 (96)
Q Consensus        41 ~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~   82 (96)
                      ..|.|..|++.-        -.+.-.|  . |.|..|.+.+.
T Consensus        35 aky~CsfCGK~~--------vKR~AvG--i-W~C~~C~kv~a   65 (92)
T KOG0402|consen   35 AKYTCSFCGKKT--------VKRKAVG--I-WKCGSCKKVVA   65 (92)
T ss_pred             hhhhhhhcchhh--------hhhhcee--E-EecCCccceec
Confidence            358899998632        1122223  4 88988877653


No 165
>KOG2071|consensus
Probab=30.64  E-value=35  Score=24.08  Aligned_cols=23  Identities=30%  Similarity=0.541  Sum_probs=18.0

Q ss_pred             eeCCCCCCCCCCchhHHHHHhhc
Q psy12015         72 YQCPHCPHRSKHKAHLTTHMAIK   94 (96)
Q Consensus        72 ~~C~~c~~~f~~~~~l~~h~r~~   94 (96)
                      -+|..||.+|........|+..|
T Consensus       419 nqC~~CG~R~~~~ee~sk~md~H  441 (579)
T KOG2071|consen  419 NQCKSCGLRFDDSEERSKHMDIH  441 (579)
T ss_pred             chhcccccccccchhhhhHhhhh
Confidence            68999999998887766665544


No 166
>KOG2482|consensus
Probab=30.06  E-value=33  Score=22.64  Aligned_cols=22  Identities=27%  Similarity=0.489  Sum_probs=20.1

Q ss_pred             eeCCCCCCCCCCchhHHHHHhh
Q psy12015         72 YQCPHCPHRSKHKAHLTTHMAI   93 (96)
Q Consensus        72 ~~C~~c~~~f~~~~~l~~h~r~   93 (96)
                      +.|-.|.+.|+.+..|..|+|-
T Consensus       196 ~~CLyCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  196 LRCLYCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             heeeeeccccCCcHHHHHHHHh
Confidence            6888999999999999999985


No 167
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=29.70  E-value=27  Score=19.71  Aligned_cols=24  Identities=13%  Similarity=0.195  Sum_probs=16.7

Q ss_pred             hhhhccccccccCeeeccccccccccc
Q psy12015         29 DKSLNTNVLTVHIDLKCDVCEKGYRYK   55 (96)
Q Consensus        29 ~~h~~~~~~~~~~~~~c~~c~~~f~~~   55 (96)
                      ..++  ..+.+ ++.+|..|+..|...
T Consensus       102 v~W~--~l~~g-~~~RCpeCG~~fkL~  125 (136)
T PF01215_consen  102 VIWF--WLHKG-KPQRCPECGQVFKLK  125 (136)
T ss_dssp             -EEE--EEETT-SEEEETTTEEEEEEE
T ss_pred             eEEE--EEeCC-CccCCCCCCeEEEEE
Confidence            3445  45555 589999999988754


No 168
>KOG4727|consensus
Probab=29.29  E-value=31  Score=20.36  Aligned_cols=21  Identities=24%  Similarity=0.547  Sum_probs=17.5

Q ss_pred             eeCCCCCCCCCCchhHHHHHh
Q psy12015         72 YQCPHCPHRSKHKAHLTTHMA   92 (96)
Q Consensus        72 ~~C~~c~~~f~~~~~l~~h~r   92 (96)
                      |-|.+|+-.|....++-.|+.
T Consensus        76 yyCdVCdcvvKDSinflDHiN   96 (193)
T KOG4727|consen   76 YYCDVCDCVVKDSINFLDHIN   96 (193)
T ss_pred             eeeeecceeehhhHHHHHHhc
Confidence            889999999988888877764


No 169
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=29.28  E-value=54  Score=13.96  Aligned_cols=18  Identities=22%  Similarity=0.353  Sum_probs=12.2

Q ss_pred             eeCCCCCCCCCCchhHHH
Q psy12015         72 YQCPHCPHRSKHKAHLTT   89 (96)
Q Consensus        72 ~~C~~c~~~f~~~~~l~~   89 (96)
                      ..|+.|+..+-....+.+
T Consensus        20 d~C~~C~G~W~d~~el~~   37 (41)
T PF13453_consen   20 DVCPSCGGIWFDAGELEK   37 (41)
T ss_pred             EECCCCCeEEccHHHHHH
Confidence            667777777766666544


No 170
>COG5216 Uncharacterized conserved protein [Function unknown]
Probab=29.15  E-value=26  Score=16.74  Aligned_cols=10  Identities=50%  Similarity=1.335  Sum_probs=6.8

Q ss_pred             eeCCCCCCCCC
Q psy12015         72 YQCPHCPHRSK   82 (96)
Q Consensus        72 ~~C~~c~~~f~   82 (96)
                      |.|+ ||..|.
T Consensus        23 yPCP-CGDRFe   32 (67)
T COG5216          23 YPCP-CGDRFE   32 (67)
T ss_pred             ecCC-CCCEeE
Confidence            6676 777764


No 171
>KOG1994|consensus
Probab=29.12  E-value=30  Score=21.45  Aligned_cols=21  Identities=24%  Similarity=0.534  Sum_probs=18.3

Q ss_pred             CeeeccccccccccchhHHHH
Q psy12015         41 IDLKCDVCEKGYRYKTGLWRH   61 (96)
Q Consensus        41 ~~~~c~~c~~~f~~~~~l~~h   61 (96)
                      ..|.|-.||..|....+|..|
T Consensus       238 eh~YC~fCG~~y~~~edl~eh  258 (268)
T KOG1994|consen  238 EHYYCFFCGIKYKDEEDLYEH  258 (268)
T ss_pred             cceEEEEeccccCCHHHHHHh
Confidence            468999999999999998765


No 172
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=28.82  E-value=27  Score=14.51  Aligned_cols=11  Identities=27%  Similarity=0.881  Sum_probs=7.4

Q ss_pred             eeCCCCCCCCC
Q psy12015         72 YQCPHCPHRSK   82 (96)
Q Consensus        72 ~~C~~c~~~f~   82 (96)
                      +.|+.|++.+.
T Consensus         5 ~~C~nC~R~v~   15 (33)
T PF08209_consen    5 VECPNCGRPVA   15 (33)
T ss_dssp             EE-TTTSSEEE
T ss_pred             EECCCCcCCcc
Confidence            78999987543


No 173
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=28.63  E-value=40  Score=16.25  Aligned_cols=44  Identities=20%  Similarity=0.328  Sum_probs=25.8

Q ss_pred             ccccccCeeeccccccccccchhHHHHhhhhcCCCCceeCCCCCCCCCC
Q psy12015         35 NVLTVHIDLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHRSKH   83 (96)
Q Consensus        35 ~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~   83 (96)
                      .++.+..++.|+.-+-.+....-+.     ..|++-.-.|+.|+..|..
T Consensus        17 ~I~~~~~~l~C~g~~~p~~HPrV~L-----~mg~~gev~CPYC~t~y~l   60 (62)
T COG4391          17 TIEIGDLPLMCPGPEPPNDHPRVFL-----DMGDEGEVVCPYCSTRYRL   60 (62)
T ss_pred             EEEeCCeeEEcCCCCCCCCCCEEEE-----EcCCCCcEecCccccEEEe
Confidence            6677888899987665443322111     1132222579999987753


No 174
>PRK11032 hypothetical protein; Provisional
Probab=28.51  E-value=42  Score=19.50  Aligned_cols=35  Identities=23%  Similarity=0.640  Sum_probs=20.7

Q ss_pred             ccccccC----eeeccccccccccchhHHHHhhhhcCCCCceeCCCCCCC
Q psy12015         35 NVLTVHI----DLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHR   80 (96)
Q Consensus        35 ~~~~~~~----~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~   80 (96)
                      ..++||.    .+.|..|+.....         .+.+..|  .|+.||..
T Consensus       113 ~Y~sGEvvg~G~LvC~~Cg~~~~~---------~~p~~i~--pCp~C~~~  151 (160)
T PRK11032        113 VYHSGEVVGLGNLVCEKCHHHLAF---------YTPEVLP--LCPKCGHD  151 (160)
T ss_pred             eeecceeeecceEEecCCCCEEEe---------cCCCcCC--CCCCCCCC
Confidence            4455554    4789999875322         1233233  69999865


No 175
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=27.95  E-value=25  Score=18.44  Aligned_cols=29  Identities=24%  Similarity=0.736  Sum_probs=19.5

Q ss_pred             cCeeeccccccccccchhHHHHhhhhcCCCCceeCCCCCC
Q psy12015         40 HIDLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPH   79 (96)
Q Consensus        40 ~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~   79 (96)
                      .+|..|..||..|.... +         ++| -.|+.|..
T Consensus        56 v~Pa~CkkCGfef~~~~-i---------k~p-SRCP~CKS   84 (97)
T COG3357          56 VRPARCKKCGFEFRDDK-I---------KKP-SRCPKCKS   84 (97)
T ss_pred             ecChhhcccCccccccc-c---------CCc-ccCCcchh
Confidence            35889999999886521 1         134 77887754


No 176
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=27.79  E-value=41  Score=14.44  Aligned_cols=10  Identities=50%  Similarity=1.192  Sum_probs=6.8

Q ss_pred             eeCCCCCCCC
Q psy12015         72 YQCPHCPHRS   81 (96)
Q Consensus        72 ~~C~~c~~~f   81 (96)
                      |.|..|+..+
T Consensus        29 y~C~~C~~~w   38 (40)
T smart00440       29 YVCTKCGHRW   38 (40)
T ss_pred             EEeCCCCCEe
Confidence            6777777654


No 177
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=27.73  E-value=28  Score=14.62  Aligned_cols=12  Identities=17%  Similarity=0.517  Sum_probs=5.1

Q ss_pred             eCCCCCCCCCCc
Q psy12015         73 QCPHCPHRSKHK   84 (96)
Q Consensus        73 ~C~~c~~~f~~~   84 (96)
                      .|..|++.|..+
T Consensus         5 ~C~eC~~~f~dS   16 (34)
T PF01286_consen    5 KCDECGKPFMDS   16 (34)
T ss_dssp             E-TTT--EES-S
T ss_pred             hHhHhCCHHHHH
Confidence            567777766554


No 178
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=27.30  E-value=79  Score=18.54  Aligned_cols=19  Identities=26%  Similarity=0.630  Sum_probs=14.5

Q ss_pred             eeCCCCCCCCCCchhHHHH
Q psy12015         72 YQCPHCPHRSKHKAHLTTH   90 (96)
Q Consensus        72 ~~C~~c~~~f~~~~~l~~h   90 (96)
                      +.|+.||+.|..-+.+.+-
T Consensus       131 ~~C~~CgkiYW~GsHw~~m  149 (165)
T COG1656         131 YRCPKCGKIYWKGSHWRRM  149 (165)
T ss_pred             eECCCCcccccCchHHHHH
Confidence            6799999998777665443


No 179
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=27.25  E-value=50  Score=22.40  Aligned_cols=29  Identities=21%  Similarity=0.690  Sum_probs=18.3

Q ss_pred             eccccccccccchhHHHHhhhhcCCCCceeCCCCCCCCCCc
Q psy12015         44 KCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHRSKHK   84 (96)
Q Consensus        44 ~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~   84 (96)
                      .|+.|+....+.           |..- |.|+.||..+...
T Consensus       352 ~Cp~Cg~~m~S~-----------G~~g-~rC~kCg~~~~~~  380 (421)
T COG1571         352 VCPRCGGRMKSA-----------GRNG-FRCKKCGTRARET  380 (421)
T ss_pred             CCCccCCchhhc-----------CCCC-cccccccccCCcc
Confidence            577887654432           2223 8888888876654


No 180
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=26.62  E-value=54  Score=17.53  Aligned_cols=9  Identities=22%  Similarity=0.715  Sum_probs=5.4

Q ss_pred             eeecccccc
Q psy12015         42 DLKCDVCEK   50 (96)
Q Consensus        42 ~~~c~~c~~   50 (96)
                      |-.|+-|+.
T Consensus         2 p~~CpYCg~   10 (102)
T PF11672_consen    2 PIICPYCGG   10 (102)
T ss_pred             CcccCCCCC
Confidence            455666665


No 181
>TIGR03829 YokU_near_AblA uncharacterized protein, YokU family. Members of this protein family occur in various species of the genus Bacillus, always next to the gene (kamA or ablA) for lysine 2,3-aminomutase. Members have a pair of CXXC motifs, and share homology to the amino-terminal region of a family of putative transcription factors for which the C-terminal is modeled by pfam01381, a helix-turn-helix domain model. This family, however, is shorter and lacks the helix-turn-helix region. The function of this protein family is unknown, but a regulatory role in compatible solute biosynthesis is suggested by local genome context.
Probab=26.28  E-value=48  Score=17.27  Aligned_cols=19  Identities=21%  Similarity=0.642  Sum_probs=12.0

Q ss_pred             CCceeCCCCCCCCCCchhH
Q psy12015         69 EPKYQCPHCPHRSKHKAHL   87 (96)
Q Consensus        69 ~~~~~C~~c~~~f~~~~~l   87 (96)
                      .|...|..||-.+-+...+
T Consensus        33 VPa~~C~~CGe~y~~dev~   51 (89)
T TIGR03829        33 TPSISCSHCGMEYQDDTTV   51 (89)
T ss_pred             CCcccccCCCcEeecHHHH
Confidence            4546777777776655444


No 182
>KOG4173|consensus
Probab=26.06  E-value=24  Score=21.52  Aligned_cols=19  Identities=21%  Similarity=0.501  Sum_probs=9.0

Q ss_pred             eCCCCCCCCCCchhHHHHH
Q psy12015         73 QCPHCPHRSKHKAHLTTHM   91 (96)
Q Consensus        73 ~C~~c~~~f~~~~~l~~h~   91 (96)
                      .|..|.+.|++.-.|..|+
T Consensus       108 sCs~C~r~~Pt~hLLd~HI  126 (253)
T KOG4173|consen  108 SCSFCKRAFPTGHLLDAHI  126 (253)
T ss_pred             hhHHHHHhCCchhhhhHHH
Confidence            3445555555544444443


No 183
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=26.00  E-value=33  Score=19.17  Aligned_cols=12  Identities=25%  Similarity=0.481  Sum_probs=8.1

Q ss_pred             eeCCCCCCCCCC
Q psy12015         72 YQCPHCPHRSKH   83 (96)
Q Consensus        72 ~~C~~c~~~f~~   83 (96)
                      --|..||+.|+.
T Consensus        69 sfchncgs~fpw   80 (160)
T COG4306          69 SFCHNCGSRFPW   80 (160)
T ss_pred             chhhcCCCCCCc
Confidence            456777777765


No 184
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=25.88  E-value=34  Score=19.58  Aligned_cols=13  Identities=23%  Similarity=0.480  Sum_probs=10.7

Q ss_pred             eeCCCCCCCCCCc
Q psy12015         72 YQCPHCPHRSKHK   84 (96)
Q Consensus        72 ~~C~~c~~~f~~~   84 (96)
                      -+|..||+.|.+.
T Consensus        29 ReC~~C~~RFTTy   41 (147)
T TIGR00244        29 RECLECHERFTTF   41 (147)
T ss_pred             ccCCccCCcccee
Confidence            5799999999775


No 185
>KOG2907|consensus
Probab=25.63  E-value=43  Score=18.31  Aligned_cols=40  Identities=23%  Similarity=0.359  Sum_probs=21.9

Q ss_pred             eeeccccccccccchhHHHHhhh-hcCCCCceeCCCCCCCCCC
Q psy12015         42 DLKCDVCEKGYRYKTGLWRHKKF-ECGQEPKYQCPHCPHRSKH   83 (96)
Q Consensus        42 ~~~c~~c~~~f~~~~~l~~h~~~-~~~~~~~~~C~~c~~~f~~   83 (96)
                      ...|+.|+..=-.  .-+..+|. ..|...=|.|..|+..|..
T Consensus        74 ~~kCpkCghe~m~--Y~T~QlRSADEGQTVFYTC~kC~~k~~e  114 (116)
T KOG2907|consen   74 KHKCPKCGHEEMS--YHTLQLRSADEGQTVFYTCPKCKYKFTE  114 (116)
T ss_pred             hccCcccCCchhh--hhhhhcccccCCceEEEEcCccceeeec
Confidence            4578888853111  11233343 3343333789999987765


No 186
>COG1379 PHP family phosphoesterase with a Zn ribbon [General function prediction only]
Probab=25.47  E-value=31  Score=22.69  Aligned_cols=10  Identities=30%  Similarity=1.155  Sum_probs=7.1

Q ss_pred             eeCCCCCCCC
Q psy12015         72 YQCPHCPHRS   81 (96)
Q Consensus        72 ~~C~~c~~~f   81 (96)
                      +.|+.||..+
T Consensus       266 wrCpkCGg~i  275 (403)
T COG1379         266 WRCPKCGGKI  275 (403)
T ss_pred             ccCcccccch
Confidence            6788887654


No 187
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=25.26  E-value=22  Score=20.54  Aligned_cols=13  Identities=15%  Similarity=0.370  Sum_probs=8.9

Q ss_pred             eeCCCCCCCCCCc
Q psy12015         72 YQCPHCPHRSKHK   84 (96)
Q Consensus        72 ~~C~~c~~~f~~~   84 (96)
                      .-|..||+.|+.-
T Consensus        69 sYC~~CGkpyPWt   81 (158)
T PF10083_consen   69 SYCHNCGKPYPWT   81 (158)
T ss_pred             hhHHhCCCCCchH
Confidence            6677777777653


No 188
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=25.20  E-value=23  Score=16.16  Aligned_cols=11  Identities=27%  Similarity=0.827  Sum_probs=6.0

Q ss_pred             CCCCCCCCCCc
Q psy12015         74 CPHCPHRSKHK   84 (96)
Q Consensus        74 C~~c~~~f~~~   84 (96)
                      |+.|++-|...
T Consensus        15 CpvCqRPFsWR   25 (54)
T COG4338          15 CPVCQRPFSWR   25 (54)
T ss_pred             hhhhcCchHHH
Confidence            55566555544


No 189
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=24.17  E-value=62  Score=17.56  Aligned_cols=12  Identities=25%  Similarity=0.634  Sum_probs=6.1

Q ss_pred             eeeccccccccc
Q psy12015         42 DLKCDVCEKGYR   53 (96)
Q Consensus        42 ~~~c~~c~~~f~   53 (96)
                      .+.|+.|+..+.
T Consensus        19 ~~iCpeC~~EW~   30 (109)
T TIGR00686        19 QLICPSCLYEWN   30 (109)
T ss_pred             eeECcccccccc
Confidence            355555554443


No 190
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=23.61  E-value=50  Score=12.28  Aligned_cols=6  Identities=50%  Similarity=1.658  Sum_probs=3.2

Q ss_pred             CCCCCC
Q psy12015         74 CPHCPH   79 (96)
Q Consensus        74 C~~c~~   79 (96)
                      |+.||.
T Consensus        16 C~~CG~   21 (23)
T PF13240_consen   16 CPNCGT   21 (23)
T ss_pred             hhhhCC
Confidence            555554


No 191
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=23.34  E-value=39  Score=20.93  Aligned_cols=16  Identities=13%  Similarity=0.436  Sum_probs=13.0

Q ss_pred             cCeeeccccccccccc
Q psy12015         40 HIDLKCDVCEKGYRYK   55 (96)
Q Consensus        40 ~~~~~c~~c~~~f~~~   55 (96)
                      .++.+|..||..|...
T Consensus       179 GkpqRCpECGqVFKLV  194 (268)
T PTZ00043        179 GFLYRCGECDQIFMLV  194 (268)
T ss_pred             CCCccCCCCCcEEEEE
Confidence            4589999999988753


No 192
>PF14447 Prok-RING_4:  Prokaryotic RING finger family 4
Probab=23.25  E-value=52  Score=15.51  Aligned_cols=12  Identities=25%  Similarity=0.708  Sum_probs=7.9

Q ss_pred             eCCCCCCCCCCc
Q psy12015         73 QCPHCPHRSKHK   84 (96)
Q Consensus        73 ~C~~c~~~f~~~   84 (96)
                      .|+.|++.|...
T Consensus        41 gCPfC~~~~~~~   52 (55)
T PF14447_consen   41 GCPFCGTPFEFD   52 (55)
T ss_pred             CCCCCCCcccCC
Confidence            477787776544


No 193
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=23.15  E-value=69  Score=17.03  Aligned_cols=35  Identities=14%  Similarity=0.326  Sum_probs=19.6

Q ss_pred             CeeeccccccccccchhHHHHhhhhcCCCCceeCCCCCCCCCC
Q psy12015         41 IDLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHRSKH   83 (96)
Q Consensus        41 ~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~   83 (96)
                      .-+.|..|+. ....-.+..      +.-. ..|..||..+..
T Consensus        20 t~f~CP~Cge-~~v~v~~~k------~~~h-~~C~~CG~y~~~   54 (99)
T PRK14892         20 KIFECPRCGK-VSISVKIKK------NIAI-ITCGNCGLYTEF   54 (99)
T ss_pred             cEeECCCCCC-eEeeeecCC------Ccce-EECCCCCCccCE
Confidence            4688999984 222211211      3223 679999876544


No 194
>PHA02998 RNA polymerase subunit; Provisional
Probab=22.98  E-value=36  Score=20.26  Aligned_cols=39  Identities=18%  Similarity=0.415  Sum_probs=20.8

Q ss_pred             eeeccccccccccchhHHHHhhhhcCCCCc---eeCCCCCCCCCCc
Q psy12015         42 DLKCDVCEKGYRYKTGLWRHKKFECGQEPK---YQCPHCPHRSKHK   84 (96)
Q Consensus        42 ~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~---~~C~~c~~~f~~~   84 (96)
                      ...|+.|+..=....  ..+.|  ..++|+   |.|..||..|.-+
T Consensus       143 ~v~CPkCg~~~A~f~--qlQTR--SADEPmT~FYkC~~CG~~wkpp  184 (195)
T PHA02998        143 NTPCPNCKSKNTTPM--MIQTR--AADEPPLVRHACRDCKKHFKPP  184 (195)
T ss_pred             CCCCCCCCCCceEEE--EEeec--cCCCCceEEEEcCCCCCccCCc
Confidence            356888875322211  12222  333332   7899999877544


No 195
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=22.11  E-value=1.2e+02  Score=18.39  Aligned_cols=16  Identities=31%  Similarity=0.746  Sum_probs=10.6

Q ss_pred             CCCCceeCCCCCCCCC
Q psy12015         67 GQEPKYQCPHCPHRSK   82 (96)
Q Consensus        67 ~~~~~~~C~~c~~~f~   82 (96)
                      |..+...|..||..++
T Consensus        26 g~~~lvrC~eCG~V~~   41 (201)
T COG1326          26 GREPLVRCEECGTVHP   41 (201)
T ss_pred             CCceEEEccCCCcEee
Confidence            3344578888887663


No 196
>PF14369 zf-RING_3:  zinc-finger
Probab=21.94  E-value=49  Score=13.80  Aligned_cols=32  Identities=19%  Similarity=0.424  Sum_probs=17.5

Q ss_pred             eeeccccccccccchhHHHHhhhhcCCCCceeCCCCCCCCCC
Q psy12015         42 DLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHRSKH   83 (96)
Q Consensus        42 ~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~   83 (96)
                      .|.|..|.+.......         +... ..|+.|+..|..
T Consensus         2 ~ywCh~C~~~V~~~~~---------~~~~-~~CP~C~~gFvE   33 (35)
T PF14369_consen    2 RYWCHQCNRFVRIAPS---------PDSD-VACPRCHGGFVE   33 (35)
T ss_pred             CEeCccCCCEeEeCcC---------CCCC-cCCcCCCCcEeE
Confidence            4667777765432111         1122 248889887753


No 197
>PF05876 Terminase_GpA:  Phage terminase large subunit (GpA);  InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry consists of several phage terminase large subunit proteins as well as related sequences from several bacterial species. The DNA packaging enzyme of bacteriophage lambda, terminase, is a heteromultimer composed of a small subunit, gpNu1, and a large subunit, gpA, products of the Nu1 and A genes, respectively. Terminase is involved in the site-specific binding and cutting of the DNA in the initial stages of packaging. It is now known that gpA is actively involved in late stages of packaging, including DNA translocation, and that this enzyme contains separate functional domains for its early and late packaging activities [].
Probab=21.72  E-value=46  Score=23.30  Aligned_cols=41  Identities=22%  Similarity=0.400  Sum_probs=22.9

Q ss_pred             eeccccccccccch-hHHHHhhhhcCCCCceeCCCCCCCCCCc
Q psy12015         43 LKCDVCEKGYRYKT-GLWRHKKFECGQEPKYQCPHCPHRSKHK   84 (96)
Q Consensus        43 ~~c~~c~~~f~~~~-~l~~h~~~~~~~~~~~~C~~c~~~f~~~   84 (96)
                      ..|+.|+..+.... ++............ |.|+.||......
T Consensus       201 vpCPhCg~~~~l~~~~l~w~~~~~~~~a~-y~C~~Cg~~i~e~  242 (557)
T PF05876_consen  201 VPCPHCGEEQVLEWENLKWDKGEAPETAR-YVCPHCGCEIEEH  242 (557)
T ss_pred             ccCCCCCCCccccccceeecCCCCccceE-EECCCCcCCCCHH
Confidence            45999998766542 22221000112233 8999999876543


No 198
>KOG0978|consensus
Probab=21.66  E-value=38  Score=24.51  Aligned_cols=17  Identities=18%  Similarity=0.399  Sum_probs=13.2

Q ss_pred             eeCCCCCCCCCCchhHH
Q psy12015         72 YQCPHCPHRSKHKAHLT   88 (96)
Q Consensus        72 ~~C~~c~~~f~~~~~l~   88 (96)
                      -.||.|+..|...+...
T Consensus       679 RKCP~Cn~aFganDv~~  695 (698)
T KOG0978|consen  679 RKCPKCNAAFGANDVHR  695 (698)
T ss_pred             CCCCCCCCCCCcccccc
Confidence            46999999998776543


No 199
>PRK10220 hypothetical protein; Provisional
Probab=21.43  E-value=88  Score=17.03  Aligned_cols=12  Identities=17%  Similarity=0.542  Sum_probs=6.3

Q ss_pred             eeeccccccccc
Q psy12015         42 DLKCDVCEKGYR   53 (96)
Q Consensus        42 ~~~c~~c~~~f~   53 (96)
                      .+.|+.|+..+.
T Consensus        20 ~~vCpeC~hEW~   31 (111)
T PRK10220         20 MYICPECAHEWN   31 (111)
T ss_pred             eEECCcccCcCC
Confidence            455666655443


No 200
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=21.33  E-value=77  Score=18.78  Aligned_cols=36  Identities=25%  Similarity=0.663  Sum_probs=23.1

Q ss_pred             cccCeeeccccccccccchhHHHHhhhhcCCCCceeCCCCCCCCCC
Q psy12015         38 TVHIDLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHRSKH   83 (96)
Q Consensus        38 ~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~   83 (96)
                      +++.-|.|+.|.-.++.....      ..+    |.|+.||.....
T Consensus       109 ~~~~~y~C~~~~~r~sfdeA~------~~~----F~Cp~Cg~~L~~  144 (176)
T COG1675         109 TENNYYVCPNCHVKYSFDEAM------ELG----FTCPKCGEDLEE  144 (176)
T ss_pred             ccCCceeCCCCCCcccHHHHH------HhC----CCCCCCCchhhh
Confidence            345568898887776654332      223    889999976433


No 201
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=21.25  E-value=56  Score=14.42  Aligned_cols=12  Identities=17%  Similarity=0.564  Sum_probs=9.4

Q ss_pred             eeCCCCCCCCCC
Q psy12015         72 YQCPHCPHRSKH   83 (96)
Q Consensus        72 ~~C~~c~~~f~~   83 (96)
                      +.|+.||..+.-
T Consensus        21 ~vC~~Cg~~~~~   32 (52)
T smart00661       21 FVCRKCGYEEPI   32 (52)
T ss_pred             EECCcCCCeEEC
Confidence            899999976544


No 202
>KOG0227|consensus
Probab=21.22  E-value=54  Score=19.80  Aligned_cols=16  Identities=19%  Similarity=0.594  Sum_probs=7.1

Q ss_pred             eeCCCCCCCCCCchhH
Q psy12015         72 YQCPHCPHRSKHKAHL   87 (96)
Q Consensus        72 ~~C~~c~~~f~~~~~l   87 (96)
                      |+|..|...-.+..+.
T Consensus        54 yeCkLClT~H~ne~Sy   69 (222)
T KOG0227|consen   54 YECKLCLTLHNNEGSY   69 (222)
T ss_pred             eeehhhhhhhcchhhh
Confidence            4555554443333333


No 203
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=21.16  E-value=64  Score=20.27  Aligned_cols=14  Identities=21%  Similarity=0.788  Sum_probs=9.4

Q ss_pred             CCceeCCCCCCCCCC
Q psy12015         69 EPKYQCPHCPHRSKH   83 (96)
Q Consensus        69 ~~~~~C~~c~~~f~~   83 (96)
                      +. |.|+.||..+..
T Consensus       321 r~-~~C~~cg~~~~r  334 (364)
T COG0675         321 RL-FKCPRCGFVHDR  334 (364)
T ss_pred             ee-EECCCCCCeehh
Confidence            44 888888875433


No 204
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=21.02  E-value=46  Score=18.01  Aligned_cols=25  Identities=24%  Similarity=0.290  Sum_probs=20.0

Q ss_pred             ccCeeeccccccccccchhHHHHhh
Q psy12015         39 VHIDLKCDVCEKGYRYKTGLWRHKK   63 (96)
Q Consensus        39 ~~~~~~c~~c~~~f~~~~~l~~h~~   63 (96)
                      |--.+.|-.|.+.|.....|..|.+
T Consensus        52 GlGqhYCieCaryf~t~~aL~~Hkk   76 (126)
T COG5112          52 GLGQHYCIECARYFITEKALMEHKK   76 (126)
T ss_pred             CCceeeeehhHHHHHHHHHHHHHhc
Confidence            3335779999999999888888876


No 205
>PRK12722 transcriptional activator FlhC; Provisional
Probab=20.93  E-value=76  Score=19.01  Aligned_cols=29  Identities=14%  Similarity=0.369  Sum_probs=17.9

Q ss_pred             eeeccccccccccchhHHHHhhhhcCCCCceeCCCCCC
Q psy12015         42 DLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPH   79 (96)
Q Consensus        42 ~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~   79 (96)
                      ...|..|+..|.....        ..... |.|+.|..
T Consensus       134 l~~C~~Cgg~fv~~~~--------e~~~~-f~CplC~~  162 (187)
T PRK12722        134 LSSCNCCGGHFVTHAH--------DPVGS-FVCGLCQP  162 (187)
T ss_pred             eccCCCCCCCeecccc--------ccCCC-CcCCCCCC
Confidence            3558888887764321        22234 88988864


No 206
>KOG3507|consensus
Probab=20.28  E-value=1e+02  Score=14.81  Aligned_cols=29  Identities=21%  Similarity=0.547  Sum_probs=18.0

Q ss_pred             cCeeeccccccccccchhHHHHhhhhcCCCCceeCCCCCCC
Q psy12015         40 HIDLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPHR   80 (96)
Q Consensus        40 ~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~   80 (96)
                      ...|.|..|+..-.          ...+ .. +.|..||..
T Consensus        18 ~miYiCgdC~~en~----------lk~~-D~-irCReCG~R   46 (62)
T KOG3507|consen   18 TMIYICGDCGQENT----------LKRG-DV-IRCRECGYR   46 (62)
T ss_pred             cEEEEecccccccc----------ccCC-Cc-EehhhcchH
Confidence            34688888875321          1122 45 899999864


No 207
>COG0846 SIR2 NAD-dependent protein deacetylases, SIR2 family [Transcription]
Probab=20.24  E-value=96  Score=19.43  Aligned_cols=36  Identities=22%  Similarity=0.521  Sum_probs=20.4

Q ss_pred             ccCeeeccccccccccchhHHHHhhhhcCCCCceeCCCCCC
Q psy12015         39 VHIDLKCDVCEKGYRYKTGLWRHKKFECGQEPKYQCPHCPH   79 (96)
Q Consensus        39 ~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~   79 (96)
                      .-....|..|+..+.... +...  ...+ .+ -.|+.||.
T Consensus       119 sl~~~~C~~C~~~~~~~~-~~~~--~~~~-~~-p~C~~Cg~  154 (250)
T COG0846         119 SLKRVRCSKCGNQYYDED-VIKF--IEDG-LI-PRCPKCGG  154 (250)
T ss_pred             ceeeeEeCCCcCccchhh-hhhh--cccC-CC-CcCccCCC
Confidence            345678999988776433 1111  1122 23 37888987


No 208
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=20.07  E-value=1e+02  Score=19.90  Aligned_cols=21  Identities=33%  Similarity=0.649  Sum_probs=17.5

Q ss_pred             eeCCCCCCCCCCchhHHHHHh
Q psy12015         72 YQCPHCPHRSKHKAHLTTHMA   92 (96)
Q Consensus        72 ~~C~~c~~~f~~~~~l~~h~r   92 (96)
                      |.|..|-+-|.....+.+|+.
T Consensus        49 yiCe~Clky~~~~~~l~~H~~   69 (290)
T PLN03238         49 YICEYCLKYMRKKKSLLRHLA   69 (290)
T ss_pred             EEcCCCcchhCCHHHHHHHHH
Confidence            888888888888888888875


Done!