Query         psy12016
Match_columns 111
No_of_seqs    117 out of 2256
Neff          11.4
Searched_HMMs 46136
Date          Fri Aug 16 16:30:40 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12016.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12016hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.9 4.7E-27   1E-31  137.5   4.9  101    2-111   141-244 (279)
  2 KOG2462|consensus               99.9   1E-22 2.2E-27  119.5   4.2   93    3-104   173-265 (279)
  3 KOG3623|consensus               99.7 5.2E-18 1.1E-22  110.9   1.6   82   15-103   890-971 (1007)
  4 KOG1074|consensus               99.7 1.9E-17 4.2E-22  109.3   3.5   56   54-110   880-935 (958)
  5 KOG3576|consensus               99.7 2.3E-17 4.9E-22   93.7   1.6   85   16-107   114-198 (267)
  6 KOG1074|consensus               99.6 1.2E-16 2.7E-21  105.6   2.5   53   54-107   606-658 (958)
  7 KOG3623|consensus               99.6 1.8E-15 3.8E-20   99.3   2.7   99    4-103   223-330 (1007)
  8 KOG3608|consensus               99.5 3.1E-14 6.6E-19   87.0   5.7  104    3-106   191-316 (467)
  9 KOG3576|consensus               99.5 5.7E-15 1.2E-19   84.1   2.4  101    4-110   130-240 (267)
 10 PHA00733 hypothetical protein   99.3 1.5E-12 3.2E-17   70.6   3.9   84   15-107    36-124 (128)
 11 KOG3608|consensus               99.2 3.3E-11 7.3E-16   74.0   6.0   91    3-103   249-342 (467)
 12 PHA02768 hypothetical protein;  99.1 8.4E-11 1.8E-15   53.9   1.6   41   54-97      6-46  (55)
 13 PHA02768 hypothetical protein;  99.1 1.2E-10 2.5E-15   53.5   2.0   44   19-70      5-48  (55)
 14 PHA00733 hypothetical protein   99.0   1E-09 2.2E-14   59.6   5.0   64    6-78     61-124 (128)
 15 PLN03086 PRLI-interacting fact  99.0 1.5E-09 3.2E-14   71.2   5.7   63   18-92    452-514 (567)
 16 PLN03086 PRLI-interacting fact  98.9 4.1E-09 8.8E-14   69.2   6.5   90    5-107   466-565 (567)
 17 PHA00616 hypothetical protein   98.9 7.5E-10 1.6E-14   48.5   1.6   29   82-110     1-29  (44)
 18 KOG3993|consensus               98.8 4.3E-10 9.3E-15   70.5  -0.3   25   82-106   356-380 (500)
 19 KOG3993|consensus               98.8 2.7E-09 5.8E-14   67.1   2.3   77    1-77    277-380 (500)
 20 PF13465 zf-H2C2_2:  Zinc-finge  98.8 4.9E-09 1.1E-13   41.3   2.1   24    7-30      2-25  (26)
 21 PF13465 zf-H2C2_2:  Zinc-finge  98.8 4.3E-09 9.3E-14   41.5   1.8   24   69-93      2-25  (26)
 22 PHA00616 hypothetical protein   98.6 3.2E-08   7E-13   43.4   1.5   29   19-47      1-29  (44)
 23 PHA00732 hypothetical protein   98.5 1.4E-07 2.9E-12   47.1   2.8   46   19-76      1-47  (79)
 24 PHA00732 hypothetical protein   98.5 1.3E-07 2.8E-12   47.2   2.5   46   54-105     2-47  (79)
 25 PF05605 zf-Di19:  Drought indu  98.5 3.4E-07 7.4E-12   42.5   3.6   51   54-107     3-54  (54)
 26 PF00096 zf-C2H2:  Zinc finger,  98.4 3.7E-07 8.1E-12   34.8   1.9   23   83-105     1-23  (23)
 27 PF13894 zf-C2H2_4:  C2H2-type   98.3 9.3E-07   2E-11   33.8   2.0   24   83-106     1-24  (24)
 28 PF00096 zf-C2H2:  Zinc finger,  98.2 1.2E-06 2.6E-11   33.3   2.2   23   20-42      1-23  (23)
 29 PF09237 GAGA:  GAGA factor;  I  98.2 1.8E-06   4E-11   38.7   2.5   31   80-110    22-52  (54)
 30 PF13912 zf-C2H2_6:  C2H2-type   98.2 9.4E-07   2E-11   35.0   1.1   26   82-107     1-26  (27)
 31 PF05605 zf-Di19:  Drought indu  98.0 1.5E-05 3.3E-10   36.9   4.1   51   19-77      2-53  (54)
 32 PF13912 zf-C2H2_6:  C2H2-type   98.0 4.2E-06 9.2E-11   33.0   1.9   25   19-43      1-25  (27)
 33 PF13894 zf-C2H2_4:  C2H2-type   97.9 1.6E-05 3.5E-10   30.1   2.5   23   20-42      1-23  (24)
 34 PF12756 zf-C2H2_2:  C2H2 type   97.8 1.4E-05 3.1E-10   41.4   2.3   73   21-105     1-73  (100)
 35 COG5189 SFP1 Putative transcri  97.8 6.6E-06 1.4E-10   50.6   0.6   70   17-103   347-419 (423)
 36 smart00355 ZnF_C2H2 zinc finge  97.7 5.7E-05 1.2E-09   29.0   2.2   24   83-106     1-24  (26)
 37 PF13909 zf-H2C2_5:  C2H2-type   97.5 0.00011 2.4E-09   28.0   2.2   24   83-107     1-24  (24)
 38 PF09237 GAGA:  GAGA factor;  I  97.5 0.00023 4.9E-09   32.1   2.9   30   16-45     21-50  (54)
 39 PF12874 zf-met:  Zinc-finger o  97.4 0.00015 3.3E-09   27.9   1.9   23   20-42      1-23  (25)
 40 smart00355 ZnF_C2H2 zinc finge  97.4 0.00019 4.2E-09   27.4   2.2   23   20-42      1-23  (26)
 41 PF12874 zf-met:  Zinc-finger o  97.3 0.00012 2.5E-09   28.2   1.2   23   83-105     1-23  (25)
 42 PF12171 zf-C2H2_jaz:  Zinc-fin  97.0 0.00033 7.2E-09   27.5   0.9   22   20-41      2-23  (27)
 43 PF12171 zf-C2H2_jaz:  Zinc-fin  97.0 0.00013 2.8E-09   28.7  -0.4   21   83-103     2-22  (27)
 44 PF13909 zf-H2C2_5:  C2H2-type   96.9  0.0016 3.6E-08   24.7   2.4   22   20-42      1-22  (24)
 45 PRK04860 hypothetical protein;  96.8  0.0011 2.4E-08   37.6   2.3   38   53-95    119-156 (160)
 46 PRK04860 hypothetical protein;  96.8   0.001 2.2E-08   37.7   1.9   26   82-111   119-144 (160)
 47 PF13913 zf-C2HC_2:  zinc-finge  96.5  0.0029 6.4E-08   24.4   1.8   22   83-105     3-24  (25)
 48 smart00451 ZnF_U1 U1-like zinc  96.4  0.0043 9.4E-08   25.7   2.1   23   19-41      3-25  (35)
 49 smart00451 ZnF_U1 U1-like zinc  96.2  0.0037   8E-08   25.9   1.4   22   82-103     3-24  (35)
 50 KOG1146|consensus               95.6  0.0092   2E-07   43.7   2.0   78   17-105   463-541 (1406)
 51 COG4049 Uncharacterized protei  94.9   0.017 3.6E-07   26.6   1.2   29   15-43     13-41  (65)
 52 cd00350 rubredoxin_like Rubred  94.7   0.026 5.6E-07   23.2   1.4   24   54-90      2-25  (33)
 53 COG4049 Uncharacterized protei  94.3   0.026 5.6E-07   26.0   1.1   25   82-106    17-41  (65)
 54 PF12756 zf-C2H2_2:  C2H2 type   94.0   0.095 2.1E-06   26.8   3.1   23   54-76     51-73  (100)
 55 KOG4173|consensus               92.9   0.058 1.3E-06   31.8   1.2   79   19-106    79-170 (253)
 56 COG1592 Rubrerythrin [Energy p  92.7   0.085 1.8E-06   30.2   1.7   23   53-89    134-156 (166)
 57 KOG2893|consensus               92.6   0.045 9.8E-07   33.1   0.5   47   20-76     11-58  (341)
 58 KOG2893|consensus               92.2   0.037   8E-07   33.4  -0.2   41   56-101    13-53  (341)
 59 cd00729 rubredoxin_SM Rubredox  92.2    0.13 2.8E-06   21.3   1.5   24   54-90      3-26  (34)
 60 KOG2231|consensus               91.9    0.52 1.1E-05   33.0   4.8   48   54-106   183-236 (669)
 61 PF09986 DUF2225:  Uncharacteri  91.8   0.056 1.2E-06   32.3   0.2   12   83-94     49-60  (214)
 62 COG5048 FOG: Zn-finger [Genera  91.6   0.059 1.3E-06   34.8   0.2   54   54-108   290-349 (467)
 63 PF12013 DUF3505:  Protein of u  91.2    0.46 9.9E-06   25.2   3.3   26   82-107    80-109 (109)
 64 TIGR00373 conserved hypothetic  91.1     0.3 6.5E-06   27.8   2.7   35   15-64    105-139 (158)
 65 PF09538 FYDLN_acid:  Protein o  90.8    0.21 4.5E-06   26.6   1.8   13   82-94     26-38  (108)
 66 PF04959 ARS2:  Arsenite-resist  90.8    0.11 2.4E-06   31.0   0.8   28   82-109    77-104 (214)
 67 COG2888 Predicted Zn-ribbon RN  90.7    0.18 3.9E-06   23.6   1.3   31   54-90     28-58  (61)
 68 PRK06266 transcription initiat  90.3    0.39 8.4E-06   28.0   2.7   35   16-65    114-148 (178)
 69 smart00659 RPOLCX RNA polymera  90.0    0.36 7.8E-06   21.3   1.9   12   20-31      3-14  (44)
 70 PF13719 zinc_ribbon_5:  zinc-r  89.7    0.36 7.8E-06   20.3   1.7   33   54-92      3-35  (37)
 71 TIGR02605 CxxC_CxxC_SSSS putat  89.7    0.15 3.3E-06   23.1   0.6   13   20-32      6-18  (52)
 72 TIGR02098 MJ0042_CXXC MJ0042 f  89.4     0.4 8.7E-06   20.1   1.8   13   54-66      3-15  (38)
 73 COG5048 FOG: Zn-finger [Genera  89.4    0.15 3.2E-06   33.0   0.6   62   18-86    288-355 (467)
 74 smart00531 TFIIE Transcription  89.1    0.61 1.3E-05   26.2   2.8   13   54-66    100-112 (147)
 75 KOG2482|consensus               89.0    0.63 1.4E-05   29.9   3.1   23   19-41    195-217 (423)
 76 COG5236 Uncharacterized conser  89.0     0.4 8.7E-06   30.8   2.2   23   54-76    221-243 (493)
 77 PF05443 ROS_MUCR:  ROS/MUCR tr  88.9    0.27 5.8E-06   27.2   1.3   24   82-108    72-95  (132)
 78 smart00834 CxxC_CXXC_SSSS Puta  88.7    0.22 4.8E-06   21.2   0.8   12   20-31      6-17  (41)
 79 PF09723 Zn-ribbon_8:  Zinc rib  88.4    0.12 2.5E-06   22.5  -0.3   14   20-33      6-19  (42)
 80 PF13717 zinc_ribbon_4:  zinc-r  88.1    0.65 1.4E-05   19.4   2.0   33   54-92      3-35  (36)
 81 smart00614 ZnF_BED BED zinc fi  86.9    0.72 1.6E-05   20.7   1.9   23   82-104    18-45  (50)
 82 COG1997 RPL43A Ribosomal prote  86.7    0.37 8.1E-06   24.5   0.9   31   54-95     36-66  (89)
 83 TIGR00622 ssl1 transcription f  86.7       2 4.3E-05   23.1   3.7   86   17-105    13-104 (112)
 84 KOG2186|consensus               86.2    0.59 1.3E-05   28.7   1.7   47   19-74      3-49  (276)
 85 PRK00464 nrdR transcriptional   85.4    0.37 8.1E-06   27.4   0.6   15   54-68     29-43  (154)
 86 KOG2186|consensus               85.2    0.47   1E-05   29.1   1.0   46   54-103     4-49  (276)
 87 PF02892 zf-BED:  BED zinc fing  84.9     1.2 2.7E-05   19.3   2.1   23   82-104    16-42  (45)
 88 KOG4167|consensus               83.8    0.31 6.8E-06   34.3  -0.1   29   17-45    790-818 (907)
 89 COG5189 SFP1 Putative transcri  83.6    0.64 1.4E-05   29.6   1.2   25   81-105   348-374 (423)
 90 PRK00398 rpoP DNA-directed RNA  83.3    0.53 1.1E-05   20.8   0.5   14   19-32      3-16  (46)
 91 KOG2482|consensus               83.1       2 4.4E-05   27.7   3.2   22   82-103   195-216 (423)
 92 KOG2231|consensus               83.0     2.1 4.6E-05   30.2   3.5   69   20-103   183-260 (669)
 93 PRK14890 putative Zn-ribbon RN  82.7    0.81 1.7E-05   21.5   1.0   30   54-90     26-56  (59)
 94 PF12013 DUF3505:  Protein of u  81.0     1.6 3.5E-05   23.1   2.0   27   52-78     79-109 (109)
 95 PF00301 Rubredoxin:  Rubredoxi  80.6    0.71 1.5E-05   20.7   0.4   12   20-31      2-13  (47)
 96 PF03604 DNA_RNApol_7kD:  DNA d  80.0     1.7 3.7E-05   17.7   1.4   11   20-30      1-11  (32)
 97 PF08790 zf-LYAR:  LYAR-type C2  80.0    0.49 1.1E-05   18.7  -0.1   17   84-101     2-18  (28)
 98 TIGR02300 FYDLN_acid conserved  80.0     1.3 2.8E-05   24.3   1.4   33   20-69     10-42  (129)
 99 COG4957 Predicted transcriptio  79.4     1.1 2.3E-05   24.9   0.9   22   83-107    77-98  (148)
100 COG4888 Uncharacterized Zn rib  79.3    0.66 1.4E-05   24.3   0.1   13   50-62     19-31  (104)
101 PRK03824 hypA hydrogenase nick  79.2     1.4 3.1E-05   24.4   1.5   15   18-32     69-83  (135)
102 smart00734 ZnF_Rad18 Rad18-lik  78.9     2.4 5.2E-05   16.3   1.6   19   21-40      3-21  (26)
103 KOG2785|consensus               78.6     4.1   9E-05   26.7   3.4   58   17-74    164-241 (390)
104 cd00730 rubredoxin Rubredoxin;  78.2    0.78 1.7E-05   20.8   0.2    8   82-89     34-41  (50)
105 PF04959 ARS2:  Arsenite-resist  77.0     2.7 5.9E-05   25.3   2.2   26   16-41     74-99  (214)
106 PF14353 CpXC:  CpXC protein     76.6     1.1 2.5E-05   24.4   0.6   21   54-74     39-59  (128)
107 KOG3408|consensus               75.8     1.6 3.6E-05   23.7   1.0   22   82-103    57-78  (129)
108 COG5151 SSL1 RNA polymerase II  75.6     4.2   9E-05   26.0   2.8   48   55-105   364-411 (421)
109 COG1996 RPC10 DNA-directed RNA  75.3     2.5 5.4E-05   19.1   1.4   10   20-29      7-16  (49)
110 PF01780 Ribosomal_L37ae:  Ribo  74.8       1 2.2E-05   23.2   0.1   31   54-95     36-66  (90)
111 PHA00626 hypothetical protein   74.7     2.7 5.8E-05   19.6   1.4   17   17-33     21-37  (59)
112 PF10571 UPF0547:  Uncharacteri  74.2     1.8 3.8E-05   16.7   0.7   10   21-30     16-25  (26)
113 TIGR00280 L37a ribosomal prote  73.5     1.4 2.9E-05   22.8   0.3   31   54-95     36-66  (91)
114 PTZ00255 60S ribosomal protein  73.5     1.5 3.2E-05   22.6   0.5   31   54-95     37-67  (90)
115 COG1198 PriA Primosomal protei  73.4     1.9 4.1E-05   30.8   1.1   10   82-91    475-484 (730)
116 smart00154 ZnF_AN1 AN1-like Zi  72.9     2.5 5.4E-05   18.0   1.1   15   19-33     12-26  (39)
117 PF09845 DUF2072:  Zn-ribbon co  72.8     2.8 6.2E-05   23.2   1.5   15   19-33      1-15  (131)
118 KOG2785|consensus               72.7     4.6  0.0001   26.5   2.6   50   54-103   167-241 (390)
119 PF08274 PhnA_Zn_Ribbon:  PhnA   72.3       2 4.3E-05   17.3   0.6    9   82-90     19-27  (30)
120 PF07975 C1_4:  TFIIH C1-like d  72.1     1.6 3.4E-05   20.0   0.3   26   17-42     19-44  (51)
121 PF15135 UPF0515:  Uncharacteri  71.8     7.1 0.00015   24.2   3.1   13   17-29    110-122 (278)
122 PRK12380 hydrogenase nickel in  71.2     3.6 7.9E-05   22.1   1.7   13   19-31     70-82  (113)
123 PF05191 ADK_lid:  Adenylate ki  71.1     3.2   7E-05   17.4   1.2   33   54-95      2-34  (36)
124 PF13451 zf-trcl:  Probable zin  70.7     1.8   4E-05   19.6   0.4   12   54-65      5-16  (49)
125 PRK03976 rpl37ae 50S ribosomal  70.4     1.7 3.7E-05   22.4   0.3   31   54-95     37-67  (90)
126 TIGR01206 lysW lysine biosynth  70.0     3.2 6.9E-05   19.2   1.1   11   54-64      3-13  (54)
127 KOG4727|consensus               69.9     3.1 6.7E-05   24.1   1.3   23   18-40     74-96  (193)
128 KOG2593|consensus               69.3     5.5 0.00012   26.6   2.4   14   54-67    129-142 (436)
129 COG5236 Uncharacterized conser  69.3      10 0.00022   24.8   3.5   76   20-107   221-306 (493)
130 KOG2593|consensus               69.0     5.3 0.00012   26.7   2.3   41   14-63    123-163 (436)
131 smart00440 ZnF_C2C2 C2C2 Zinc   68.1     1.4   3E-05   18.9  -0.3   10   83-92     29-38  (40)
132 TIGR00100 hypA hydrogenase nic  68.0       4 8.8E-05   22.0   1.4   13   19-31     70-82  (115)
133 COG3364 Zn-ribbon containing p  67.9     4.6  0.0001   21.3   1.5   14   19-32      2-15  (112)
134 PRK09678 DNA-binding transcrip  67.3     2.9 6.2E-05   20.6   0.7   16   54-69     28-45  (72)
135 PLN02294 cytochrome c oxidase   67.2     3.3 7.2E-05   24.0   1.0   17   16-32    138-154 (174)
136 PF07754 DUF1610:  Domain of un  67.0     3.5 7.7E-05   15.6   0.8   10   18-27     15-24  (24)
137 PRK03681 hypA hydrogenase nick  66.6     3.3 7.1E-05   22.3   0.9   14   18-31     69-82  (114)
138 cd00924 Cyt_c_Oxidase_Vb Cytoc  65.9     4.2 9.1E-05   21.3   1.2   16   17-32     77-92  (97)
139 PF07295 DUF1451:  Protein of u  65.5     3.9 8.5E-05   23.1   1.1   10   53-62    112-121 (146)
140 PF01428 zf-AN1:  AN1-like Zinc  65.5     3.4 7.3E-05   17.9   0.7   16   18-33     12-27  (43)
141 KOG4167|consensus               65.3     1.5 3.3E-05   31.2  -0.6   25   82-106   792-816 (907)
142 PF06524 NOA36:  NOA36 protein;  64.8     5.4 0.00012   24.9   1.7   27   13-40    136-162 (314)
143 PF13878 zf-C2H2_3:  zinc-finge  64.0     9.8 0.00021   16.4   2.0   24   19-42     13-38  (41)
144 COG1675 TFA1 Transcription ini  62.9      12 0.00027   21.9   2.8   17   16-32    110-126 (176)
145 PF04780 DUF629:  Protein of un  62.7     6.5 0.00014   26.7   1.9   22   83-104    58-79  (466)
146 PF10013 DUF2256:  Uncharacteri  60.2     6.4 0.00014   17.2   1.0   15   84-98     10-24  (42)
147 COG2331 Uncharacterized protei  60.0     4.4 9.5E-05   20.2   0.6   10   20-29     13-22  (82)
148 PF09963 DUF2197:  Uncharacteri  59.9     3.6 7.7E-05   19.2   0.3    8   82-89     31-38  (56)
149 PRK14873 primosome assembly pr  59.7       4 8.6E-05   29.0   0.6   10   82-91    422-431 (665)
150 COG4306 Uncharacterized protei  59.5     5.9 0.00013   21.8   1.1   42   54-95     40-81  (160)
151 KOG1146|consensus               59.5     2.9 6.3E-05   31.8  -0.1   48   58-105   441-488 (1406)
152 PF10083 DUF2321:  Uncharacteri  59.1     4.6  0.0001   23.1   0.6   15   82-96     68-82  (158)
153 PRK04023 DNA polymerase II lar  58.9     9.6 0.00021   28.6   2.3   11   18-28    625-635 (1121)
154 PF02176 zf-TRAF:  TRAF-type zi  58.6     6.6 0.00014   18.0   1.1   20   67-87     24-43  (60)
155 PF14787 zf-CCHC_5:  GAG-polypr  58.1     6.2 0.00014   16.6   0.8   16   83-98      3-18  (36)
156 PLN03238 probable histone acet  58.0      11 0.00023   24.0   2.2   25   82-106    48-72  (290)
157 COG2879 Uncharacterized small   57.2      13 0.00027   17.8   1.8   17   95-111    25-41  (65)
158 PRK00564 hypA hydrogenase nick  57.2     5.8 0.00012   21.5   0.8   16   17-32     69-84  (117)
159 PF01155 HypA:  Hydrogenase exp  56.8      11 0.00023   20.3   1.8   12   20-31     71-82  (113)
160 COG1655 Uncharacterized protei  56.6     2.1 4.5E-05   26.1  -1.0   20   16-35     16-35  (267)
161 TIGR00595 priA primosomal prot  56.0     5.6 0.00012   27.2   0.8    9   82-90    253-261 (505)
162 KOG0717|consensus               55.9     8.6 0.00019   26.1   1.6   22   20-41    293-314 (508)
163 KOG0717|consensus               55.6     7.1 0.00015   26.5   1.1   21   83-103   293-313 (508)
164 PF04423 Rad50_zn_hook:  Rad50   54.9      16 0.00035   16.6   2.0   12   21-32     22-33  (54)
165 PF01096 TFIIS_C:  Transcriptio  54.7       1 2.3E-05   19.2  -1.9   10   83-92     29-38  (39)
166 KOG0782|consensus               54.1       1 2.2E-05   31.2  -2.8   46   10-67    244-290 (1004)
167 PF12760 Zn_Tnp_IS1595:  Transp  53.5     9.9 0.00021   16.7   1.2    8   82-89     37-44  (46)
168 COG4338 Uncharacterized protei  53.3     5.6 0.00012   17.9   0.3   14   84-97     14-27  (54)
169 COG3091 SprT Zn-dependent meta  52.0     8.7 0.00019   21.9   1.0   33   54-92    118-150 (156)
170 KOG2807|consensus               51.4      37 0.00081   22.2   3.7   22   18-39    289-310 (378)
171 PF15269 zf-C2H2_7:  Zinc-finge  50.5      16 0.00035   16.1   1.5   22   20-41     21-42  (54)
172 COG1571 Predicted DNA-binding   49.7      14 0.00031   24.8   1.8   12   54-65    368-379 (421)
173 TIGR00515 accD acetyl-CoA carb  49.5      13 0.00029   23.5   1.6   33   20-67     27-59  (285)
174 TIGR00416 sms DNA repair prote  49.5      12 0.00027   25.3   1.6   13   18-30      6-18  (454)
175 KOG2071|consensus               48.6      13 0.00029   25.9   1.6   26   82-107   418-443 (579)
176 TIGR00627 tfb4 transcription f  48.2      17 0.00036   23.1   1.9   12   53-64    255-266 (279)
177 PF13824 zf-Mss51:  Zinc-finger  48.0      18 0.00039   16.8   1.5    7   54-60     15-21  (55)
178 PRK05978 hypothetical protein;  48.0       9  0.0002   21.8   0.7    8   55-62     54-61  (148)
179 PRK11823 DNA repair protein Ra  47.8      14  0.0003   25.0   1.6   14   17-30      5-18  (446)
180 PF06220 zf-U1:  U1 zinc finger  47.4      20 0.00043   15.2   1.6   14   82-95      3-16  (38)
181 KOG4124|consensus               46.9     3.7 8.1E-05   26.7  -1.0   51   51-101   347-417 (442)
182 PF12907 zf-met2:  Zinc-binding  46.2       9  0.0002   16.5   0.4   22   54-75      2-26  (40)
183 PF01215 COX5B:  Cytochrome c o  46.1      10 0.00022   21.3   0.7   17   17-33    110-126 (136)
184 PF07282 OrfB_Zn_ribbon:  Putat  46.1      15 0.00033   17.4   1.3   11   82-92     46-56  (69)
185 PTZ00043 cytochrome c oxidase   45.5      13 0.00028   22.8   1.1   18   16-33    178-195 (268)
186 PF05290 Baculo_IE-1:  Baculovi  45.2      20 0.00042   20.1   1.7   19   16-34     77-95  (140)
187 KOG1842|consensus               45.2      12 0.00027   25.3   1.1   27   54-80     16-42  (505)
188 KOG1842|consensus               44.5      11 0.00024   25.5   0.7   23   19-41     15-37  (505)
189 CHL00174 accD acetyl-CoA carbo  44.5      17 0.00038   23.2   1.6   33   20-67     39-71  (296)
190 COG0068 HypF Hydrogenase matur  44.0     4.8  0.0001   28.8  -0.9   59   21-92    125-183 (750)
191 PF10276 zf-CHCC:  Zinc-finger   43.2     9.3  0.0002   16.5   0.2   11   82-92     29-39  (40)
192 PHA02998 RNA polymerase subuni  42.9       8 0.00017   22.7  -0.0   38   54-95    144-184 (195)
193 PRK04351 hypothetical protein;  42.8      13 0.00027   21.2   0.7   34   53-95    112-145 (149)
194 PLN00104 MYST -like histone ac  42.6      16 0.00035   24.8   1.3   25   82-106   198-222 (450)
195 COG3357 Predicted transcriptio  42.4      11 0.00025   19.5   0.5   14   18-31     57-70  (97)
196 PF03811 Zn_Tnp_IS1:  InsA N-te  42.0      12 0.00026   15.7   0.5    7   82-88     29-35  (36)
197 PTZ00064 histone acetyltransfe  41.9      20 0.00043   24.8   1.6   25   82-106   280-304 (552)
198 PF10272 Tmpp129:  Putative tra  40.8       5 0.00011   26.2  -1.1   11   54-64    341-351 (358)
199 PRK05580 primosome assembly pr  40.6      20 0.00043   25.7   1.6    9   82-90    421-429 (679)
200 PF14803 Nudix_N_2:  Nudix N-te  39.6     5.5 0.00012   16.5  -0.7    6   55-60     24-29  (34)
201 COG1773 Rubredoxin [Energy pro  39.5      15 0.00033   17.1   0.6   14   19-32      3-16  (55)
202 PTZ00448 hypothetical protein;  39.3      24 0.00053   23.3   1.7   24   82-105   314-337 (373)
203 PRK05654 acetyl-CoA carboxylas  39.0      21 0.00045   22.8   1.4   33   20-67     28-60  (292)
204 PRK12496 hypothetical protein;  38.7      23 0.00049   20.5   1.4   28   52-92    126-153 (164)
205 COG2956 Predicted N-acetylgluc  38.7      17 0.00036   23.8   0.9    7   54-60    355-361 (389)
206 PF10263 SprT-like:  SprT-like   38.5      19  0.0004   20.2   1.0   13   54-66    124-136 (157)
207 PF05129 Elf1:  Transcription e  38.5     7.8 0.00017   19.5  -0.4   13   82-94     46-58  (81)
208 KOG3507|consensus               38.2      11 0.00025   17.7   0.1   11   54-64     38-48  (62)
209 COG5112 UFD2 U1-like Zn-finger  38.0      14  0.0003   19.7   0.4   22   82-103    55-76  (126)
210 PLN02748 tRNA dimethylallyltra  37.8      24 0.00053   24.1   1.6   23   82-104   418-441 (468)
211 COG1326 Uncharacterized archae  37.7      40 0.00088   20.2   2.3   12   54-65     31-42  (201)
212 PRK05452 anaerobic nitric oxid  37.1      17 0.00038   24.8   0.8   13   54-66    426-438 (479)
213 PRK11032 hypothetical protein;  37.0      22 0.00047   20.6   1.1    8   54-61    125-132 (160)
214 cd01121 Sms Sms (bacterial rad  36.9      21 0.00045   23.6   1.1    7   21-27     16-22  (372)
215 PRK00762 hypA hydrogenase nick  36.0      19 0.00041   19.7   0.7   12   19-31     70-81  (124)
216 PF01286 XPA_N:  XPA protein N-  35.9      21 0.00046   14.8   0.7   12   21-32      5-16  (34)
217 PF13453 zf-TFIIB:  Transcripti  35.8      42  0.0009   14.2   1.7   20   19-38     19-38  (41)
218 KOG3352|consensus               35.6      21 0.00047   20.3   0.9   15   79-94    131-145 (153)
219 PF14369 zf-RING_3:  zinc-finge  35.6      19 0.00042   14.9   0.6   11   21-31     23-33  (35)
220 COG4896 Uncharacterized protei  35.4      23 0.00049   16.9   0.9    9   54-62     32-40  (68)
221 PF14311 DUF4379:  Domain of un  35.2      50  0.0011   15.0   2.0   13   54-66     29-41  (55)
222 PF06397 Desulfoferrod_N:  Desu  35.1      22 0.00047   15.0   0.7   12   18-29      5-16  (36)
223 KOG3214|consensus               34.8      14 0.00031   19.5   0.1   13   82-94     47-59  (109)
224 smart00731 SprT SprT homologue  34.7      24 0.00051   19.8   1.0   33   53-93    112-144 (146)
225 COG4391 Uncharacterized protei  34.5      26 0.00057   16.7   1.0   36   54-94     25-60  (62)
226 KOG2906|consensus               34.1      11 0.00023   19.9  -0.4   19   18-36     20-38  (105)
227 KOG0562|consensus               33.7      35 0.00075   20.0   1.6   26   82-107   153-178 (184)
228 smart00132 LIM Zinc-binding do  33.7      20 0.00044   14.2   0.5   10   83-92     28-37  (39)
229 COG3677 Transposase and inacti  33.2      24 0.00051   19.5   0.9   14   82-95     53-66  (129)
230 PF03966 Trm112p:  Trm112p-like  33.0      24 0.00053   16.9   0.8   19   13-31     47-65  (68)
231 COG1594 RPB9 DNA-directed RNA   32.9      16 0.00034   19.7   0.1   17   17-33     20-36  (113)
232 PRK00420 hypothetical protein;  32.0      36 0.00079   18.4   1.4   11   82-92     40-50  (112)
233 PF04216 FdhE:  Protein involve  31.7      10 0.00023   23.9  -0.7   13   82-94    238-250 (290)
234 KOG1088|consensus               31.7      22 0.00047   19.4   0.5   13   54-66     99-111 (124)
235 PF10537 WAC_Acf1_DNA_bd:  ATP-  31.1      89  0.0019   16.6   3.1   38   18-62      2-39  (102)
236 KOG2907|consensus               30.2      31 0.00068   18.7   1.0   40   54-94     75-114 (116)
237 PRK12722 transcriptional activ  29.8      46 0.00099   19.9   1.7   28   54-90    135-162 (187)
238 KOG4317|consensus               29.5      27 0.00058   22.7   0.7   13   54-66     20-32  (383)
239 PF15616 TerY-C:  TerY-C metal   29.4      24 0.00051   19.7   0.5   11   82-92    105-115 (131)
240 KOG1280|consensus               29.2      56  0.0012   21.6   2.1   27   54-80     80-106 (381)
241 PF04810 zf-Sec23_Sec24:  Sec23  29.1      26 0.00057   14.8   0.5   11   82-92     24-34  (40)
242 PF04438 zf-HIT:  HIT zinc fing  28.8      43 0.00093   13.3   1.1   16   17-32     11-26  (30)
243 PF00412 LIM:  LIM domain;  Int  28.6      23  0.0005   15.9   0.3   10   83-92     27-36  (58)
244 PRK12860 transcriptional activ  28.5      49  0.0011   19.8   1.7   27   54-89    135-161 (189)
245 COG1998 RPS31 Ribosomal protei  28.5      50  0.0011   15.0   1.3   10   82-91     37-46  (51)
246 PF05495 zf-CHY:  CHY zinc fing  27.7      15 0.00032   17.9  -0.4   29   54-91     42-70  (71)
247 PF13821 DUF4187:  Domain of un  27.5      47   0.001   15.4   1.2   18   82-99     27-44  (55)
248 TIGR00319 desulf_FeS4 desulfof  27.1      40 0.00088   13.5   0.9   12   18-29      6-17  (34)
249 COG1779 C4-type Zn-finger prot  27.1      10 0.00023   22.6  -1.2    7   21-27     16-22  (201)
250 COG4530 Uncharacterized protei  26.5      56  0.0012   17.7   1.5   27   55-93     11-37  (129)
251 KOG2747|consensus               26.5      34 0.00074   22.9   0.9   25   82-106   158-182 (396)
252 cd00974 DSRD Desulforedoxin (D  26.4      44 0.00095   13.4   0.9   11   19-29      4-14  (34)
253 TIGR03831 YgiT_finger YgiT-typ  26.4      33 0.00072   14.5   0.6   12   20-31     33-44  (46)
254 PRK14714 DNA polymerase II lar  26.3      77  0.0017   25.0   2.6    9   20-28    668-676 (1337)
255 KOG1994|consensus               26.0      31 0.00068   21.2   0.6   20   82-101   239-258 (268)
256 TIGR01384 TFS_arch transcripti  25.8      19  0.0004   18.8  -0.3   14   18-31     15-28  (104)
257 PRK14892 putative transcriptio  25.5      40 0.00087   17.8   0.9   11   54-64     43-53  (99)
258 COG1885 Uncharacterized protei  24.3      41 0.00089   17.9   0.8   12   19-30     49-60  (115)
259 PF11023 DUF2614:  Protein of u  24.2      60  0.0013   17.6   1.4    9   54-62     70-78  (114)
260 COG5188 PRP9 Splicing factor 3  24.0      41 0.00088   22.3   0.8   22   19-40    238-259 (470)
261 PLN03239 histone acetyltransfe  23.9      61  0.0013   21.4   1.6   23   82-104   106-128 (351)
262 PF03107 C1_2:  C1 domain;  Int  23.8      51  0.0011   12.8   0.9    6   85-90      3-8   (30)
263 COG1066 Sms Predicted ATP-depe  23.5      55  0.0012   22.4   1.4   14   18-31      6-19  (456)
264 COG0675 Transposase and inacti  23.5      46 0.00099   21.1   1.0    9   82-90    322-330 (364)
265 PF08209 Sgf11:  Sgf11 (transcr  23.4      74  0.0016   13.0   2.3   24   82-106     4-27  (33)
266 PF10071 DUF2310:  Zn-ribbon-co  23.4      54  0.0012   20.7   1.3   28   54-89    221-248 (258)
267 PF11672 DUF3268:  Protein of u  23.1      59  0.0013   17.3   1.2   10   19-28      2-11  (102)
268 TIGR01385 TFSII transcription   23.0      35 0.00076   21.9   0.4   37   53-93    258-297 (299)
269 PF02891 zf-MIZ:  MIZ/SP-RING z  22.7      65  0.0014   14.4   1.2    8   54-61     42-49  (50)
270 COG5027 SAS2 Histone acetyltra  22.6      43 0.00092   22.2   0.7   26   82-107   158-183 (395)
271 PF02148 zf-UBP:  Zn-finger in   22.4      49  0.0011   15.5   0.8   16   17-32      9-24  (63)
272 PF02748 PyrI_C:  Aspartate car  22.3      54  0.0012   15.0   0.9   16   16-31     32-47  (52)
273 PF04328 DUF466:  Protein of un  22.3      84  0.0018   15.1   1.6   13   98-110    28-40  (65)
274 PF14690 zf-ISL3:  zinc-finger   22.3      48   0.001   14.2   0.7    7   20-26      3-9   (47)
275 smart00064 FYVE Protein presen  21.8      69  0.0015   15.0   1.3   12   20-31     11-22  (68)
276 PF14446 Prok-RING_1:  Prokaryo  21.7      37 0.00081   15.7   0.3    8   85-92      8-15  (54)
277 TIGR03830 CxxCG_CxxCG_HTH puta  21.5 1.2E+02  0.0025   16.2   2.3   21   19-39     31-51  (127)
278 KOG2857|consensus               21.4      51  0.0011   18.7   0.8   22   19-40     17-38  (157)
279 COG5595 Zn-ribbon-containing,   21.2      35 0.00075   20.5   0.2   14   21-34    220-233 (256)
280 PF14255 Cys_rich_CPXG:  Cystei  20.9      51  0.0011   15.1   0.6    9   84-92      2-10  (52)
281 PF08792 A2L_zn_ribbon:  A2L zi  20.8      49  0.0011   13.5   0.5   11   54-64     22-32  (33)
282 TIGR00686 phnA alkylphosphonat  20.7      59  0.0013   17.5   0.9   11   20-30     20-30  (109)
283 PF08271 TF_Zn_Ribbon:  TFIIB z  20.7      57  0.0012   13.9   0.8    9   54-62     20-28  (43)
284 PF12773 DZR:  Double zinc ribb  20.6      89  0.0019   13.6   1.4    7   55-61     31-37  (50)
285 PF04606 Ogr_Delta:  Ogr/Delta-  20.6      21 0.00045   15.8  -0.7    6   88-93     33-38  (47)
286 KOG3362|consensus               20.5      39 0.00085   19.2   0.3   20   82-101   129-148 (156)
287 KOG2636|consensus               20.3      94   0.002   21.4   1.9   23   17-39    399-422 (497)

No 1  
>KOG2462|consensus
Probab=99.94  E-value=4.7e-27  Score=137.52  Aligned_cols=101  Identities=24%  Similarity=0.394  Sum_probs=91.2

Q ss_pred             hHHHHHHhhhhhcC---CCCceecCCCcccccchhHHHHHHhhhcCCCCCCCCCccccCccCcccCCchhhHhhhhhhcC
Q psy12016          2 FFLFFLEYLSVWQN---DSGMFTCDVCFKEYKYKRGLVRHKKNSCKQKPQNLDGLFSCDVCGKHYKYKKGLGRHKRYECG   78 (111)
Q Consensus         2 ~~~~~l~~~~~~~~---~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~   78 (111)
                      .+...|..|.++|-   ..+.+.|+.|++.+.+...|.-|+++|+.  +      ..|.+||+.|.+++.|+.|+++|+|
T Consensus       141 sT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~l--~------c~C~iCGKaFSRPWLLQGHiRTHTG  212 (279)
T KOG2462|consen  141 STSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHTL--P------CECGICGKAFSRPWLLQGHIRTHTG  212 (279)
T ss_pred             ccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccCC--C------cccccccccccchHHhhcccccccC
Confidence            45566778888883   36678999999999999999999999984  3      8999999999999999999999999


Q ss_pred             CCCccccCCCCcccccchhHHHHHHHhhCCCCC
Q psy12016         79 QEPKYECDQCPHRTKHISSLKKHMALKHGVESQ  111 (111)
Q Consensus        79 ~~~~~~C~~C~~~f~~~~~l~~H~~~~~~ek~~  111 (111)
                      |+ ||.|..|+++|+.+++|+.|+++|.+.|+|
T Consensus       213 EK-PF~C~hC~kAFADRSNLRAHmQTHS~~K~~  244 (279)
T KOG2462|consen  213 EK-PFSCPHCGKAFADRSNLRAHMQTHSDVKKH  244 (279)
T ss_pred             CC-CccCCcccchhcchHHHHHHHHhhcCCccc
Confidence            88 999999999999999999999999999987


No 2  
>KOG2462|consensus
Probab=99.87  E-value=1e-22  Score=119.50  Aligned_cols=93  Identities=25%  Similarity=0.374  Sum_probs=86.8

Q ss_pred             HHHHHHhhhhhcCCCCceecCCCcccccchhHHHHHHhhhcCCCCCCCCCccccCccCcccCCchhhHhhhhhhcCCCCc
Q psy12016          3 FLFFLEYLSVWQNDSGMFTCDVCFKEYKYKRGLVRHKKNSCKQKPQNLDGLFSCDVCGKHYKYKKGLGRHKRYECGQEPK   82 (111)
Q Consensus         3 ~~~~l~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~   82 (111)
                      .+=.|+.|+++|+  -+..|.+||+.|...=.|+.|+++|+|++|      |.|..|+++|...++|..|+++|.+.+ +
T Consensus       173 SmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQGHiRTHTGEKP------F~C~hC~kAFADRSNLRAHmQTHS~~K-~  243 (279)
T KOG2462|consen  173 SMPALKMHIRTHT--LPCECGICGKAFSRPWLLQGHIRTHTGEKP------FSCPHCGKAFADRSNLRAHMQTHSDVK-K  243 (279)
T ss_pred             ehHHHhhHhhccC--CCcccccccccccchHHhhcccccccCCCC------ccCCcccchhcchHHHHHHHHhhcCCc-c
Confidence            3446899999987  789999999999999999999999999999      999999999999999999999998887 9


Q ss_pred             cccCCCCcccccchhHHHHHHH
Q psy12016         83 YECDQCPHRTKHISSLKKHMAL  104 (111)
Q Consensus        83 ~~C~~C~~~f~~~~~l~~H~~~  104 (111)
                      |.|..|++.|...+.|.+|...
T Consensus       244 ~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  244 HQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             ccCcchhhHHHHHHHHHHhhhh
Confidence            9999999999999999999764


No 3  
>KOG3623|consensus
Probab=99.69  E-value=5.2e-18  Score=110.85  Aligned_cols=82  Identities=37%  Similarity=0.810  Sum_probs=78.4

Q ss_pred             CCCCceecCCCcccccchhHHHHHHhhhcCCCCCCCCCccccCccCcccCCchhhHhhhhhhcCCCCccccCCCCccccc
Q psy12016         15 NDSGMFTCDVCFKEYKYKRGLVRHKKNSCKQKPQNLDGLFSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPHRTKH   94 (111)
Q Consensus        15 ~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~   94 (111)
                      +.+++|.|+.|++.|...+.|.+|...|+|.++      |.|.+|.++|..+-.|..|++.|.|++ ||.|+.|++.|..
T Consensus       890 te~gmyaCDqCDK~FqKqSSLaRHKYEHsGqRP------yqC~iCkKAFKHKHHLtEHkRLHSGEK-PfQCdKClKRFSH  962 (1007)
T KOG3623|consen  890 TEDGMYACDQCDKAFQKQSSLARHKYEHSGQRP------YQCIICKKAFKHKHHLTEHKRLHSGEK-PFQCDKCLKRFSH  962 (1007)
T ss_pred             CccccchHHHHHHHHHhhHHHHHhhhhhcCCCC------cccchhhHhhhhhhhhhhhhhhccCCC-cchhhhhhhhccc
Confidence            467899999999999999999999999999999      999999999999999999999999988 9999999999999


Q ss_pred             chhHHHHHH
Q psy12016         95 ISSLKKHMA  103 (111)
Q Consensus        95 ~~~l~~H~~  103 (111)
                      .+.+..||.
T Consensus       963 SGSYSQHMN  971 (1007)
T KOG3623|consen  963 SGSYSQHMN  971 (1007)
T ss_pred             ccchHhhhc
Confidence            999999975


No 4  
>KOG1074|consensus
Probab=99.68  E-value=1.9e-17  Score=109.28  Aligned_cols=56  Identities=29%  Similarity=0.540  Sum_probs=52.7

Q ss_pred             cccCccCcccCCchhhHhhhhhhcCCCCccccCCCCcccccchhHHHHHHHhhCCCC
Q psy12016         54 FSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPHRTKHISSLKKHMALKHGVES  110 (111)
Q Consensus        54 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~ek~  110 (111)
                      ..|.+|++.|.....|..|+++|++++ ||.|.+|++.|..+.+|+.||.+|+..+|
T Consensus       880 h~C~vCgk~FsSSsALqiH~rTHtg~K-PF~C~fC~~aFttrgnLKvHMgtH~w~q~  935 (958)
T KOG1074|consen  880 HVCNVCGKQFSSSAALEIHMRTHTGPK-PFFCHFCEEAFTTRGNLKVHMGTHMWVQP  935 (958)
T ss_pred             hhhccchhcccchHHHHHhhhcCCCCC-CccchhhhhhhhhhhhhhhhhccccccCC
Confidence            489999999999999999999999988 99999999999999999999999987655


No 5  
>KOG3576|consensus
Probab=99.66  E-value=2.3e-17  Score=93.66  Aligned_cols=85  Identities=35%  Similarity=0.630  Sum_probs=76.6

Q ss_pred             CCCceecCCCcccccchhHHHHHHhhhcCCCCCCCCCccccCccCcccCCchhhHhhhhhhcCCCCccccCCCCcccccc
Q psy12016         16 DSGMFTCDVCFKEYKYKRGLVRHKKNSCKQKPQNLDGLFSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPHRTKHI   95 (111)
Q Consensus        16 ~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~~   95 (111)
                      ....|.|.+|++.|....-|.+|++.|...+.      +.|..||+.|.....|..|.++|+|-+ ||+|..|+++|..+
T Consensus       114 d~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr------~lct~cgkgfndtfdlkrh~rthtgvr-pykc~~c~kaftqr  186 (267)
T KOG3576|consen  114 DQDSFTCRVCGKKFGLQRMLNRHLKCHSDVKR------HLCTFCGKGFNDTFDLKRHTRTHTGVR-PYKCSLCEKAFTQR  186 (267)
T ss_pred             CCCeeeeehhhhhhhHHHHHHHHhhhccHHHH------HHHhhccCcccchhhhhhhhccccCcc-ccchhhhhHHHHhh
Confidence            34568999999999999999999999988877      999999999999999999999999977 99999999999999


Q ss_pred             hhHHHHHHHhhC
Q psy12016         96 SSLKKHMALKHG  107 (111)
Q Consensus        96 ~~l~~H~~~~~~  107 (111)
                      ..|..|++.-||
T Consensus       187 csleshl~kvhg  198 (267)
T KOG3576|consen  187 CSLESHLKKVHG  198 (267)
T ss_pred             ccHHHHHHHHcC
Confidence            999999875554


No 6  
>KOG1074|consensus
Probab=99.63  E-value=1.2e-16  Score=105.58  Aligned_cols=53  Identities=23%  Similarity=0.479  Sum_probs=50.2

Q ss_pred             cccCccCcccCCchhhHhhhhhhcCCCCccccCCCCcccccchhHHHHHHHhhC
Q psy12016         54 FSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPHRTKHISSLKKHMALKHG  107 (111)
Q Consensus        54 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~  107 (111)
                      ..|..|.+.....+.|+.|-++|+|++ ||+|.+|+++|..+.+|+.|+.+|..
T Consensus       606 NqCiiC~rVlSC~saLqmHyrtHtGER-PFkCKiCgRAFtTkGNLkaH~~vHka  658 (958)
T KOG1074|consen  606 NQCIICLRVLSCPSALQMHYRTHTGER-PFKCKICGRAFTTKGNLKAHMSVHKA  658 (958)
T ss_pred             cceeeeeecccchhhhhhhhhcccCcC-ccccccccchhccccchhhccccccc
Confidence            389999999999999999999999988 99999999999999999999998875


No 7  
>KOG3623|consensus
Probab=99.56  E-value=1.8e-15  Score=99.31  Aligned_cols=99  Identities=30%  Similarity=0.573  Sum_probs=81.4

Q ss_pred             HHHHHhhhhhcC--CCCceecCCCcccccchhHHHHHHhhhcCCCCC-------CCCCccccCccCcccCCchhhHhhhh
Q psy12016          4 LFFLEYLSVWQN--DSGMFTCDVCFKEYKYKRGLVRHKKNSCKQKPQ-------NLDGLFSCDVCGKHYKYKKGLGRHKR   74 (111)
Q Consensus         4 ~~~l~~~~~~~~--~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~-------~~~~~~~c~~c~~~~~~~~~l~~h~~   74 (111)
                      +..|++|+.-..  -+..|.|..|..+|.....|.+|+.+|......       ..-..|+|.+|+++|..+-.|+.|++
T Consensus       223 ltslkeHikyrhekne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgKAFKfKHHLKEHlR  302 (1007)
T KOG3623|consen  223 LTSLKEHIKYRHEKNEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECGKAFKFKHHLKEHLR  302 (1007)
T ss_pred             HHHHHHHHHHHHhhCCCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccchhhhhHHHHHhhhe
Confidence            566777765442  244588999999999999999999988644332       11234899999999999999999999


Q ss_pred             hhcCCCCccccCCCCcccccchhHHHHHH
Q psy12016         75 YECGQEPKYECDQCPHRTKHISSLKKHMA  103 (111)
Q Consensus        75 ~~~~~~~~~~C~~C~~~f~~~~~l~~H~~  103 (111)
                      .|.|++ ||.|+.|.+.|...+.+..|+.
T Consensus       303 IHSGEK-PfeCpnCkKRFSHSGSySSHmS  330 (1007)
T KOG3623|consen  303 IHSGEK-PFECPNCKKRFSHSGSYSSHMS  330 (1007)
T ss_pred             eecCCC-CcCCcccccccccCCccccccc
Confidence            999988 9999999999999999988874


No 8  
>KOG3608|consensus
Probab=99.52  E-value=3.1e-14  Score=86.97  Aligned_cols=104  Identities=19%  Similarity=0.411  Sum_probs=84.7

Q ss_pred             HHHHHHhhhhhcCCCCceecCCCcccccchhHHHHHHhhhcCCCCCCC----------------------CCccccCccC
Q psy12016          3 FLFFLEYLSVWQNDSGMFTCDVCFKEYKYKRGLVRHKKNSCKQKPQNL----------------------DGLFSCDVCG   60 (111)
Q Consensus         3 ~~~~l~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~----------------------~~~~~c~~c~   60 (111)
                      ...-|++|.+.|+.++...|+.|+..|..+..|-.|.+..+.-.....                      .+-|+|+.|+
T Consensus       191 ~k~~LreH~r~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn~ykCplCd  270 (467)
T KOG3608|consen  191 NKYRLREHIRTHSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHVNCYKCPLCD  270 (467)
T ss_pred             cHHHHHHHHHhcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhhhcccccccc
Confidence            456789999999999999999999999999999888765443322211                      2347899999


Q ss_pred             cccCCchhhHhhhhhhcCCCCccccCCCCcccccchhHHHHHHHhh
Q psy12016         61 KHYKYKKGLGRHKRYECGQEPKYECDQCPHRTKHISSLKKHMALKH  106 (111)
Q Consensus        61 ~~~~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~  106 (111)
                      .....++.|..|++..+.+-+||+|+.|+..+...++|.+|...|.
T Consensus       271 mtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS  316 (467)
T KOG3608|consen  271 MTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS  316 (467)
T ss_pred             cCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc
Confidence            9999999999998887766669999999999999999999988776


No 9  
>KOG3576|consensus
Probab=99.52  E-value=5.7e-15  Score=84.05  Aligned_cols=101  Identities=21%  Similarity=0.408  Sum_probs=88.5

Q ss_pred             HHHHHhhhhhcCCCCceecCCCcccccchhHHHHHHhhhcCCCCCCCCCccccCccCcccCCchhhHhhhhhhcCC----
Q psy12016          4 LFFLEYLSVWQNDSGMFTCDVCFKEYKYKRGLVRHKKNSCKQKPQNLDGLFSCDVCGKHYKYKKGLGRHKRYECGQ----   79 (111)
Q Consensus         4 ~~~l~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~----   79 (111)
                      -+.|..|..-|+..+.+.|..||+.|...-+|.+|+++|+|.++      |.|..|+++|...-.|..|.+.-++.    
T Consensus       130 QRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrp------ykc~~c~kaftqrcsleshl~kvhgv~~~y  203 (267)
T KOG3576|consen  130 QRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRP------YKCSLCEKAFTQRCSLESHLKKVHGVQHQY  203 (267)
T ss_pred             HHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccc------cchhhhhHHHHhhccHHHHHHHHcCchHHH
Confidence            46788899999999999999999999999999999999999999      99999999999999999998876653    


Q ss_pred             ------CCccccCCCCcccccchhHHHHHHHhhCCCC
Q psy12016         80 ------EPKYECDQCPHRTKHISSLKKHMALKHGVES  110 (111)
Q Consensus        80 ------~~~~~C~~C~~~f~~~~~l~~H~~~~~~ek~  110 (111)
                            .+.|.|+.||.+-.....+-.|++.++...|
T Consensus       204 aykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp~Sp  240 (267)
T KOG3576|consen  204 AYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHPFSP  240 (267)
T ss_pred             HHHHhhhheeeecccCCCCCChhHHHHHHHhcCCCCH
Confidence                  1268999999888888888889988876443


No 10 
>PHA00733 hypothetical protein
Probab=99.34  E-value=1.5e-12  Score=70.65  Aligned_cols=84  Identities=19%  Similarity=0.279  Sum_probs=67.8

Q ss_pred             CCCCceecCCCcccccchhHHHHH--Hhh---hcCCCCCCCCCccccCccCcccCCchhhHhhhhhhcCCCCccccCCCC
Q psy12016         15 NDSGMFTCDVCFKEYKYKRGLVRH--KKN---SCKQKPQNLDGLFSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCP   89 (111)
Q Consensus        15 ~~~~~~~C~~C~~~f~~~~~l~~h--~~~---~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~   89 (111)
                      ...+++.|..|...|.....|..+  +..   +.+..+      |.|+.|++.|.....|..|++.+  .. ++.|..|+
T Consensus        36 ~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kP------y~C~~Cgk~Fss~s~L~~H~r~h--~~-~~~C~~Cg  106 (128)
T PHA00733         36 PEQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSP------YVCPLCLMPFSSSVSLKQHIRYT--EH-SKVCPVCG  106 (128)
T ss_pred             hhhhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCC------ccCCCCCCcCCCHHHHHHHHhcC--Cc-CccCCCCC
Confidence            446778999999888887777665  222   122344      99999999999999999999875  34 79999999


Q ss_pred             cccccchhHHHHHHHhhC
Q psy12016         90 HRTKHISSLKKHMALKHG  107 (111)
Q Consensus        90 ~~f~~~~~l~~H~~~~~~  107 (111)
                      +.|.....|..|+...|+
T Consensus       107 K~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733        107 KEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             CccCCHHHHHHHHHHhcC
Confidence            999999999999987765


No 11 
>KOG3608|consensus
Probab=99.23  E-value=3.3e-11  Score=73.98  Aligned_cols=91  Identities=21%  Similarity=0.488  Sum_probs=47.3

Q ss_pred             HHHHHHhhhhhcCCCCceecCCCcccccchhHHHHHHhh-hcCCCCCCCCCccccCccCcccCCchhhHhhhhhhcCCCC
Q psy12016          3 FLFFLEYLSVWQNDSGMFTCDVCFKEYKYKRGLVRHKKN-SCKQKPQNLDGLFSCDVCGKHYKYKKGLGRHKRYECGQEP   81 (111)
Q Consensus         3 ~~~~l~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~~-~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~   81 (111)
                      +-..|+.|.+.|.  .-|.|+.|+.+....+.|.+|++. |...++      |+|+.|++.+.+...|..|..+|. +. 
T Consensus       249 TeklL~~Hv~rHv--n~ykCplCdmtc~~~ssL~~H~r~rHs~dkp------fKCd~Cd~~c~~esdL~kH~~~HS-~~-  318 (467)
T KOG3608|consen  249 TEKLLKSHVVRHV--NCYKCPLCDMTCSSASSLTTHIRYRHSKDKP------FKCDECDTRCVRESDLAKHVQVHS-KT-  318 (467)
T ss_pred             HHHHHHHHHHHhh--hcccccccccCCCChHHHHHHHHhhhccCCC------ccccchhhhhccHHHHHHHHHhcc-cc-
Confidence            3344555555443  345566666666666666666543 333344      666666666666666666655543 22 


Q ss_pred             ccccCC--CCcccccchhHHHHHH
Q psy12016         82 KYECDQ--CPHRTKHISSLKKHMA  103 (111)
Q Consensus        82 ~~~C~~--C~~~f~~~~~l~~H~~  103 (111)
                      .|.|..  |...+.+...+++|.+
T Consensus       319 ~y~C~h~~C~~s~r~~~q~~~H~~  342 (467)
T KOG3608|consen  319 VYQCEHPDCHYSVRTYTQMRRHFL  342 (467)
T ss_pred             ceecCCCCCcHHHHHHHHHHHHHH
Confidence            344443  4444444444444443


No 12 
>PHA02768 hypothetical protein; Provisional
Probab=99.05  E-value=8.4e-11  Score=53.92  Aligned_cols=41  Identities=20%  Similarity=0.489  Sum_probs=21.3

Q ss_pred             cccCccCcccCCchhhHhhhhhhcCCCCccccCCCCcccccchh
Q psy12016         54 FSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPHRTKHISS   97 (111)
Q Consensus        54 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~~~~   97 (111)
                      |.|+.||+.|.....|..|+++|.  + +++|..|++.|...+.
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~--k-~~kc~~C~k~f~~~s~   46 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN--T-NLKLSNCKRISLRTGE   46 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC--C-cccCCcccceecccce
Confidence            455555555555555555555553  2 4555555555544443


No 13 
>PHA02768 hypothetical protein; Provisional
Probab=99.05  E-value=1.2e-10  Score=53.45  Aligned_cols=44  Identities=11%  Similarity=0.286  Sum_probs=39.0

Q ss_pred             ceecCCCcccccchhHHHHHHhhhcCCCCCCCCCccccCccCcccCCchhhH
Q psy12016         19 MFTCDVCFKEYKYKRGLVRHKKNSCKQKPQNLDGLFSCDVCGKHYKYKKGLG   70 (111)
Q Consensus        19 ~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~   70 (111)
                      -|.|+.||+.|.....|..|+++|+  .+      +.|..|++.|...+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~------~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TN------LKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--Cc------ccCCcccceecccceeE
Confidence            3789999999999999999999998  45      89999999998776654


No 14 
>PHA00733 hypothetical protein
Probab=99.01  E-value=1e-09  Score=59.62  Aligned_cols=64  Identities=19%  Similarity=0.387  Sum_probs=52.1

Q ss_pred             HHHhhhhhcCCCCceecCCCcccccchhHHHHHHhhhcCCCCCCCCCccccCccCcccCCchhhHhhhhhhcC
Q psy12016          6 FLEYLSVWQNDSGMFTCDVCFKEYKYKRGLVRHKKNSCKQKPQNLDGLFSCDVCGKHYKYKKGLGRHKRYECG   78 (111)
Q Consensus         6 ~l~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~   78 (111)
                      +|..+...+ .++||.|+.|++.|.....|..|+..+.  .+      +.|..|++.|.....|..|+...++
T Consensus        61 ~l~~~~~~~-~~kPy~C~~Cgk~Fss~s~L~~H~r~h~--~~------~~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         61 YLYKLLTSK-AVSPYVCPLCLMPFSSSVSLKQHIRYTE--HS------KVCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             HHHhhcccC-CCCCccCCCCCCcCCCHHHHHHHHhcCC--cC------ccCCCCCCccCCHHHHHHHHHHhcC
Confidence            345554444 4779999999999999999999988652  34      8999999999999999999886543


No 15 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.98  E-value=1.5e-09  Score=71.22  Aligned_cols=63  Identities=21%  Similarity=0.511  Sum_probs=32.6

Q ss_pred             CceecCCCcccccchhHHHHHHhhhcCCCCCCCCCccccCccCcccCCchhhHhhhhhhcCCCCccccCCCCccc
Q psy12016         18 GMFTCDVCFKEYKYKRGLVRHKKNSCKQKPQNLDGLFSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPHRT   92 (111)
Q Consensus        18 ~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~~~f   92 (111)
                      ..+.|+.|++.|. ...+..|+..+.  .+      +.|+ |+..+ ....|..|+.++.+.+ ++.|..|+..+
T Consensus       452 ~H~~C~~Cgk~f~-~s~LekH~~~~H--kp------v~Cp-Cg~~~-~R~~L~~H~~thCp~K-pi~C~fC~~~v  514 (567)
T PLN03086        452 NHVHCEKCGQAFQ-QGEMEKHMKVFH--EP------LQCP-CGVVL-EKEQMVQHQASTCPLR-LITCRFCGDMV  514 (567)
T ss_pred             cCccCCCCCCccc-hHHHHHHHHhcC--CC------ccCC-CCCCc-chhHHHhhhhccCCCC-ceeCCCCCCcc
Confidence            3345555655553 344555555542  33      5555 55433 3345555555555544 55566665555


No 16 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.93  E-value=4.1e-09  Score=69.21  Aligned_cols=90  Identities=20%  Similarity=0.380  Sum_probs=72.4

Q ss_pred             HHHHhhhhhcCCCCceecCCCcccccchhHHHHHHhhhcCCCCCCCCCccccCccCcccCC----------chhhHhhhh
Q psy12016          5 FFLEYLSVWQNDSGMFTCDVCFKEYKYKRGLVRHKKNSCKQKPQNLDGLFSCDVCGKHYKY----------KKGLGRHKR   74 (111)
Q Consensus         5 ~~l~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~----------~~~l~~h~~   74 (111)
                      ..|+.|...+.  .++.|+ |+..+ .+..|..|+.++++.++      +.|..|+..+..          ...|..|..
T Consensus       466 s~LekH~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kp------i~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~  535 (567)
T PLN03086        466 GEMEKHMKVFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRL------ITCRFCGDMVQAGGSAMDVRDRLRGMSEHES  535 (567)
T ss_pred             HHHHHHHHhcC--CCccCC-CCCCc-chhHHHhhhhccCCCCc------eeCCCCCCccccCccccchhhhhhhHHHHHH
Confidence            45788888874  689999 99755 66899999999999999      999999998852          346888888


Q ss_pred             hhcCCCCccccCCCCcccccchhHHHHHHHhhC
Q psy12016         75 YECGQEPKYECDQCPHRTKHISSLKKHMALKHG  107 (111)
Q Consensus        75 ~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~  107 (111)
                      .. +.+ ++.|..|++.+..+ .+..|+...|.
T Consensus       536 ~C-G~r-t~~C~~Cgk~Vrlr-dm~~H~~~~h~  565 (567)
T PLN03086        536 IC-GSR-TAPCDSCGRSVMLK-EMDIHQIAVHQ  565 (567)
T ss_pred             hc-CCc-ceEccccCCeeeeh-hHHHHHHHhhc
Confidence            74 666 99999999888665 67778876654


No 17 
>PHA00616 hypothetical protein
Probab=98.90  E-value=7.5e-10  Score=48.48  Aligned_cols=29  Identities=17%  Similarity=0.364  Sum_probs=17.0

Q ss_pred             ccccCCCCcccccchhHHHHHHHhhCCCC
Q psy12016         82 KYECDQCPHRTKHISSLKKHMALKHGVES  110 (111)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~~~~~ek~  110 (111)
                      ||.|..||+.|...+++..|++.+||++|
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~   29 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNK   29 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCc
Confidence            35555666666666666666666665554


No 18 
>KOG3993|consensus
Probab=98.84  E-value=4.3e-10  Score=70.51  Aligned_cols=25  Identities=20%  Similarity=0.546  Sum_probs=21.3

Q ss_pred             ccccCCCCcccccchhHHHHHHHhh
Q psy12016         82 KYECDQCPHRTKHISSLKKHMALKH  106 (111)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~~~~  106 (111)
                      .|.|..|++.|.....|++|+.+|+
T Consensus       356 i~~C~~C~KkFrRqAYLrKHqlthq  380 (500)
T KOG3993|consen  356 IFSCHTCGKKFRRQAYLRKHQLTHQ  380 (500)
T ss_pred             eeecHHhhhhhHHHHHHHHhHHhhh
Confidence            5788889999998889999987776


No 19 
>KOG3993|consensus
Probab=98.80  E-value=2.7e-09  Score=67.07  Aligned_cols=77  Identities=21%  Similarity=0.333  Sum_probs=61.6

Q ss_pred             ChHHHHHHhhhhhcCCCCceecCCCcccccchhHHHHHHhhhcCCCC-----------C----------------CCCCc
Q psy12016          1 MFFLFFLEYLSVWQNDSGMFTCDVCFKEYKYKRGLVRHKKNSCKQKP-----------Q----------------NLDGL   53 (111)
Q Consensus         1 ~~~~~~l~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~-----------~----------------~~~~~   53 (111)
                      |++.+.|-.|.-....-.-|.|++|+++|.-..+|..|.+.|-....           .                +.+++
T Consensus       277 YeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg~dss~gi  356 (500)
T KOG3993|consen  277 YEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAERSGDDSSSGI  356 (500)
T ss_pred             hhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccccCCcccCce
Confidence            46677788887776666779999999999999999999987732211           0                23568


Q ss_pred             cccCccCcccCCchhhHhhhhhhc
Q psy12016         54 FSCDVCGKHYKYKKGLGRHKRYEC   77 (111)
Q Consensus        54 ~~c~~c~~~~~~~~~l~~h~~~~~   77 (111)
                      |.|..|++.|.+...|..|+.+|+
T Consensus       357 ~~C~~C~KkFrRqAYLrKHqlthq  380 (500)
T KOG3993|consen  357 FSCHTCGKKFRRQAYLRKHQLTHQ  380 (500)
T ss_pred             eecHHhhhhhHHHHHHHHhHHhhh
Confidence            999999999999999999977765


No 20 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.79  E-value=4.9e-09  Score=41.34  Aligned_cols=24  Identities=17%  Similarity=0.308  Sum_probs=17.3

Q ss_pred             HHhhhhhcCCCCceecCCCccccc
Q psy12016          7 LEYLSVWQNDSGMFTCDVCFKEYK   30 (111)
Q Consensus         7 l~~~~~~~~~~~~~~C~~C~~~f~   30 (111)
                      |+.|+++|++++||.|+.|++.|.
T Consensus         2 l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    2 LRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHSSSSSEEESSSSEEES
T ss_pred             HHHHhhhcCCCCCCCCCCCcCeeC
Confidence            566777777777777777777764


No 21 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.78  E-value=4.3e-09  Score=41.51  Aligned_cols=24  Identities=33%  Similarity=0.697  Sum_probs=16.5

Q ss_pred             hHhhhhhhcCCCCccccCCCCcccc
Q psy12016         69 LGRHKRYECGQEPKYECDQCPHRTK   93 (111)
Q Consensus        69 l~~h~~~~~~~~~~~~C~~C~~~f~   93 (111)
                      |..|+++|.+++ ||.|+.|++.|.
T Consensus         2 l~~H~~~H~~~k-~~~C~~C~k~F~   25 (26)
T PF13465_consen    2 LRRHMRTHTGEK-PYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHSSSS-SEEESSSSEEES
T ss_pred             HHHHhhhcCCCC-CCCCCCCcCeeC
Confidence            556777776665 777777777664


No 22 
>PHA00616 hypothetical protein
Probab=98.57  E-value=3.2e-08  Score=43.36  Aligned_cols=29  Identities=24%  Similarity=0.461  Sum_probs=19.4

Q ss_pred             ceecCCCcccccchhHHHHHHhhhcCCCC
Q psy12016         19 MFTCDVCFKEYKYKRGLVRHKKNSCKQKP   47 (111)
Q Consensus        19 ~~~C~~C~~~f~~~~~l~~h~~~~~~~~~   47 (111)
                      ||.|+.||+.|..+.++..|++.|+++.+
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~   29 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNK   29 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCc
Confidence            45666666666666666666666666655


No 23 
>PHA00732 hypothetical protein
Probab=98.49  E-value=1.4e-07  Score=47.07  Aligned_cols=46  Identities=28%  Similarity=0.511  Sum_probs=36.0

Q ss_pred             ceecCCCcccccchhHHHHHHhh-hcCCCCCCCCCccccCccCcccCCchhhHhhhhhh
Q psy12016         19 MFTCDVCFKEYKYKRGLVRHKKN-SCKQKPQNLDGLFSCDVCGKHYKYKKGLGRHKRYE   76 (111)
Q Consensus        19 ~~~C~~C~~~f~~~~~l~~h~~~-~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~   76 (111)
                      ||.|..|++.|.....|..|++. |.   +      +.|+.|++.|.   .+..|.++.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~------~~C~~CgKsF~---~l~~H~~~~   47 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---L------TKCPVCNKSYR---RLNQHFYSQ   47 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---C------CccCCCCCEeC---Chhhhhccc
Confidence            57899999999999999999874 43   2      57999999887   356676554


No 24 
>PHA00732 hypothetical protein
Probab=98.48  E-value=1.3e-07  Score=47.17  Aligned_cols=46  Identities=24%  Similarity=0.477  Sum_probs=37.4

Q ss_pred             cccCccCcccCCchhhHhhhhhhcCCCCccccCCCCcccccchhHHHHHHHh
Q psy12016         54 FSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPHRTKHISSLKKHMALK  105 (111)
Q Consensus        54 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~  105 (111)
                      |.|..|++.|.....|..|++.++.   ++.|+.|++.|.   .+..|..+.
T Consensus         2 y~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~---~l~~H~~~~   47 (79)
T PHA00732          2 FKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYR---RLNQHFYSQ   47 (79)
T ss_pred             ccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeC---Chhhhhccc
Confidence            7899999999999999999985322   468999999997   467776543


No 25 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.47  E-value=3.4e-07  Score=42.46  Aligned_cols=51  Identities=27%  Similarity=0.514  Sum_probs=32.8

Q ss_pred             cccCccCcccCCchhhHhhhhhhcC-CCCccccCCCCcccccchhHHHHHHHhhC
Q psy12016         54 FSCDVCGKHYKYKKGLGRHKRYECG-QEPKYECDQCPHRTKHISSLKKHMALKHG  107 (111)
Q Consensus        54 ~~c~~c~~~~~~~~~l~~h~~~~~~-~~~~~~C~~C~~~f~~~~~l~~H~~~~~~  107 (111)
                      |.|+.|++ ......|..|....+. +.+.+.|+.|...+.  .+|..|+...|+
T Consensus         3 f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H~   54 (54)
T PF05605_consen    3 FTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQHR   54 (54)
T ss_pred             cCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhcC
Confidence            77888887 4445667777555443 333677888876543  377778777664


No 26 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.35  E-value=3.7e-07  Score=34.75  Aligned_cols=23  Identities=35%  Similarity=0.651  Sum_probs=18.5

Q ss_pred             cccCCCCcccccchhHHHHHHHh
Q psy12016         83 YECDQCPHRTKHISSLKKHMALK  105 (111)
Q Consensus        83 ~~C~~C~~~f~~~~~l~~H~~~~  105 (111)
                      |.|+.|++.|.....|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            56888888888888888888763


No 27 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.25  E-value=9.3e-07  Score=33.77  Aligned_cols=24  Identities=29%  Similarity=0.692  Sum_probs=18.0

Q ss_pred             cccCCCCcccccchhHHHHHHHhh
Q psy12016         83 YECDQCPHRTKHISSLKKHMALKH  106 (111)
Q Consensus        83 ~~C~~C~~~f~~~~~l~~H~~~~~  106 (111)
                      |.|+.|+..|.....|..|+.++|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            578888888888888888888764


No 28 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.25  E-value=1.2e-06  Score=33.31  Aligned_cols=23  Identities=30%  Similarity=0.723  Sum_probs=17.5

Q ss_pred             eecCCCcccccchhHHHHHHhhh
Q psy12016         20 FTCDVCFKEYKYKRGLVRHKKNS   42 (111)
Q Consensus        20 ~~C~~C~~~f~~~~~l~~h~~~~   42 (111)
                      |.|+.|++.|..+..|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            56788888888888888887653


No 29 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=98.19  E-value=1.8e-06  Score=38.74  Aligned_cols=31  Identities=19%  Similarity=0.464  Sum_probs=23.0

Q ss_pred             CCccccCCCCcccccchhHHHHHHHhhCCCC
Q psy12016         80 EPKYECDQCPHRTKHISSLKKHMALKHGVES  110 (111)
Q Consensus        80 ~~~~~C~~C~~~f~~~~~l~~H~~~~~~ek~  110 (111)
                      .+|-.|++|+..+....+|++|+.+.|+-||
T Consensus        22 ~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   22 EQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             S--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             CCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            3388999999999999999999999998886


No 30 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.15  E-value=9.4e-07  Score=34.98  Aligned_cols=26  Identities=27%  Similarity=0.636  Sum_probs=19.4

Q ss_pred             ccccCCCCcccccchhHHHHHHHhhC
Q psy12016         82 KYECDQCPHRTKHISSLKKHMALKHG  107 (111)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~~~~~  107 (111)
                      ||.|..|++.|.....|..|++.|.+
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhcC
Confidence            46788888888888888888776653


No 31 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.04  E-value=1.5e-05  Score=36.89  Aligned_cols=51  Identities=25%  Similarity=0.408  Sum_probs=36.3

Q ss_pred             ceecCCCcccccchhHHHHHHhh-hcCCCCCCCCCccccCccCcccCCchhhHhhhhhhc
Q psy12016         19 MFTCDVCFKEYKYKRGLVRHKKN-SCKQKPQNLDGLFSCDVCGKHYKYKKGLGRHKRYEC   77 (111)
Q Consensus        19 ~~~C~~C~~~f~~~~~l~~h~~~-~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~   77 (111)
                      .|.|+.|++ ..+...|..|... |..+..     .+.|+.|...+.  ..+..|+...+
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~-----~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESK-----NVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCC-----CccCCCchhhhh--hHHHHHHHHhc
Confidence            488999999 5566789999755 433221     289999997644  47888887654


No 32 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.04  E-value=4.2e-06  Score=33.04  Aligned_cols=25  Identities=36%  Similarity=0.749  Sum_probs=18.5

Q ss_pred             ceecCCCcccccchhHHHHHHhhhc
Q psy12016         19 MFTCDVCFKEYKYKRGLVRHKKNSC   43 (111)
Q Consensus        19 ~~~C~~C~~~f~~~~~l~~h~~~~~   43 (111)
                      ||.|..|++.|.....|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            5677888888888877777776553


No 33 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.92  E-value=1.6e-05  Score=30.15  Aligned_cols=23  Identities=30%  Similarity=0.722  Sum_probs=15.4

Q ss_pred             eecCCCcccccchhHHHHHHhhh
Q psy12016         20 FTCDVCFKEYKYKRGLVRHKKNS   42 (111)
Q Consensus        20 ~~C~~C~~~f~~~~~l~~h~~~~   42 (111)
                      |.|+.|+..|.....|..|+..+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            56777777777777777777654


No 34 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.84  E-value=1.4e-05  Score=41.40  Aligned_cols=73  Identities=21%  Similarity=0.277  Sum_probs=19.8

Q ss_pred             ecCCCcccccchhHHHHHHhhhcCCCCCCCCCccccCccCcccCCchhhHhhhhhhcCCCCccccCCCCcccccchhHHH
Q psy12016         21 TCDVCFKEYKYKRGLVRHKKNSCKQKPQNLDGLFSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPHRTKHISSLKK  100 (111)
Q Consensus        21 ~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~~~~l~~  100 (111)
                      .|..|+..|.....+..|+....+...         +.. ..+.....+....+.... . .+.|..|++.|.+...|..
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~---------~~~-~~l~~~~~~~~~~~~~~~-~-~~~C~~C~~~f~s~~~l~~   68 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDI---------PDQ-KYLVDPNRLLNYLRKKVK-E-SFRCPYCNKTFRSREALQE   68 (100)
T ss_dssp             -----------------------------------------------------------S-SEEBSSSS-EESSHHHHHH
T ss_pred             Ccccccccccccccccccccccccccc---------ccc-cccccccccccccccccC-C-CCCCCccCCCCcCHHHHHH
Confidence            488999999999999999865443211         110 111122222222222211 2 5889999999999999999


Q ss_pred             HHHHh
Q psy12016        101 HMALK  105 (111)
Q Consensus       101 H~~~~  105 (111)
                      |++.+
T Consensus        69 Hm~~~   73 (100)
T PF12756_consen   69 HMRSK   73 (100)
T ss_dssp             HHHHT
T ss_pred             HHcCc
Confidence            98754


No 35 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.79  E-value=6.6e-06  Score=50.65  Aligned_cols=70  Identities=27%  Similarity=0.511  Sum_probs=43.1

Q ss_pred             CCceecCC--CcccccchhHHHHHHhh-hcCCCCCCCCCccccCccCcccCCchhhHhhhhhhcCCCCccccCCCCcccc
Q psy12016         17 SGMFTCDV--CFKEYKYKRGLVRHKKN-SCKQKPQNLDGLFSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPHRTK   93 (111)
Q Consensus        17 ~~~~~C~~--C~~~f~~~~~l~~h~~~-~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~   93 (111)
                      ++||.|++  |++.+.....|+=|+.. |...+.      ..         .+ ....+.......+ ||+|++|++.++
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~------~~---------~p-~p~~~~~F~~~~K-PYrCevC~KRYK  409 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKL------HE---------NP-SPEKMNIFSAKDK-PYRCEVCDKRYK  409 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCccc------CC---------CC-CccccccccccCC-ceeccccchhhc
Confidence            47888887  88888888888777542 211111      00         00 0011111122334 999999999999


Q ss_pred             cchhHHHHHH
Q psy12016         94 HISSLKKHMA  103 (111)
Q Consensus        94 ~~~~l~~H~~  103 (111)
                      +...|+-|.+
T Consensus       410 NlNGLKYHr~  419 (423)
T COG5189         410 NLNGLKYHRK  419 (423)
T ss_pred             cCccceeccc
Confidence            9999988754


No 36 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.65  E-value=5.7e-05  Score=29.02  Aligned_cols=24  Identities=38%  Similarity=0.664  Sum_probs=17.2

Q ss_pred             cccCCCCcccccchhHHHHHHHhh
Q psy12016         83 YECDQCPHRTKHISSLKKHMALKH  106 (111)
Q Consensus        83 ~~C~~C~~~f~~~~~l~~H~~~~~  106 (111)
                      +.|..|++.|.....|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            457777777777777777777543


No 37 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.53  E-value=0.00011  Score=28.02  Aligned_cols=24  Identities=38%  Similarity=0.766  Sum_probs=16.9

Q ss_pred             cccCCCCcccccchhHHHHHHHhhC
Q psy12016         83 YECDQCPHRTKHISSLKKHMALKHG  107 (111)
Q Consensus        83 ~~C~~C~~~f~~~~~l~~H~~~~~~  107 (111)
                      |.|..|+.... ...|.+|++.+++
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhCc
Confidence            57888887776 7788888887764


No 38 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.45  E-value=0.00023  Score=32.12  Aligned_cols=30  Identities=23%  Similarity=0.297  Sum_probs=14.9

Q ss_pred             CCCceecCCCcccccchhHHHHHHhhhcCC
Q psy12016         16 DSGMFTCDVCFKEYKYKRGLVRHKKNSCKQ   45 (111)
Q Consensus        16 ~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~   45 (111)
                      .+.|..|++|+..+....+|.+|+....+.
T Consensus        21 S~~PatCP~C~a~~~~srnLrRHle~~H~~   50 (54)
T PF09237_consen   21 SEQPATCPICGAVIRQSRNLRRHLEIRHFK   50 (54)
T ss_dssp             TS--EE-TTT--EESSHHHHHHHHHHHTTT
T ss_pred             cCCCCCCCcchhhccchhhHHHHHHHHhcc
Confidence            445566666666666666666666554443


No 39 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.41  E-value=0.00015  Score=27.85  Aligned_cols=23  Identities=30%  Similarity=0.761  Sum_probs=17.9

Q ss_pred             eecCCCcccccchhHHHHHHhhh
Q psy12016         20 FTCDVCFKEYKYKRGLVRHKKNS   42 (111)
Q Consensus        20 ~~C~~C~~~f~~~~~l~~h~~~~   42 (111)
                      |.|..|+..|.....+..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            56888888888888888887643


No 40 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.40  E-value=0.00019  Score=27.43  Aligned_cols=23  Identities=30%  Similarity=0.603  Sum_probs=15.3

Q ss_pred             eecCCCcccccchhHHHHHHhhh
Q psy12016         20 FTCDVCFKEYKYKRGLVRHKKNS   42 (111)
Q Consensus        20 ~~C~~C~~~f~~~~~l~~h~~~~   42 (111)
                      |.|..|++.|.....+..|+..|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            35667777777777777776644


No 41 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.35  E-value=0.00012  Score=28.21  Aligned_cols=23  Identities=30%  Similarity=0.628  Sum_probs=17.0

Q ss_pred             cccCCCCcccccchhHHHHHHHh
Q psy12016         83 YECDQCPHRTKHISSLKKHMALK  105 (111)
Q Consensus        83 ~~C~~C~~~f~~~~~l~~H~~~~  105 (111)
                      |.|..|+..|.+...+..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            46778888888888888777543


No 42 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=97.00  E-value=0.00033  Score=27.51  Aligned_cols=22  Identities=36%  Similarity=0.685  Sum_probs=16.7

Q ss_pred             eecCCCcccccchhHHHHHHhh
Q psy12016         20 FTCDVCFKEYKYKRGLVRHKKN   41 (111)
Q Consensus        20 ~~C~~C~~~f~~~~~l~~h~~~   41 (111)
                      |.|..|++.|.....+..|+.+
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            5688888888888888777654


No 43 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.99  E-value=0.00013  Score=28.73  Aligned_cols=21  Identities=33%  Similarity=0.678  Sum_probs=13.8

Q ss_pred             cccCCCCcccccchhHHHHHH
Q psy12016         83 YECDQCPHRTKHISSLKKHMA  103 (111)
Q Consensus        83 ~~C~~C~~~f~~~~~l~~H~~  103 (111)
                      |.|..|++.|.+...|..|++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~   22 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMK   22 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTT
T ss_pred             CCcccCCCCcCCHHHHHHHHc
Confidence            456777777777666666654


No 44 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.87  E-value=0.0016  Score=24.65  Aligned_cols=22  Identities=32%  Similarity=0.555  Sum_probs=13.8

Q ss_pred             eecCCCcccccchhHHHHHHhhh
Q psy12016         20 FTCDVCFKEYKYKRGLVRHKKNS   42 (111)
Q Consensus        20 ~~C~~C~~~f~~~~~l~~h~~~~   42 (111)
                      |.|+.|+.... ...|.+|++.+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~   22 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRH   22 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhh
Confidence            56777777666 66777776654


No 45 
>PRK04860 hypothetical protein; Provisional
Probab=96.82  E-value=0.0011  Score=37.58  Aligned_cols=38  Identities=24%  Similarity=0.585  Sum_probs=31.0

Q ss_pred             ccccCccCcccCCchhhHhhhhhhcCCCCccccCCCCcccccc
Q psy12016         53 LFSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPHRTKHI   95 (111)
Q Consensus        53 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~~   95 (111)
                      .|.|. |+.   ....+..|.+++.++. +|.|..|+..|...
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~-~YrC~~C~~~l~~~  156 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEA-VYRCRRCGETLVFK  156 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCc-cEECCCCCceeEEe
Confidence            38997 887   5566788999998877 89999999888654


No 46 
>PRK04860 hypothetical protein; Provisional
Probab=96.76  E-value=0.001  Score=37.74  Aligned_cols=26  Identities=23%  Similarity=0.615  Sum_probs=16.5

Q ss_pred             ccccCCCCcccccchhHHHHHHHhhCCCCC
Q psy12016         82 KYECDQCPHRTKHISSLKKHMALKHGVESQ  111 (111)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~~~~~ek~~  111 (111)
                      +|.|. |+.   ....+++|.+++.++++|
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~Y  144 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVY  144 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccE
Confidence            56666 665   445566677777776665


No 47 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=96.50  E-value=0.0029  Score=24.38  Aligned_cols=22  Identities=23%  Similarity=0.443  Sum_probs=14.6

Q ss_pred             cccCCCCcccccchhHHHHHHHh
Q psy12016         83 YECDQCPHRTKHISSLKKHMALK  105 (111)
Q Consensus        83 ~~C~~C~~~f~~~~~l~~H~~~~  105 (111)
                      ..|+.|++.| ....|..|+++.
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~~C   24 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEKIC   24 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHHhc
Confidence            4577788887 455667776653


No 48 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=96.35  E-value=0.0043  Score=25.67  Aligned_cols=23  Identities=22%  Similarity=0.442  Sum_probs=17.5

Q ss_pred             ceecCCCcccccchhHHHHHHhh
Q psy12016         19 MFTCDVCFKEYKYKRGLVRHKKN   41 (111)
Q Consensus        19 ~~~C~~C~~~f~~~~~l~~h~~~   41 (111)
                      +|.|..|+..|.....+..|+..
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            57788888888877777777653


No 49 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=96.18  E-value=0.0037  Score=25.89  Aligned_cols=22  Identities=18%  Similarity=0.412  Sum_probs=17.6

Q ss_pred             ccccCCCCcccccchhHHHHHH
Q psy12016         82 KYECDQCPHRTKHISSLKKHMA  103 (111)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~  103 (111)
                      +|.|..|+..|.....+..|++
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHC
Confidence            5778888888888878877764


No 50 
>KOG1146|consensus
Probab=95.55  E-value=0.0092  Score=43.70  Aligned_cols=78  Identities=19%  Similarity=0.326  Sum_probs=43.0

Q ss_pred             CCceecCCCcccccchhHHHHHHhhhcCCCCCCCCCccccCccCcccCCchhhHhhhhhh-cCCCCccccCCCCcccccc
Q psy12016         17 SGMFTCDVCFKEYKYKRGLVRHKKNSCKQKPQNLDGLFSCDVCGKHYKYKKGLGRHKRYE-CGQEPKYECDQCPHRTKHI   95 (111)
Q Consensus        17 ~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~-~~~~~~~~C~~C~~~f~~~   95 (111)
                      .+.+.|+.|++.|.....|..|++.-+.+..      .  ..|.. +.....+ ....+. .+.. +|.|..|...+...
T Consensus       463 ~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~------~--~~c~~-gq~~~~~-arg~~~~~~~~-p~~C~~C~~stttn  531 (1406)
T KOG1146|consen  463 FKTLKCPKCNWHYKLAQTLGVHMRSKHPESQ------S--AYCKA-GQNHPRL-ARGEVYRCPGK-PYPCRACNYSTTTN  531 (1406)
T ss_pred             cccccCCccchhhhhHHHhhhcccccccccc------h--hHhHh-ccccccc-cccccccCCCC-cccceeeeeeeecc
Confidence            3556777777777777777777665332211      0  11110 0000000 001111 1223 88999999999999


Q ss_pred             hhHHHHHHHh
Q psy12016         96 SSLKKHMALK  105 (111)
Q Consensus        96 ~~l~~H~~~~  105 (111)
                      .+|..|+...
T Consensus       532 g~LsihlqS~  541 (1406)
T KOG1146|consen  532 GNLSIHLQSD  541 (1406)
T ss_pred             hHHHHHHHHH
Confidence            9999998643


No 51 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=94.90  E-value=0.017  Score=26.61  Aligned_cols=29  Identities=14%  Similarity=0.482  Sum_probs=23.7

Q ss_pred             CCCCceecCCCcccccchhHHHHHHhhhc
Q psy12016         15 NDSGMFTCDVCFKEYKYKRGLVRHKKNSC   43 (111)
Q Consensus        15 ~~~~~~~C~~C~~~f~~~~~l~~h~~~~~   43 (111)
                      -++..+.|+.|+..|....++.+|.....
T Consensus        13 DGE~~lrCPRC~~~FR~~K~Y~RHVNKaH   41 (65)
T COG4049          13 DGEEFLRCPRCGMVFRRRKDYIRHVNKAH   41 (65)
T ss_pred             CCceeeeCCchhHHHHHhHHHHHHhhHHh
Confidence            46777899999999999999999975433


No 52 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=94.70  E-value=0.026  Score=23.23  Aligned_cols=24  Identities=29%  Similarity=0.816  Sum_probs=13.6

Q ss_pred             cccCccCcccCCchhhHhhhhhhcCCCCccccCCCCc
Q psy12016         54 FSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPH   90 (111)
Q Consensus        54 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~~   90 (111)
                      |.|..||..+....            . ++.|+.|+.
T Consensus         2 ~~C~~CGy~y~~~~------------~-~~~CP~Cg~   25 (33)
T cd00350           2 YVCPVCGYIYDGEE------------A-PWVCPVCGA   25 (33)
T ss_pred             EECCCCCCEECCCc------------C-CCcCcCCCC
Confidence            56667765544321            2 667777763


No 53 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=94.32  E-value=0.026  Score=26.01  Aligned_cols=25  Identities=16%  Similarity=0.357  Sum_probs=15.8

Q ss_pred             ccccCCCCcccccchhHHHHHHHhh
Q psy12016         82 KYECDQCPHRTKHISSLKKHMALKH  106 (111)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~~~~  106 (111)
                      -+.|+.|+..|...-++.+|..-.|
T Consensus        17 ~lrCPRC~~~FR~~K~Y~RHVNKaH   41 (65)
T COG4049          17 FLRCPRCGMVFRRRKDYIRHVNKAH   41 (65)
T ss_pred             eeeCCchhHHHHHhHHHHHHhhHHh
Confidence            5567777777766666666655443


No 54 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=94.04  E-value=0.095  Score=26.82  Aligned_cols=23  Identities=30%  Similarity=0.777  Sum_probs=15.6

Q ss_pred             cccCccCcccCCchhhHhhhhhh
Q psy12016         54 FSCDVCGKHYKYKKGLGRHKRYE   76 (111)
Q Consensus        54 ~~c~~c~~~~~~~~~l~~h~~~~   76 (111)
                      +.|..|+..|.+...|..|++.+
T Consensus        51 ~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen   51 FRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             EEBSSSS-EESSHHHHHHHHHHT
T ss_pred             CCCCccCCCCcCHHHHHHHHcCc
Confidence            67777777777777777777654


No 55 
>KOG4173|consensus
Probab=92.87  E-value=0.058  Score=31.83  Aligned_cols=79  Identities=23%  Similarity=0.391  Sum_probs=56.4

Q ss_pred             ceecCC--CcccccchhHHHHHHhhhcCCCCCCCCCccccCccCcccCCchhhHhhhhhhc---------CCCCccccC-
Q psy12016         19 MFTCDV--CFKEYKYKRGLVRHKKNSCKQKPQNLDGLFSCDVCGKHYKYKKGLGRHKRYEC---------GQEPKYECD-   86 (111)
Q Consensus        19 ~~~C~~--C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~---------~~~~~~~C~-   86 (111)
                      .+.|+.  |.+.|.....+..|..+..+         ..|..|.+.|+....|..|..-.+         .+...|.|- 
T Consensus        79 ~~~cqvagc~~~~d~lD~~E~hY~~~h~---------~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~Clv  149 (253)
T KOG4173|consen   79 AFACQVAGCCQVFDALDDYEHHYHTLHG---------NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLV  149 (253)
T ss_pred             cccccccchHHHHhhhhhHHHhhhhccc---------chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHH
Confidence            356776  66777777777777544333         589999999999988888855433         223368884 


Q ss_pred             -CCCcccccchhHHHHHHHhh
Q psy12016         87 -QCPHRTKHISSLKKHMALKH  106 (111)
Q Consensus        87 -~C~~~f~~~~~l~~H~~~~~  106 (111)
                       .|+..|......+.|+..-|
T Consensus       150 EgCt~KFkT~r~RkdH~I~~H  170 (253)
T KOG4173|consen  150 EGCTEKFKTSRDRKDHMIRMH  170 (253)
T ss_pred             HhhhhhhhhhhhhhhHHHHhc
Confidence             59999999888888876544


No 56 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=92.73  E-value=0.085  Score=30.22  Aligned_cols=23  Identities=30%  Similarity=0.777  Sum_probs=17.6

Q ss_pred             ccccCccCcccCCchhhHhhhhhhcCCCCccccCCCC
Q psy12016         53 LFSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCP   89 (111)
Q Consensus        53 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~   89 (111)
                      .|.|++||..             +.++. |..|+.||
T Consensus       134 ~~vC~vCGy~-------------~~ge~-P~~CPiCg  156 (166)
T COG1592         134 VWVCPVCGYT-------------HEGEA-PEVCPICG  156 (166)
T ss_pred             EEEcCCCCCc-------------ccCCC-CCcCCCCC
Confidence            3999999876             23433 89999998


No 57 
>KOG2893|consensus
Probab=92.61  E-value=0.045  Score=33.06  Aligned_cols=47  Identities=30%  Similarity=0.561  Sum_probs=34.4

Q ss_pred             eecCCCcccccchhHHHHHHhhhcCCCCCCCCCccccCccCcccCCchhhHhh-hhhh
Q psy12016         20 FTCDVCFKEYKYKRGLVRHKKNSCKQKPQNLDGLFSCDVCGKHYKYKKGLGRH-KRYE   76 (111)
Q Consensus        20 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h-~~~~   76 (111)
                      .+|..|++.|....-|.+|++.    +.      |+|..|-+...+...|..| +++|
T Consensus        11 pwcwycnrefddekiliqhqka----kh------fkchichkkl~sgpglsihcmqvh   58 (341)
T KOG2893|consen   11 PWCWYCNREFDDEKILIQHQKA----KH------FKCHICHKKLFSGPGLSIHCMQVH   58 (341)
T ss_pred             ceeeecccccchhhhhhhhhhh----cc------ceeeeehhhhccCCCceeehhhhh
Confidence            3688999999999988888764    34      8999998666665555444 4444


No 58 
>KOG2893|consensus
Probab=92.17  E-value=0.037  Score=33.43  Aligned_cols=41  Identities=22%  Similarity=0.515  Sum_probs=34.7

Q ss_pred             cCccCcccCCchhhHhhhhhhcCCCCccccCCCCcccccchhHHHH
Q psy12016         56 CDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPHRTKHISSLKKH  101 (111)
Q Consensus        56 c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~~~~l~~H  101 (111)
                      |=.|++.|.....|.+|++.    + .|+|..|-+.+.+.-.|..|
T Consensus        13 cwycnrefddekiliqhqka----k-hfkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQKA----K-HFKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             eeecccccchhhhhhhhhhh----c-cceeeeehhhhccCCCceee
Confidence            66799999999999988874    3 89999999888777777766


No 59 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=92.17  E-value=0.13  Score=21.30  Aligned_cols=24  Identities=29%  Similarity=0.648  Sum_probs=16.3

Q ss_pred             cccCccCcccCCchhhHhhhhhhcCCCCccccCCCCc
Q psy12016         54 FSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPH   90 (111)
Q Consensus        54 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~~   90 (111)
                      |.|..||..+...             ..|..|+.|+.
T Consensus         3 ~~C~~CG~i~~g~-------------~~p~~CP~Cg~   26 (34)
T cd00729           3 WVCPVCGYIHEGE-------------EAPEKCPICGA   26 (34)
T ss_pred             EECCCCCCEeECC-------------cCCCcCcCCCC
Confidence            7888888764321             22678888874


No 60 
>KOG2231|consensus
Probab=91.95  E-value=0.52  Score=32.97  Aligned_cols=48  Identities=23%  Similarity=0.472  Sum_probs=27.2

Q ss_pred             cccCccCcccCCchhhHhhhhhhcCCCCccccCCC------CcccccchhHHHHHHHhh
Q psy12016         54 FSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQC------PHRTKHISSLKKHMALKH  106 (111)
Q Consensus        54 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C------~~~f~~~~~l~~H~~~~~  106 (111)
                      -.|..|...|.....+..|++..     .|-|..|      +..|.....|..|-+..|
T Consensus       183 p~C~~C~~~fld~~el~rH~~~~-----h~~chfC~~~~~~neyy~~~~dLe~HfR~~H  236 (669)
T KOG2231|consen  183 PLCKFCHERFLDDDELYRHLRFD-----HEFCHFCDYKTGQNEYYNDYDDLEEHFRKGH  236 (669)
T ss_pred             ccchhhhhhhccHHHHHHhhccc-----eeheeecCcccccchhcccchHHHHHhhhcC
Confidence            35666666666666666666654     3333333      344555566666655444


No 61 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=91.79  E-value=0.056  Score=32.31  Aligned_cols=12  Identities=17%  Similarity=0.528  Sum_probs=7.8

Q ss_pred             cccCCCCccccc
Q psy12016         83 YECDQCPHRTKH   94 (111)
Q Consensus        83 ~~C~~C~~~f~~   94 (111)
                      ..|+.||.++..
T Consensus        49 ~vCP~CgyA~~~   60 (214)
T PF09986_consen   49 WVCPHCGYAAFE   60 (214)
T ss_pred             EECCCCCCcccc
Confidence            467778766543


No 62 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=91.61  E-value=0.059  Score=34.77  Aligned_cols=54  Identities=22%  Similarity=0.501  Sum_probs=32.7

Q ss_pred             cccCccCcccCCchhhHhhhh--hhcCC--CCccccC--CCCcccccchhHHHHHHHhhCC
Q psy12016         54 FSCDVCGKHYKYKKGLGRHKR--YECGQ--EPKYECD--QCPHRTKHISSLKKHMALKHGV  108 (111)
Q Consensus        54 ~~c~~c~~~~~~~~~l~~h~~--~~~~~--~~~~~C~--~C~~~f~~~~~l~~H~~~~~~e  108 (111)
                      +.|..|...+.....+..|.+  .|.++  + ++.|.  .|++.|.....+..|..++.+-
T Consensus       290 ~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~-~~~~p~~~~~~~~~~~~~~~~~~~~~~~~  349 (467)
T COG5048         290 IKSKQCNISFSRSSPLTRHLRSVNHSGESLK-PFSCPYSLCGKLFSRNDALKRHILLHTSI  349 (467)
T ss_pred             CCCccccCCccccccccccccccccccccCC-ceeeeccCCCccccccccccCCcccccCC
Confidence            455666666666666666666  45555  4 66666  5666666666666665555543


No 63 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=91.20  E-value=0.46  Score=25.17  Aligned_cols=26  Identities=31%  Similarity=0.689  Sum_probs=22.8

Q ss_pred             cccc----CCCCcccccchhHHHHHHHhhC
Q psy12016         82 KYEC----DQCPHRTKHISSLKKHMALKHG  107 (111)
Q Consensus        82 ~~~C----~~C~~~f~~~~~l~~H~~~~~~  107 (111)
                      -|.|    ..|+....+...+..|.+..||
T Consensus        80 G~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   80 GYRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CeeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            4789    8999999999999999988875


No 64 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=91.13  E-value=0.3  Score=27.81  Aligned_cols=35  Identities=17%  Similarity=0.551  Sum_probs=23.6

Q ss_pred             CCCCceecCCCcccccchhHHHHHHhhhcCCCCCCCCCccccCccCcccC
Q psy12016         15 NDSGMFTCDVCFKEYKYKRGLVRHKKNSCKQKPQNLDGLFSCDVCGKHYK   64 (111)
Q Consensus        15 ~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~c~~c~~~~~   64 (111)
                      .....|.|+.|+..|+....+.         ..      |.|+.||....
T Consensus       105 ~~~~~Y~Cp~c~~r~tf~eA~~---------~~------F~Cp~Cg~~L~  139 (158)
T TIGR00373       105 TNNMFFICPNMCVRFTFNEAME---------LN------FTCPRCGAMLD  139 (158)
T ss_pred             cCCCeEECCCCCcEeeHHHHHH---------cC------CcCCCCCCEee
Confidence            3455678888888777766553         13      88888886543


No 65 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=90.82  E-value=0.21  Score=26.60  Aligned_cols=13  Identities=15%  Similarity=0.391  Sum_probs=6.7

Q ss_pred             ccccCCCCccccc
Q psy12016         82 KYECDQCPHRTKH   94 (111)
Q Consensus        82 ~~~C~~C~~~f~~   94 (111)
                      |..|+.||..|..
T Consensus        26 PivCP~CG~~~~~   38 (108)
T PF09538_consen   26 PIVCPKCGTEFPP   38 (108)
T ss_pred             CccCCCCCCccCc
Confidence            5555555555433


No 66 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=90.77  E-value=0.11  Score=31.02  Aligned_cols=28  Identities=29%  Similarity=0.446  Sum_probs=20.8

Q ss_pred             ccccCCCCcccccchhHHHHHHHhhCCC
Q psy12016         82 KYECDQCPHRTKHISSLKKHMALKHGVE  109 (111)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~~~~~ek  109 (111)
                      .|.|..|++.|....-+++|+..-|.|+
T Consensus        77 K~~C~lc~KlFkg~eFV~KHI~nKH~e~  104 (214)
T PF04959_consen   77 KWRCPLCGKLFKGPEFVRKHIFNKHPEK  104 (214)
T ss_dssp             EEEE-SSS-EESSHHHHHHHHHHH-HHH
T ss_pred             EECCCCCCcccCChHHHHHHHhhcCHHH
Confidence            6889999999998888899988777653


No 67 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=90.72  E-value=0.18  Score=23.65  Aligned_cols=31  Identities=26%  Similarity=0.670  Sum_probs=18.7

Q ss_pred             cccCccCcccCCchhhHhhhhhhcCCCCccccCCCCc
Q psy12016         54 FSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPH   90 (111)
Q Consensus        54 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~~   90 (111)
                      |.|+.||......     -.+-...+. +|.|+.||.
T Consensus        28 F~CPnCGe~~I~R-----c~~CRk~g~-~Y~Cp~CGF   58 (61)
T COG2888          28 FPCPNCGEVEIYR-----CAKCRKLGN-PYRCPKCGF   58 (61)
T ss_pred             eeCCCCCceeeeh-----hhhHHHcCC-ceECCCcCc
Confidence            8899999553322     112222235 899999973


No 68 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=90.30  E-value=0.39  Score=27.96  Aligned_cols=35  Identities=20%  Similarity=0.627  Sum_probs=23.7

Q ss_pred             CCCceecCCCcccccchhHHHHHHhhhcCCCCCCCCCccccCccCcccCC
Q psy12016         16 DSGMFTCDVCFKEYKYKRGLVRHKKNSCKQKPQNLDGLFSCDVCGKHYKY   65 (111)
Q Consensus        16 ~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~   65 (111)
                      ....|.|+.|+..|+....+.         ..      |.|+.||.....
T Consensus       114 ~~~~Y~Cp~C~~rytf~eA~~---------~~------F~Cp~Cg~~L~~  148 (178)
T PRK06266        114 NNMFFFCPNCHIRFTFDEAME---------YG------FRCPQCGEMLEE  148 (178)
T ss_pred             CCCEEECCCCCcEEeHHHHhh---------cC------CcCCCCCCCCee
Confidence            345688988988877765432         13      889999866544


No 69 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=90.00  E-value=0.36  Score=21.28  Aligned_cols=12  Identities=25%  Similarity=0.719  Sum_probs=6.9

Q ss_pred             eecCCCcccccc
Q psy12016         20 FTCDVCFKEYKY   31 (111)
Q Consensus        20 ~~C~~C~~~f~~   31 (111)
                      |.|..|+..|..
T Consensus         3 Y~C~~Cg~~~~~   14 (44)
T smart00659        3 YICGECGRENEI   14 (44)
T ss_pred             EECCCCCCEeec
Confidence            556666665543


No 70 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=89.71  E-value=0.36  Score=20.34  Aligned_cols=33  Identities=21%  Similarity=0.556  Sum_probs=16.5

Q ss_pred             cccCccCcccCCchhhHhhhhhhcCCCCccccCCCCccc
Q psy12016         54 FSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPHRT   92 (111)
Q Consensus        54 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~~~f   92 (111)
                      ..|+.|+..|.....-.     ..++. ..+|..|+..|
T Consensus         3 i~CP~C~~~f~v~~~~l-----~~~~~-~vrC~~C~~~f   35 (37)
T PF13719_consen    3 ITCPNCQTRFRVPDDKL-----PAGGR-KVRCPKCGHVF   35 (37)
T ss_pred             EECCCCCceEEcCHHHc-----ccCCc-EEECCCCCcEe
Confidence            45666666655554311     11223 55666666555


No 71 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=89.71  E-value=0.15  Score=23.07  Aligned_cols=13  Identities=15%  Similarity=0.690  Sum_probs=8.4

Q ss_pred             eecCCCcccccch
Q psy12016         20 FTCDVCFKEYKYK   32 (111)
Q Consensus        20 ~~C~~C~~~f~~~   32 (111)
                      |.|..|+..|...
T Consensus         6 y~C~~Cg~~fe~~   18 (52)
T TIGR02605         6 YRCTACGHRFEVL   18 (52)
T ss_pred             EEeCCCCCEeEEE
Confidence            5677777766543


No 72 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=89.42  E-value=0.4  Score=20.11  Aligned_cols=13  Identities=15%  Similarity=0.644  Sum_probs=6.2

Q ss_pred             cccCccCcccCCc
Q psy12016         54 FSCDVCGKHYKYK   66 (111)
Q Consensus        54 ~~c~~c~~~~~~~   66 (111)
                      +.|+.|+..|...
T Consensus         3 ~~CP~C~~~~~v~   15 (38)
T TIGR02098         3 IQCPNCKTSFRVV   15 (38)
T ss_pred             EECCCCCCEEEeC
Confidence            3455555544444


No 73 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=89.38  E-value=0.15  Score=32.98  Aligned_cols=62  Identities=26%  Similarity=0.443  Sum_probs=50.9

Q ss_pred             CceecCCCcccccchhHHHHHHh--hhcCC--CCCCCCCccccC--ccCcccCCchhhHhhhhhhcCCCCccccC
Q psy12016         18 GMFTCDVCFKEYKYKRGLVRHKK--NSCKQ--KPQNLDGLFSCD--VCGKHYKYKKGLGRHKRYECGQEPKYECD   86 (111)
Q Consensus        18 ~~~~C~~C~~~f~~~~~l~~h~~--~~~~~--~~~~~~~~~~c~--~c~~~~~~~~~l~~h~~~~~~~~~~~~C~   86 (111)
                      .++.|..|...|.....+..|..  .|.++  .+      +.|+  .|+..|.....+..|...+.+.. ++.+.
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~------~~~p~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~  355 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKP------FSCPYSLCGKLFSRNDALKRHILLHTSIS-PAKEK  355 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCc------eeeeccCCCccccccccccCCcccccCCC-ccccc
Confidence            36788899999999999999988  68887  67      8898  79999999999998988887755 55543


No 74 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=89.08  E-value=0.61  Score=26.21  Aligned_cols=13  Identities=23%  Similarity=0.920  Sum_probs=7.1

Q ss_pred             cccCccCcccCCc
Q psy12016         54 FSCDVCGKHYKYK   66 (111)
Q Consensus        54 ~~c~~c~~~~~~~   66 (111)
                      |.|+.|+..|...
T Consensus       100 Y~Cp~C~~~y~~~  112 (147)
T smart00531      100 YKCPNCQSKYTFL  112 (147)
T ss_pred             EECcCCCCEeeHH
Confidence            5566665555543


No 75 
>KOG2482|consensus
Probab=89.05  E-value=0.63  Score=29.87  Aligned_cols=23  Identities=26%  Similarity=0.476  Sum_probs=20.8

Q ss_pred             ceecCCCcccccchhHHHHHHhh
Q psy12016         19 MFTCDVCFKEYKYKRGLVRHKKN   41 (111)
Q Consensus        19 ~~~C~~C~~~f~~~~~l~~h~~~   41 (111)
                      .+.|-.|.+.|..+..|..||+.
T Consensus       195 r~~CLyCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHh
Confidence            46899999999999999999975


No 76 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=88.97  E-value=0.4  Score=30.80  Aligned_cols=23  Identities=26%  Similarity=0.355  Sum_probs=14.9

Q ss_pred             cccCccCcccCCchhhHhhhhhh
Q psy12016         54 FSCDVCGKHYKYKKGLGRHKRYE   76 (111)
Q Consensus        54 ~~c~~c~~~~~~~~~l~~h~~~~   76 (111)
                      -.|..|...|.....|..|.+..
T Consensus       221 P~C~FC~~~FYdDDEL~~HcR~~  243 (493)
T COG5236         221 PLCIFCKIYFYDDDELRRHCRLR  243 (493)
T ss_pred             chhhhccceecChHHHHHHHHhh
Confidence            35666777777666676666643


No 77 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=88.93  E-value=0.27  Score=27.17  Aligned_cols=24  Identities=33%  Similarity=0.686  Sum_probs=14.5

Q ss_pred             ccccCCCCcccccchhHHHHHHHhhCC
Q psy12016         82 KYECDQCPHRTKHISSLKKHMALKHGV  108 (111)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~~~~~e  108 (111)
                      ...|-+||+.|..   |++|+..|||-
T Consensus        72 ~i~clecGk~~k~---LkrHL~~~~gl   95 (132)
T PF05443_consen   72 YIICLECGKKFKT---LKRHLRTHHGL   95 (132)
T ss_dssp             -EE-TBT--EESB---HHHHHHHTT-S
T ss_pred             eeEEccCCcccch---HHHHHHHccCC
Confidence            4578889888765   58888888763


No 78 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=88.74  E-value=0.22  Score=21.20  Aligned_cols=12  Identities=17%  Similarity=0.783  Sum_probs=6.5

Q ss_pred             eecCCCcccccc
Q psy12016         20 FTCDVCFKEYKY   31 (111)
Q Consensus        20 ~~C~~C~~~f~~   31 (111)
                      |.|..|+..|..
T Consensus         6 y~C~~Cg~~fe~   17 (41)
T smart00834        6 YRCEDCGHTFEV   17 (41)
T ss_pred             EEcCCCCCEEEE
Confidence            456666655543


No 79 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=88.36  E-value=0.12  Score=22.52  Aligned_cols=14  Identities=21%  Similarity=0.769  Sum_probs=10.0

Q ss_pred             eecCCCcccccchh
Q psy12016         20 FTCDVCFKEYKYKR   33 (111)
Q Consensus        20 ~~C~~C~~~f~~~~   33 (111)
                      |.|..||..|....
T Consensus         6 y~C~~Cg~~fe~~~   19 (42)
T PF09723_consen    6 YRCEECGHEFEVLQ   19 (42)
T ss_pred             EEeCCCCCEEEEEE
Confidence            67888887776543


No 80 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=88.13  E-value=0.65  Score=19.44  Aligned_cols=33  Identities=21%  Similarity=0.466  Sum_probs=15.1

Q ss_pred             cccCccCcccCCchhhHhhhhhhcCCCCccccCCCCccc
Q psy12016         54 FSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPHRT   92 (111)
Q Consensus        54 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~~~f   92 (111)
                      ..|+.|+..|.-.....     -..+. ..+|..|+..|
T Consensus         3 i~Cp~C~~~y~i~d~~i-----p~~g~-~v~C~~C~~~f   35 (36)
T PF13717_consen    3 ITCPNCQAKYEIDDEKI-----PPKGR-KVRCSKCGHVF   35 (36)
T ss_pred             EECCCCCCEEeCCHHHC-----CCCCc-EEECCCCCCEe
Confidence            34555655555443321     11122 45566665544


No 81 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=86.89  E-value=0.72  Score=20.73  Aligned_cols=23  Identities=22%  Similarity=0.599  Sum_probs=15.1

Q ss_pred             ccccCCCCcccccc-----hhHHHHHHH
Q psy12016         82 KYECDQCPHRTKHI-----SSLKKHMAL  104 (111)
Q Consensus        82 ~~~C~~C~~~f~~~-----~~l~~H~~~  104 (111)
                      ...|..|++.+...     +.|.+|++.
T Consensus        18 ~a~C~~C~~~l~~~~~~gTs~L~rHl~~   45 (50)
T smart00614       18 RAKCKYCGKKLSRSSKGGTSNLRRHLRR   45 (50)
T ss_pred             EEEecCCCCEeeeCCCCCcHHHHHHHHh
Confidence            35677777766544     577888773


No 82 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=86.69  E-value=0.37  Score=24.48  Aligned_cols=31  Identities=23%  Similarity=0.576  Sum_probs=19.9

Q ss_pred             cccCccCcccCCchhhHhhhhhhcCCCCccccCCCCcccccc
Q psy12016         54 FSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPHRTKHI   95 (111)
Q Consensus        54 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~~   95 (111)
                      +.|+.|++. .       ..+...  . .|.|..|+..|+-.
T Consensus        36 ~~Cp~C~~~-~-------VkR~a~--G-IW~C~kCg~~fAGg   66 (89)
T COG1997          36 HVCPFCGRT-T-------VKRIAT--G-IWKCRKCGAKFAGG   66 (89)
T ss_pred             CcCCCCCCc-c-------eeeecc--C-eEEcCCCCCeeccc
Confidence            788888865 1       122222  2 78888888887554


No 83 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=86.68  E-value=2  Score=23.09  Aligned_cols=86  Identities=16%  Similarity=0.159  Sum_probs=48.8

Q ss_pred             CCceecCCCcccccchhHHHHHHhhhcCCCCC---CCC---CccccCccCcccCCchhhHhhhhhhcCCCCccccCCCCc
Q psy12016         17 SGMFTCDVCFKEYKYKRGLVRHKKNSCKQKPQ---NLD---GLFSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPH   90 (111)
Q Consensus        17 ~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~---~~~---~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~~   90 (111)
                      +-|..|+.|+-.......|.+.....-...+.   .++   ..-.|--|...|........-.  ..... .|.|..|..
T Consensus        13 ~LP~~CpiCgLtLVss~HLARSyHHLfPl~~f~ev~~~~~~~~~~C~~C~~~f~~~~~~~~~~--~~~~~-~y~C~~C~~   89 (112)
T TIGR00622        13 ELPVECPICGLTLILSTHLARSYHHLFPLKAFQEIPLEEYNGSRFCFGCQGPFPKPPVSPFDE--LKDSH-RYVCAVCKN   89 (112)
T ss_pred             CCCCcCCcCCCEEeccchHHHhhhccCCCcccccccccccCCCCcccCcCCCCCCcccccccc--ccccc-ceeCCCCCC
Confidence            45778999998888888777653221111110   000   1124777887776543211000  11123 689999999


Q ss_pred             ccccchhHHHHHHHh
Q psy12016         91 RTKHISSLKKHMALK  105 (111)
Q Consensus        91 ~f~~~~~l~~H~~~~  105 (111)
                      .|-..-+.-.|...|
T Consensus        90 ~FC~dCD~fiHe~Lh  104 (112)
T TIGR00622        90 VFCVDCDVFVHESLH  104 (112)
T ss_pred             ccccccchhhhhhcc
Confidence            998777666665544


No 84 
>KOG2186|consensus
Probab=86.18  E-value=0.59  Score=28.67  Aligned_cols=47  Identities=30%  Similarity=0.589  Sum_probs=31.9

Q ss_pred             ceecCCCcccccchhHHHHHHhhhcCCCCCCCCCccccCccCcccCCchhhHhhhh
Q psy12016         19 MFTCDVCFKEYKYKRGLVRHKKNSCKQKPQNLDGLFSCDVCGKHYKYKKGLGRHKR   74 (111)
Q Consensus        19 ~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~   74 (111)
                      .|.|..||..... ..+.+|+..-.+ ..      |.|..|+..|.. .....|..
T Consensus         3 ~FtCnvCgEsvKK-p~vekH~srCrn-~~------fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    3 FFTCNVCGESVKK-PQVEKHMSRCRN-AY------FSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             EEehhhhhhhccc-cchHHHHHhccC-Ce------eEEeeccccccc-chhhhhhh
Confidence            4788899876544 456778655444 44      899999998887 44555644


No 85 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=85.39  E-value=0.37  Score=27.36  Aligned_cols=15  Identities=27%  Similarity=0.594  Sum_probs=10.5

Q ss_pred             cccCccCcccCCchh
Q psy12016         54 FSCDVCGKHYKYKKG   68 (111)
Q Consensus        54 ~~c~~c~~~~~~~~~   68 (111)
                      +.|+.||..|.....
T Consensus        29 ~~c~~c~~~f~~~e~   43 (154)
T PRK00464         29 RECLACGKRFTTFER   43 (154)
T ss_pred             eeccccCCcceEeEe
Confidence            678888877766543


No 86 
>KOG2186|consensus
Probab=85.18  E-value=0.47  Score=29.07  Aligned_cols=46  Identities=26%  Similarity=0.555  Sum_probs=35.0

Q ss_pred             cccCccCcccCCchhhHhhhhhhcCCCCccccCCCCcccccchhHHHHHH
Q psy12016         54 FSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPHRTKHISSLKKHMA  103 (111)
Q Consensus        54 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~  103 (111)
                      |.|..||....-+ .+..|+..-++ . .|.|..|+..|.. .++..|.+
T Consensus         4 FtCnvCgEsvKKp-~vekH~srCrn-~-~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    4 FTCNVCGESVKKP-QVEKHMSRCRN-A-YFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             Eehhhhhhhcccc-chHHHHHhccC-C-eeEEeeccccccc-chhhhhhh
Confidence            7899999887655 45558776655 5 7999999999977 56666754


No 87 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=84.92  E-value=1.2  Score=19.28  Aligned_cols=23  Identities=35%  Similarity=0.564  Sum_probs=13.2

Q ss_pred             ccccCCCCcccccc----hhHHHHHHH
Q psy12016         82 KYECDQCPHRTKHI----SSLKKHMAL  104 (111)
Q Consensus        82 ~~~C~~C~~~f~~~----~~l~~H~~~  104 (111)
                      ...|..|++.+...    +.|..|++.
T Consensus        16 ~a~C~~C~~~~~~~~~~ts~l~~HL~~   42 (45)
T PF02892_consen   16 KAKCKYCGKVIKYSSGGTSNLKRHLKK   42 (45)
T ss_dssp             -EEETTTTEE-----SSTHHHHHHHHH
T ss_pred             eEEeCCCCeEEeeCCCcHHHHHHhhhh
Confidence            56788888777653    577777743


No 88 
>KOG4167|consensus
Probab=83.76  E-value=0.31  Score=34.27  Aligned_cols=29  Identities=28%  Similarity=0.465  Sum_probs=24.9

Q ss_pred             CCceecCCCcccccchhHHHHHHhhhcCC
Q psy12016         17 SGMFTCDVCFKEYKYKRGLVRHKKNSCKQ   45 (111)
Q Consensus        17 ~~~~~C~~C~~~f~~~~~l~~h~~~~~~~   45 (111)
                      ...|.|.+|++.|.....+..||++|...
T Consensus       790 ~giFpCreC~kvF~KiKSrNAHMK~Hr~q  818 (907)
T KOG4167|consen  790 TGIFPCRECGKVFFKIKSRNAHMKTHRQQ  818 (907)
T ss_pred             CceeehHHHHHHHHHHhhhhHHHHHHHHH
Confidence            45689999999999999999999988643


No 89 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=83.61  E-value=0.64  Score=29.58  Aligned_cols=25  Identities=32%  Similarity=0.588  Sum_probs=21.4

Q ss_pred             CccccCC--CCcccccchhHHHHHHHh
Q psy12016         81 PKYECDQ--CPHRTKHISSLKKHMALK  105 (111)
Q Consensus        81 ~~~~C~~--C~~~f~~~~~l~~H~~~~  105 (111)
                      +||+|++  |++.+++...|+-|+.--
T Consensus       348 KpykCpV~gC~K~YknqnGLKYH~lhG  374 (423)
T COG5189         348 KPYKCPVEGCNKKYKNQNGLKYHMLHG  374 (423)
T ss_pred             ceecCCCCCchhhhccccchhhhhhcc
Confidence            3999986  999999999999997533


No 90 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=83.29  E-value=0.53  Score=20.79  Aligned_cols=14  Identities=21%  Similarity=0.610  Sum_probs=9.5

Q ss_pred             ceecCCCcccccch
Q psy12016         19 MFTCDVCFKEYKYK   32 (111)
Q Consensus        19 ~~~C~~C~~~f~~~   32 (111)
                      .|.|+.|+..|...
T Consensus         3 ~y~C~~CG~~~~~~   16 (46)
T PRK00398          3 EYKCARCGREVELD   16 (46)
T ss_pred             EEECCCCCCEEEEC
Confidence            47788888766553


No 91 
>KOG2482|consensus
Probab=83.09  E-value=2  Score=27.71  Aligned_cols=22  Identities=27%  Similarity=0.567  Sum_probs=20.0

Q ss_pred             ccccCCCCcccccchhHHHHHH
Q psy12016         82 KYECDQCPHRTKHISSLKKHMA  103 (111)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~  103 (111)
                      .+.|-.|.+.|..+..|+.||+
T Consensus       195 r~~CLyCekifrdkntLkeHMr  216 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMR  216 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHH
Confidence            4689999999999999999986


No 92 
>KOG2231|consensus
Probab=83.04  E-value=2.1  Score=30.15  Aligned_cols=69  Identities=20%  Similarity=0.401  Sum_probs=43.4

Q ss_pred             eecCCCcccccchhHHHHHHhhhcCCCCCCCCCccccCccC------cccCCchhhHhhhhhhcCCCCccccC--CCC-c
Q psy12016         20 FTCDVCFKEYKYKRGLVRHKKNSCKQKPQNLDGLFSCDVCG------KHYKYKKGLGRHKRYECGQEPKYECD--QCP-H   90 (111)
Q Consensus        20 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~c~~c~------~~~~~~~~l~~h~~~~~~~~~~~~C~--~C~-~   90 (111)
                      ..|..|...|.....+.+|++.+.          +.|..|.      ..|.....|..|-+..     .|.|.  .|. +
T Consensus       183 p~C~~C~~~fld~~el~rH~~~~h----------~~chfC~~~~~~neyy~~~~dLe~HfR~~-----HflCE~~~C~~~  247 (669)
T KOG2231|consen  183 PLCKFCHERFLDDDELYRHLRFDH----------EFCHFCDYKTGQNEYYNDYDDLEEHFRKG-----HFLCEEEFCRTK  247 (669)
T ss_pred             ccchhhhhhhccHHHHHHhhccce----------eheeecCcccccchhcccchHHHHHhhhc-----Cccccccccccc
Confidence            468889999999999998887654          5566553      3444456677776643     77776  454 2


Q ss_pred             ccccchhHHHHHH
Q psy12016         91 RTKHISSLKKHMA  103 (111)
Q Consensus        91 ~f~~~~~l~~H~~  103 (111)
                      .|.....+..+++
T Consensus       248 ~f~~~~~~ei~lk  260 (669)
T KOG2231|consen  248 KFYVAFELEIELK  260 (669)
T ss_pred             eeeehhHHHHHHH
Confidence            3333334444444


No 93 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=82.67  E-value=0.81  Score=21.52  Aligned_cols=30  Identities=23%  Similarity=0.555  Sum_probs=18.1

Q ss_pred             cccCccCcc-cCCchhhHhhhhhhcCCCCccccCCCCc
Q psy12016         54 FSCDVCGKH-YKYKKGLGRHKRYECGQEPKYECDQCPH   90 (111)
Q Consensus        54 ~~c~~c~~~-~~~~~~l~~h~~~~~~~~~~~~C~~C~~   90 (111)
                      |.|+.||.. ..+-..      -..... +|.|+.||.
T Consensus        26 F~CPnCG~~~I~RC~~------CRk~~~-~Y~CP~CGF   56 (59)
T PRK14890         26 FLCPNCGEVIIYRCEK------CRKQSN-PYTCPKCGF   56 (59)
T ss_pred             eeCCCCCCeeEeechh------HHhcCC-ceECCCCCC
Confidence            889999876 222211      111224 899999974


No 94 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=81.01  E-value=1.6  Score=23.09  Aligned_cols=27  Identities=33%  Similarity=0.567  Sum_probs=22.8

Q ss_pred             Ccccc----CccCcccCCchhhHhhhhhhcC
Q psy12016         52 GLFSC----DVCGKHYKYKKGLGRHKRYECG   78 (111)
Q Consensus        52 ~~~~c----~~c~~~~~~~~~l~~h~~~~~~   78 (111)
                      .+|.|    ..|+....+...+..|.+.+++
T Consensus        79 ~G~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   79 DGYRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CCeeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            45899    8899999999999999887654


No 95 
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=80.63  E-value=0.71  Score=20.68  Aligned_cols=12  Identities=33%  Similarity=0.744  Sum_probs=6.2

Q ss_pred             eecCCCcccccc
Q psy12016         20 FTCDVCFKEYKY   31 (111)
Q Consensus        20 ~~C~~C~~~f~~   31 (111)
                      |.|..|+..+..
T Consensus         2 y~C~~CgyvYd~   13 (47)
T PF00301_consen    2 YQCPVCGYVYDP   13 (47)
T ss_dssp             EEETTTSBEEET
T ss_pred             cCCCCCCEEEcC
Confidence            455555555443


No 96 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=80.03  E-value=1.7  Score=17.73  Aligned_cols=11  Identities=27%  Similarity=0.721  Sum_probs=6.0

Q ss_pred             eecCCCccccc
Q psy12016         20 FTCDVCFKEYK   30 (111)
Q Consensus        20 ~~C~~C~~~f~   30 (111)
                      |.|..|+..+.
T Consensus         1 Y~C~~Cg~~~~   11 (32)
T PF03604_consen    1 YICGECGAEVE   11 (32)
T ss_dssp             EBESSSSSSE-
T ss_pred             CCCCcCCCeeE
Confidence            45666666554


No 97 
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=79.97  E-value=0.49  Score=18.70  Aligned_cols=17  Identities=29%  Similarity=0.524  Sum_probs=7.6

Q ss_pred             ccCCCCcccccchhHHHH
Q psy12016         84 ECDQCPHRTKHISSLKKH  101 (111)
Q Consensus        84 ~C~~C~~~f~~~~~l~~H  101 (111)
                      .|..|++.| .....+.|
T Consensus         2 sCiDC~~~F-~~~~y~~H   18 (28)
T PF08790_consen    2 SCIDCSKDF-DGDSYKSH   18 (28)
T ss_dssp             EETTTTEEE-EGGGTTT-
T ss_pred             eeecCCCCc-CcCCcCCC
Confidence            455555555 33333444


No 98 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=79.97  E-value=1.3  Score=24.30  Aligned_cols=33  Identities=12%  Similarity=0.228  Sum_probs=21.5

Q ss_pred             eecCCCcccccchhHHHHHHhhhcCCCCCCCCCccccCccCcccCCchhh
Q psy12016         20 FTCDVCFKEYKYKRGLVRHKKNSCKQKPQNLDGLFSCDVCGKHYKYKKGL   69 (111)
Q Consensus        20 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l   69 (111)
                      ..|+.|++.|....           ..+      ..|+.||..+.....+
T Consensus        10 r~Cp~cg~kFYDLn-----------k~p------~vcP~cg~~~~~~~~~   42 (129)
T TIGR02300        10 RICPNTGSKFYDLN-----------RRP------AVSPYTGEQFPPEEAL   42 (129)
T ss_pred             ccCCCcCccccccC-----------CCC------ccCCCcCCccCcchhh
Confidence            46888888775532           234      6888888877665443


No 99 
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=79.39  E-value=1.1  Score=24.88  Aligned_cols=22  Identities=27%  Similarity=0.427  Sum_probs=17.6

Q ss_pred             cccCCCCcccccchhHHHHHHHhhC
Q psy12016         83 YECDQCPHRTKHISSLKKHMALKHG  107 (111)
Q Consensus        83 ~~C~~C~~~f~~~~~l~~H~~~~~~  107 (111)
                      ..|-++|+.|.+   |++|+.+|+|
T Consensus        77 IicLEDGkkfKS---LKRHL~t~~g   98 (148)
T COG4957          77 IICLEDGKKFKS---LKRHLTTHYG   98 (148)
T ss_pred             EEEeccCcchHH---HHHHHhcccC
Confidence            468888888854   7999988876


No 100
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=79.33  E-value=0.66  Score=24.26  Aligned_cols=13  Identities=38%  Similarity=0.956  Sum_probs=7.3

Q ss_pred             CCCccccCccCcc
Q psy12016         50 LDGLFSCDVCGKH   62 (111)
Q Consensus        50 ~~~~~~c~~c~~~   62 (111)
                      +++.|.|+.|+..
T Consensus        19 L~k~FtCp~Cghe   31 (104)
T COG4888          19 LPKTFTCPRCGHE   31 (104)
T ss_pred             CCceEecCccCCe
Confidence            4455666666544


No 101
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=79.16  E-value=1.4  Score=24.40  Aligned_cols=15  Identities=27%  Similarity=0.696  Sum_probs=9.5

Q ss_pred             CceecCCCcccccch
Q psy12016         18 GMFTCDVCFKEYKYK   32 (111)
Q Consensus        18 ~~~~C~~C~~~f~~~   32 (111)
                      ..+.|..|+..|...
T Consensus        69 ~~~~C~~CG~~~~~~   83 (135)
T PRK03824         69 AVLKCRNCGNEWSLK   83 (135)
T ss_pred             eEEECCCCCCEEecc
Confidence            446777777666553


No 102
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=78.87  E-value=2.4  Score=16.31  Aligned_cols=19  Identities=32%  Similarity=0.644  Sum_probs=11.4

Q ss_pred             ecCCCcccccchhHHHHHHh
Q psy12016         21 TCDVCFKEYKYKRGLVRHKK   40 (111)
Q Consensus        21 ~C~~C~~~f~~~~~l~~h~~   40 (111)
                      .|+.|++.+ ....+..|..
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            477777776 3345555543


No 103
>KOG2785|consensus
Probab=78.63  E-value=4.1  Score=26.70  Aligned_cols=58  Identities=17%  Similarity=0.159  Sum_probs=35.4

Q ss_pred             CCceecCCCcccccchhHHHHHHhhhcCCCCCCC-----------------CCccccCccC---cccCCchhhHhhhh
Q psy12016         17 SGMFTCDVCFKEYKYKRGLVRHKKNSCKQKPQNL-----------------DGLFSCDVCG---KHYKYKKGLGRHKR   74 (111)
Q Consensus        17 ~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~-----------------~~~~~c~~c~---~~~~~~~~l~~h~~   74 (111)
                      ..|-.|-.|+..+.....-..||..+++-.....                 ...+.|..|+   ..|.+...++.||.
T Consensus       164 ~~Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~  241 (390)
T KOG2785|consen  164 LIPTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMR  241 (390)
T ss_pred             cCCcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHh
Confidence            3456688899988888888888876655322111                 1234555555   55555555666655


No 104
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=78.23  E-value=0.78  Score=20.83  Aligned_cols=8  Identities=25%  Similarity=0.912  Sum_probs=4.2

Q ss_pred             ccccCCCC
Q psy12016         82 KYECDQCP   89 (111)
Q Consensus        82 ~~~C~~C~   89 (111)
                      .|.|+.|+
T Consensus        34 ~w~CP~C~   41 (50)
T cd00730          34 DWVCPVCG   41 (50)
T ss_pred             CCCCCCCC
Confidence            34555554


No 105
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=77.01  E-value=2.7  Score=25.34  Aligned_cols=26  Identities=27%  Similarity=0.413  Sum_probs=20.6

Q ss_pred             CCCceecCCCcccccchhHHHHHHhh
Q psy12016         16 DSGMFTCDVCFKEYKYKRGLVRHKKN   41 (111)
Q Consensus        16 ~~~~~~C~~C~~~f~~~~~l~~h~~~   41 (111)
                      .+.-|.|+.|++.|.....+..|+..
T Consensus        74 ~~~K~~C~lc~KlFkg~eFV~KHI~n   99 (214)
T PF04959_consen   74 DEDKWRCPLCGKLFKGPEFVRKHIFN   99 (214)
T ss_dssp             SSEEEEE-SSS-EESSHHHHHHHHHH
T ss_pred             cCCEECCCCCCcccCChHHHHHHHhh
Confidence            44569999999999999999999865


No 106
>PF14353 CpXC:  CpXC protein
Probab=76.59  E-value=1.1  Score=24.38  Aligned_cols=21  Identities=29%  Similarity=0.735  Sum_probs=14.3

Q ss_pred             cccCccCcccCCchhhHhhhh
Q psy12016         54 FSCDVCGKHYKYKKGLGRHKR   74 (111)
Q Consensus        54 ~~c~~c~~~~~~~~~l~~h~~   74 (111)
                      +.|+.||..+.....+.-|..
T Consensus        39 ~~CP~Cg~~~~~~~p~lY~D~   59 (128)
T PF14353_consen   39 FTCPSCGHKFRLEYPLLYHDP   59 (128)
T ss_pred             EECCCCCCceecCCCEEEEcC
Confidence            688888888776665554443


No 107
>KOG3408|consensus
Probab=75.80  E-value=1.6  Score=23.67  Aligned_cols=22  Identities=23%  Similarity=0.529  Sum_probs=19.0

Q ss_pred             ccccCCCCcccccchhHHHHHH
Q psy12016         82 KYECDQCPHRTKHISSLKKHMA  103 (111)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~  103 (111)
                      .|.|..|.+.|.+...|..|.+
T Consensus        57 qfyCi~CaRyFi~~~~l~~H~k   78 (129)
T KOG3408|consen   57 QFYCIECARYFIDAKALKTHFK   78 (129)
T ss_pred             eeehhhhhhhhcchHHHHHHHh
Confidence            6889999999999988888865


No 108
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=75.62  E-value=4.2  Score=26.04  Aligned_cols=48  Identities=17%  Similarity=0.298  Sum_probs=27.0

Q ss_pred             ccCccCcccCCchhhHhhhhhhcCCCCccccCCCCcccccchhHHHHHHHh
Q psy12016         55 SCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPHRTKHISSLKKHMALK  105 (111)
Q Consensus        55 ~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~  105 (111)
                      .|-.|-..|+-...-..-..  .... .|.|+.|...|....+.-.|...|
T Consensus       364 ~Cf~CQ~~fp~~~~~~~~~~--~ss~-rY~Ce~CK~~FC~dCdvfiHe~Lh  411 (421)
T COG5151         364 HCFVCQGPFPKPPVSPFDES--TSSG-RYQCELCKSTFCSDCDVFIHETLH  411 (421)
T ss_pred             cceeccCCCCCCCCCccccc--cccc-ceechhhhhhhhhhhHHHHHHHHh
Confidence            35666655554432111111  1123 689999998888777766665443


No 109
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=75.27  E-value=2.5  Score=19.15  Aligned_cols=10  Identities=30%  Similarity=0.863  Sum_probs=5.1

Q ss_pred             eecCCCcccc
Q psy12016         20 FTCDVCFKEY   29 (111)
Q Consensus        20 ~~C~~C~~~f   29 (111)
                      |.|..|++.|
T Consensus         7 Y~C~~Cg~~~   16 (49)
T COG1996           7 YKCARCGREV   16 (49)
T ss_pred             EEhhhcCCee
Confidence            4455555544


No 110
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=74.77  E-value=1  Score=23.20  Aligned_cols=31  Identities=29%  Similarity=0.744  Sum_probs=20.2

Q ss_pred             cccCccCcccCCchhhHhhhhhhcCCCCccccCCCCcccccc
Q psy12016         54 FSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPHRTKHI   95 (111)
Q Consensus        54 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~~   95 (111)
                      |.|+.|++.-.        .+...|   .|.|..|+..|+-.
T Consensus        36 y~Cp~Cgk~~v--------kR~a~G---IW~C~~C~~~~AGG   66 (90)
T PF01780_consen   36 YTCPFCGKTSV--------KRVATG---IWKCKKCGKKFAGG   66 (90)
T ss_dssp             BEESSSSSSEE--------EEEETT---EEEETTTTEEEE-B
T ss_pred             CcCCCCCCcee--------EEeeeE---EeecCCCCCEEeCC
Confidence            89999987621        122222   78999999888543


No 111
>PHA00626 hypothetical protein
Probab=74.66  E-value=2.7  Score=19.57  Aligned_cols=17  Identities=18%  Similarity=0.198  Sum_probs=10.6

Q ss_pred             CCceecCCCcccccchh
Q psy12016         17 SGMFTCDVCFKEYKYKR   33 (111)
Q Consensus        17 ~~~~~C~~C~~~f~~~~   33 (111)
                      ...|.|+.|+..|+...
T Consensus        21 snrYkCkdCGY~ft~~~   37 (59)
T PHA00626         21 SDDYVCCDCGYNDSKDA   37 (59)
T ss_pred             CcceEcCCCCCeechhh
Confidence            34577777777665543


No 112
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=74.23  E-value=1.8  Score=16.74  Aligned_cols=10  Identities=20%  Similarity=0.660  Sum_probs=7.4

Q ss_pred             ecCCCccccc
Q psy12016         21 TCDVCFKEYK   30 (111)
Q Consensus        21 ~C~~C~~~f~   30 (111)
                      .|+.||..|.
T Consensus        16 ~Cp~CG~~F~   25 (26)
T PF10571_consen   16 FCPHCGYDFE   25 (26)
T ss_pred             cCCCCCCCCc
Confidence            5788887774


No 113
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=73.49  E-value=1.4  Score=22.77  Aligned_cols=31  Identities=26%  Similarity=0.581  Sum_probs=19.9

Q ss_pred             cccCccCcccCCchhhHhhhhhhcCCCCccccCCCCcccccc
Q psy12016         54 FSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPHRTKHI   95 (111)
Q Consensus        54 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~~   95 (111)
                      |.|+.|++.-.        .+...  . .|.|..|++.|+-.
T Consensus        36 y~CpfCgk~~v--------kR~a~--G-IW~C~~C~~~~AGG   66 (91)
T TIGR00280        36 YVCPFCGKKTV--------KRGST--G-IWTCRKCGAKFAGG   66 (91)
T ss_pred             ccCCCCCCCce--------EEEee--E-EEEcCCCCCEEeCC
Confidence            88999985411        11221  2 78899999887544


No 114
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=73.46  E-value=1.5  Score=22.59  Aligned_cols=31  Identities=29%  Similarity=0.641  Sum_probs=20.0

Q ss_pred             cccCccCcccCCchhhHhhhhhhcCCCCccccCCCCcccccc
Q psy12016         54 FSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPHRTKHI   95 (111)
Q Consensus        54 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~~   95 (111)
                      |.|+.|++.-.        .+...   ..|.|..|++.|+-.
T Consensus        37 y~CpfCgk~~v--------kR~a~---GIW~C~~C~~~~AGG   67 (90)
T PTZ00255         37 YFCPFCGKHAV--------KRQAV---GIWRCKGCKKTVAGG   67 (90)
T ss_pred             ccCCCCCCCce--------eeeee---EEEEcCCCCCEEeCC
Confidence            89999985421        11111   278999999888654


No 115
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=73.37  E-value=1.9  Score=30.80  Aligned_cols=10  Identities=20%  Similarity=0.683  Sum_probs=7.6

Q ss_pred             ccccCCCCcc
Q psy12016         82 KYECDQCPHR   91 (111)
Q Consensus        82 ~~~C~~C~~~   91 (111)
                      |..|+.||..
T Consensus       475 p~~Cp~Cgs~  484 (730)
T COG1198         475 PQSCPECGSE  484 (730)
T ss_pred             CCCCCCCCCC
Confidence            7788888854


No 116
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=72.90  E-value=2.5  Score=18.03  Aligned_cols=15  Identities=20%  Similarity=0.383  Sum_probs=12.5

Q ss_pred             ceecCCCcccccchh
Q psy12016         19 MFTCDVCFKEYKYKR   33 (111)
Q Consensus        19 ~~~C~~C~~~f~~~~   33 (111)
                      |+.|..|+..|..+.
T Consensus        12 ~f~C~~C~~~FC~~H   26 (39)
T smart00154       12 GFKCRHCGNLFCGEH   26 (39)
T ss_pred             CeECCccCCcccccc
Confidence            788999999988763


No 117
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=72.80  E-value=2.8  Score=23.15  Aligned_cols=15  Identities=13%  Similarity=0.370  Sum_probs=11.5

Q ss_pred             ceecCCCcccccchh
Q psy12016         19 MFTCDVCFKEYKYKR   33 (111)
Q Consensus        19 ~~~C~~C~~~f~~~~   33 (111)
                      |..|..|++.|..-+
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            567888998887654


No 118
>KOG2785|consensus
Probab=72.67  E-value=4.6  Score=26.50  Aligned_cols=50  Identities=22%  Similarity=0.305  Sum_probs=39.8

Q ss_pred             cccCccCcccCCchhhHhhhhhhcCCC----------------------CccccCCCC---cccccchhHHHHHH
Q psy12016         54 FSCDVCGKHYKYKKGLGRHKRYECGQE----------------------PKYECDQCP---HRTKHISSLKKHMA  103 (111)
Q Consensus        54 ~~c~~c~~~~~~~~~l~~h~~~~~~~~----------------------~~~~C~~C~---~~f~~~~~l~~H~~  103 (111)
                      -.|..|+..+.....-..||..+++-.                      ..+.|-.|+   +.|.+....+.||.
T Consensus       167 t~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~  241 (390)
T KOG2785|consen  167 TDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMR  241 (390)
T ss_pred             cceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHh
Confidence            468889999998888888988887631                      146888899   88888888888875


No 119
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=72.29  E-value=2  Score=17.28  Aligned_cols=9  Identities=33%  Similarity=0.903  Sum_probs=4.9

Q ss_pred             ccccCCCCc
Q psy12016         82 KYECDQCPH   90 (111)
Q Consensus        82 ~~~C~~C~~   90 (111)
                      .+.|+.|+.
T Consensus        19 ~~vCp~C~~   27 (30)
T PF08274_consen   19 LLVCPECGH   27 (30)
T ss_dssp             SEEETTTTE
T ss_pred             EEeCCcccc
Confidence            455655553


No 120
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=72.08  E-value=1.6  Score=19.98  Aligned_cols=26  Identities=15%  Similarity=0.359  Sum_probs=15.4

Q ss_pred             CCceecCCCcccccchhHHHHHHhhh
Q psy12016         17 SGMFTCDVCFKEYKYKRGLVRHKKNS   42 (111)
Q Consensus        17 ~~~~~C~~C~~~f~~~~~l~~h~~~~   42 (111)
                      ...|.|+.|...|...=++-.|...|
T Consensus        19 ~~~y~C~~C~~~FC~dCD~fiHE~LH   44 (51)
T PF07975_consen   19 SSRYRCPKCKNHFCIDCDVFIHETLH   44 (51)
T ss_dssp             -EEE--TTTT--B-HHHHHTTTTTS-
T ss_pred             CCeEECCCCCCccccCcChhhhcccc
Confidence            35699999999999988887776554


No 121
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=71.82  E-value=7.1  Score=24.19  Aligned_cols=13  Identities=23%  Similarity=0.687  Sum_probs=9.5

Q ss_pred             CCceecCCCcccc
Q psy12016         17 SGMFTCDVCFKEY   29 (111)
Q Consensus        17 ~~~~~C~~C~~~f   29 (111)
                      ...|.|..|+..+
T Consensus       110 drqFaC~~Cd~~W  122 (278)
T PF15135_consen  110 DRQFACSSCDHMW  122 (278)
T ss_pred             ceeeeccccchHH
Confidence            3678999997543


No 122
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=71.23  E-value=3.6  Score=22.08  Aligned_cols=13  Identities=15%  Similarity=0.112  Sum_probs=6.9

Q ss_pred             ceecCCCcccccc
Q psy12016         19 MFTCDVCFKEYKY   31 (111)
Q Consensus        19 ~~~C~~C~~~f~~   31 (111)
                      ...|..|+..|..
T Consensus        70 ~~~C~~Cg~~~~~   82 (113)
T PRK12380         70 QAWCWDCSQVVEI   82 (113)
T ss_pred             EEEcccCCCEEec
Confidence            3556666655433


No 123
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=71.06  E-value=3.2  Score=17.38  Aligned_cols=33  Identities=21%  Similarity=0.415  Sum_probs=18.4

Q ss_pred             cccCccCcccCCchhhHhhhhhhcCCCCccccCCCCcccccc
Q psy12016         54 FSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPHRTKHI   95 (111)
Q Consensus        54 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~~   95 (111)
                      ..|..||..|-...        ..... +-.|+.||..+..+
T Consensus         2 r~C~~Cg~~Yh~~~--------~pP~~-~~~Cd~cg~~L~qR   34 (36)
T PF05191_consen    2 RICPKCGRIYHIEF--------NPPKV-EGVCDNCGGELVQR   34 (36)
T ss_dssp             EEETTTTEEEETTT--------B--SS-TTBCTTTTEBEBEE
T ss_pred             cCcCCCCCcccccc--------CCCCC-CCccCCCCCeeEeC
Confidence            46777877754322        22223 56788888665443


No 124
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=70.69  E-value=1.8  Score=19.57  Aligned_cols=12  Identities=25%  Similarity=1.088  Sum_probs=5.4

Q ss_pred             cccCccCcccCC
Q psy12016         54 FSCDVCGKHYKY   65 (111)
Q Consensus        54 ~~c~~c~~~~~~   65 (111)
                      +.|..||..|..
T Consensus         5 l~C~dCg~~Fvf   16 (49)
T PF13451_consen    5 LTCKDCGAEFVF   16 (49)
T ss_pred             EEcccCCCeEEE
Confidence            444445444433


No 125
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=70.36  E-value=1.7  Score=22.36  Aligned_cols=31  Identities=32%  Similarity=0.674  Sum_probs=19.9

Q ss_pred             cccCccCcccCCchhhHhhhhhhcCCCCccccCCCCcccccc
Q psy12016         54 FSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPHRTKHI   95 (111)
Q Consensus        54 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~~   95 (111)
                      |.|+.|++.-.        .+...|   .|.|..|+..|+-.
T Consensus        37 y~CpfCgk~~v--------kR~a~G---IW~C~~C~~~~AGG   67 (90)
T PRK03976         37 HVCPVCGRPKV--------KRVGTG---IWECRKCGAKFAGG   67 (90)
T ss_pred             ccCCCCCCCce--------EEEEEE---EEEcCCCCCEEeCC
Confidence            88999975411        112222   78899999887553


No 126
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=69.99  E-value=3.2  Score=19.20  Aligned_cols=11  Identities=36%  Similarity=1.020  Sum_probs=5.9

Q ss_pred             cccCccCcccC
Q psy12016         54 FSCDVCGKHYK   64 (111)
Q Consensus        54 ~~c~~c~~~~~   64 (111)
                      +.|+.|+..+.
T Consensus         3 ~~CP~CG~~ie   13 (54)
T TIGR01206         3 FECPDCGAEIE   13 (54)
T ss_pred             cCCCCCCCEEe
Confidence            45666665443


No 127
>KOG4727|consensus
Probab=69.93  E-value=3.1  Score=24.12  Aligned_cols=23  Identities=30%  Similarity=0.491  Sum_probs=20.0

Q ss_pred             CceecCCCcccccchhHHHHHHh
Q psy12016         18 GMFTCDVCFKEYKYKRGLVRHKK   40 (111)
Q Consensus        18 ~~~~C~~C~~~f~~~~~l~~h~~   40 (111)
                      .-|.|.+|+-+|....++..|+.
T Consensus        74 ~GyyCdVCdcvvKDSinflDHiN   96 (193)
T KOG4727|consen   74 GGYYCDVCDCVVKDSINFLDHIN   96 (193)
T ss_pred             CceeeeecceeehhhHHHHHHhc
Confidence            34899999999999999998864


No 128
>KOG2593|consensus
Probab=69.28  E-value=5.5  Score=26.64  Aligned_cols=14  Identities=29%  Similarity=0.764  Sum_probs=7.3

Q ss_pred             cccCccCcccCCch
Q psy12016         54 FSCDVCGKHYKYKK   67 (111)
Q Consensus        54 ~~c~~c~~~~~~~~   67 (111)
                      |.|+.|.+.|....
T Consensus       129 Y~Cp~C~kkyt~Le  142 (436)
T KOG2593|consen  129 YVCPNCQKKYTSLE  142 (436)
T ss_pred             ccCCccccchhhhH
Confidence            55555555554443


No 129
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=69.28  E-value=10  Score=24.81  Aligned_cols=76  Identities=24%  Similarity=0.329  Sum_probs=49.0

Q ss_pred             eecCCCcccccchhHHHHHHhhhcCCCCCCCCCccccCccC----cccCCchhhHhhhhhhcCCCCccccCC--CC----
Q psy12016         20 FTCDVCFKEYKYKRGLVRHKKNSCKQKPQNLDGLFSCDVCG----KHYKYKKGLGRHKRYECGQEPKYECDQ--CP----   89 (111)
Q Consensus        20 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~c~~c~----~~~~~~~~l~~h~~~~~~~~~~~~C~~--C~----   89 (111)
                      ..|..|...|.....|..|++..... -      +.|+.-+    +.|.+...|..|.+.    - .|.|.+  |.    
T Consensus       221 P~C~FC~~~FYdDDEL~~HcR~~HE~-C------hICD~v~p~~~QYFK~Y~~Le~HF~~----~-hy~ct~qtc~~~k~  288 (493)
T COG5236         221 PLCIFCKIYFYDDDELRRHCRLRHEA-C------HICDMVGPIRYQYFKSYEDLEAHFRN----A-HYCCTFQTCRVGKC  288 (493)
T ss_pred             chhhhccceecChHHHHHHHHhhhhh-h------hhhhccCccchhhhhCHHHHHHHhhc----C-ceEEEEEEEecCcE
Confidence            46999999999999999998865432 2      4555433    234444556555543    2 566532  22    


Q ss_pred             cccccchhHHHHHHHhhC
Q psy12016         90 HRTKHISSLKKHMALKHG  107 (111)
Q Consensus        90 ~~f~~~~~l~~H~~~~~~  107 (111)
                      ..|.....|..|+-..|+
T Consensus       289 ~vf~~~~el~~h~~~~h~  306 (493)
T COG5236         289 YVFPYHTELLEHLTRFHK  306 (493)
T ss_pred             EEeccHHHHHHHHHHHhh
Confidence            357778888888766654


No 130
>KOG2593|consensus
Probab=69.02  E-value=5.3  Score=26.67  Aligned_cols=41  Identities=22%  Similarity=0.515  Sum_probs=26.1

Q ss_pred             cCCCCceecCCCcccccchhHHHHHHhhhcCCCCCCCCCccccCccCccc
Q psy12016         14 QNDSGMFTCDVCFKEYKYKRGLVRHKKNSCKQKPQNLDGLFSCDVCGKHY   63 (111)
Q Consensus        14 ~~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~c~~c~~~~   63 (111)
                      .+...-|.|+.|.+.|.....++   ......-.      |.|..|+...
T Consensus       123 ~t~~~~Y~Cp~C~kkyt~Lea~~---L~~~~~~~------F~C~~C~gel  163 (436)
T KOG2593|consen  123 DTNVAGYVCPNCQKKYTSLEALQ---LLDNETGE------FHCENCGGEL  163 (436)
T ss_pred             ccccccccCCccccchhhhHHHH---hhcccCce------EEEecCCCch
Confidence            34456699999999988765443   22221122      8999998653


No 131
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=68.08  E-value=1.4  Score=18.91  Aligned_cols=10  Identities=50%  Similarity=1.198  Sum_probs=5.6

Q ss_pred             cccCCCCccc
Q psy12016         83 YECDQCPHRT   92 (111)
Q Consensus        83 ~~C~~C~~~f   92 (111)
                      |.|..|+..|
T Consensus        29 y~C~~C~~~w   38 (40)
T smart00440       29 YVCTKCGHRW   38 (40)
T ss_pred             EEeCCCCCEe
Confidence            5566666544


No 132
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=68.02  E-value=4  Score=21.97  Aligned_cols=13  Identities=23%  Similarity=0.457  Sum_probs=7.8

Q ss_pred             ceecCCCcccccc
Q psy12016         19 MFTCDVCFKEYKY   31 (111)
Q Consensus        19 ~~~C~~C~~~f~~   31 (111)
                      ...|..|+..|..
T Consensus        70 ~~~C~~Cg~~~~~   82 (115)
T TIGR00100        70 ECECEDCSEEVSP   82 (115)
T ss_pred             EEEcccCCCEEec
Confidence            3567777765544


No 133
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=67.85  E-value=4.6  Score=21.31  Aligned_cols=14  Identities=14%  Similarity=0.342  Sum_probs=11.0

Q ss_pred             ceecCCCcccccch
Q psy12016         19 MFTCDVCFKEYKYK   32 (111)
Q Consensus        19 ~~~C~~C~~~f~~~   32 (111)
                      |..|..||..|..-
T Consensus         2 pH~CtrCG~vf~~g   15 (112)
T COG3364           2 PHQCTRCGEVFDDG   15 (112)
T ss_pred             Cceecccccccccc
Confidence            56788888888774


No 134
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=67.33  E-value=2.9  Score=20.61  Aligned_cols=16  Identities=13%  Similarity=0.499  Sum_probs=10.1

Q ss_pred             cccC--ccCcccCCchhh
Q psy12016         54 FSCD--VCGKHYKYKKGL   69 (111)
Q Consensus        54 ~~c~--~c~~~~~~~~~l   69 (111)
                      +.|.  .||..|.....+
T Consensus        28 ~qC~N~eCg~tF~t~es~   45 (72)
T PRK09678         28 HQCQNVNCSATFITYESV   45 (72)
T ss_pred             eecCCCCCCCEEEEEEEE
Confidence            5676  677776665443


No 135
>PLN02294 cytochrome c oxidase subunit Vb
Probab=67.18  E-value=3.3  Score=23.98  Aligned_cols=17  Identities=24%  Similarity=0.688  Sum_probs=11.9

Q ss_pred             CCCceecCCCcccccch
Q psy12016         16 DSGMFTCDVCFKEYKYK   32 (111)
Q Consensus        16 ~~~~~~C~~C~~~f~~~   32 (111)
                      ..+|.+|++||..|..+
T Consensus       138 kGkp~RCpeCG~~fkL~  154 (174)
T PLN02294        138 KGKSFECPVCTQYFELE  154 (174)
T ss_pred             CCCceeCCCCCCEEEEE
Confidence            34577788888877654


No 136
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=66.96  E-value=3.5  Score=15.63  Aligned_cols=10  Identities=30%  Similarity=0.434  Sum_probs=7.4

Q ss_pred             CceecCCCcc
Q psy12016         18 GMFTCDVCFK   27 (111)
Q Consensus        18 ~~~~C~~C~~   27 (111)
                      .+|.|+.||+
T Consensus        15 v~f~CPnCG~   24 (24)
T PF07754_consen   15 VPFPCPNCGF   24 (24)
T ss_pred             ceEeCCCCCC
Confidence            4688888874


No 137
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=66.60  E-value=3.3  Score=22.29  Aligned_cols=14  Identities=14%  Similarity=0.361  Sum_probs=8.5

Q ss_pred             CceecCCCcccccc
Q psy12016         18 GMFTCDVCFKEYKY   31 (111)
Q Consensus        18 ~~~~C~~C~~~f~~   31 (111)
                      ....|..|+..|..
T Consensus        69 ~~~~C~~Cg~~~~~   82 (114)
T PRK03681         69 AECWCETCQQYVTL   82 (114)
T ss_pred             cEEEcccCCCeeec
Confidence            34667777765533


No 138
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=65.94  E-value=4.2  Score=21.30  Aligned_cols=16  Identities=19%  Similarity=0.291  Sum_probs=11.8

Q ss_pred             CCceecCCCcccccch
Q psy12016         17 SGMFTCDVCFKEYKYK   32 (111)
Q Consensus        17 ~~~~~C~~C~~~f~~~   32 (111)
                      .+|.+|..||..|...
T Consensus        77 g~~~rC~eCG~~fkL~   92 (97)
T cd00924          77 GKPKRCPECGHVFKLV   92 (97)
T ss_pred             CCceeCCCCCcEEEEE
Confidence            3678888888887653


No 139
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=65.55  E-value=3.9  Score=23.11  Aligned_cols=10  Identities=30%  Similarity=1.026  Sum_probs=5.6

Q ss_pred             ccccCccCcc
Q psy12016         53 LFSCDVCGKH   62 (111)
Q Consensus        53 ~~~c~~c~~~   62 (111)
                      .+.|..||..
T Consensus       112 ~l~C~~Cg~~  121 (146)
T PF07295_consen  112 TLVCENCGHE  121 (146)
T ss_pred             eEecccCCCE
Confidence            3566666644


No 140
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=65.52  E-value=3.4  Score=17.93  Aligned_cols=16  Identities=31%  Similarity=0.544  Sum_probs=10.6

Q ss_pred             CceecCCCcccccchh
Q psy12016         18 GMFTCDVCFKEYKYKR   33 (111)
Q Consensus        18 ~~~~C~~C~~~f~~~~   33 (111)
                      .|+.|..|+..|....
T Consensus        12 ~~~~C~~C~~~FC~~H   27 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLKH   27 (43)
T ss_dssp             SHEE-TTTS-EE-TTT
T ss_pred             CCeECCCCCcccCccc
Confidence            5789999999998764


No 141
>KOG4167|consensus
Probab=65.29  E-value=1.5  Score=31.17  Aligned_cols=25  Identities=24%  Similarity=0.445  Sum_probs=21.8

Q ss_pred             ccccCCCCcccccchhHHHHHHHhh
Q psy12016         82 KYECDQCPHRTKHISSLKKHMALKH  106 (111)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~~~~  106 (111)
                      .|.|.+|++.|.---++..||++|.
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHH
Confidence            5889999999988888888998886


No 142
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=64.83  E-value=5.4  Score=24.89  Aligned_cols=27  Identities=19%  Similarity=0.523  Sum_probs=18.5

Q ss_pred             hcCCCCceecCCCcccccchhHHHHHHh
Q psy12016         13 WQNDSGMFTCDVCFKEYKYKRGLVRHKK   40 (111)
Q Consensus        13 ~~~~~~~~~C~~C~~~f~~~~~l~~h~~   40 (111)
                      |..+.+.|.|..|......-..+. |++
T Consensus       136 w~hGGrif~CsfC~~flCEDDQFE-HQA  162 (314)
T PF06524_consen  136 WDHGGRIFKCSFCDNFLCEDDQFE-HQA  162 (314)
T ss_pred             ccCCCeEEEeecCCCeeeccchhh-hhh
Confidence            445677899999987766665544 444


No 143
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=63.96  E-value=9.8  Score=16.36  Aligned_cols=24  Identities=29%  Similarity=0.290  Sum_probs=15.8

Q ss_pred             ceecCCCcccccch--hHHHHHHhhh
Q psy12016         19 MFTCDVCFKEYKYK--RGLVRHKKNS   42 (111)
Q Consensus        19 ~~~C~~C~~~f~~~--~~l~~h~~~~   42 (111)
                      .-.|+.|+..+...  .+-..|.+.|
T Consensus        13 ~~~C~~CgM~Y~~~~~eD~~~H~~yH   38 (41)
T PF13878_consen   13 ATTCPTCGMLYSPGSPEDEKLHKKYH   38 (41)
T ss_pred             CcCCCCCCCEECCCCHHHHHHHHHHH
Confidence            35799999776654  5556665554


No 144
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=62.87  E-value=12  Score=21.88  Aligned_cols=17  Identities=18%  Similarity=0.821  Sum_probs=9.7

Q ss_pred             CCCceecCCCcccccch
Q psy12016         16 DSGMFTCDVCFKEYKYK   32 (111)
Q Consensus        16 ~~~~~~C~~C~~~f~~~   32 (111)
                      ....|.|+.|...++..
T Consensus       110 ~~~~y~C~~~~~r~sfd  126 (176)
T COG1675         110 ENNYYVCPNCHVKYSFD  126 (176)
T ss_pred             cCCceeCCCCCCcccHH
Confidence            44456776666555443


No 145
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=62.65  E-value=6.5  Score=26.68  Aligned_cols=22  Identities=23%  Similarity=0.516  Sum_probs=11.8

Q ss_pred             cccCCCCcccccchhHHHHHHH
Q psy12016         83 YECDQCPHRTKHISSLKKHMAL  104 (111)
Q Consensus        83 ~~C~~C~~~f~~~~~l~~H~~~  104 (111)
                      +.|+.|.+.|.....+..|+..
T Consensus        58 WiCp~CskkF~d~~~~~~H~~~   79 (466)
T PF04780_consen   58 WICPRCSKKFSDAESCLSHMEQ   79 (466)
T ss_pred             eeCCcccceeCCHHHHHHHHHH
Confidence            3455555555555555555543


No 146
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=60.16  E-value=6.4  Score=17.18  Aligned_cols=15  Identities=13%  Similarity=0.233  Sum_probs=10.3

Q ss_pred             ccCCCCcccccchhH
Q psy12016         84 ECDQCPHRTKHISSL   98 (111)
Q Consensus        84 ~C~~C~~~f~~~~~l   98 (111)
                      .|..|++.|.+.--+
T Consensus        10 ~C~~C~rpf~WRKKW   24 (42)
T PF10013_consen   10 ICPVCGRPFTWRKKW   24 (42)
T ss_pred             cCcccCCcchHHHHH
Confidence            578888888765443


No 147
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=59.99  E-value=4.4  Score=20.16  Aligned_cols=10  Identities=20%  Similarity=0.906  Sum_probs=7.4

Q ss_pred             eecCCCcccc
Q psy12016         20 FTCDVCFKEY   29 (111)
Q Consensus        20 ~~C~~C~~~f   29 (111)
                      |.|..|+..|
T Consensus        13 Y~c~~cg~~~   22 (82)
T COG2331          13 YECTECGNRF   22 (82)
T ss_pred             EeecccchHH
Confidence            6788887765


No 148
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=59.92  E-value=3.6  Score=19.21  Aligned_cols=8  Identities=50%  Similarity=1.443  Sum_probs=4.7

Q ss_pred             ccccCCCC
Q psy12016         82 KYECDQCP   89 (111)
Q Consensus        82 ~~~C~~C~   89 (111)
                      .|.|+.|.
T Consensus        31 tYmC~eC~   38 (56)
T PF09963_consen   31 TYMCDECK   38 (56)
T ss_pred             ceeChhHH
Confidence            56666664


No 149
>PRK14873 primosome assembly protein PriA; Provisional
Probab=59.68  E-value=4  Score=28.99  Aligned_cols=10  Identities=20%  Similarity=0.889  Sum_probs=6.8

Q ss_pred             ccccCCCCcc
Q psy12016         82 KYECDQCPHR   91 (111)
Q Consensus        82 ~~~C~~C~~~   91 (111)
                      |+.|+.|+..
T Consensus       422 p~~Cp~Cgs~  431 (665)
T PRK14873        422 DWRCPRCGSD  431 (665)
T ss_pred             CccCCCCcCC
Confidence            6677777754


No 150
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=59.52  E-value=5.9  Score=21.77  Aligned_cols=42  Identities=17%  Similarity=0.269  Sum_probs=21.6

Q ss_pred             cccCccCcccCCchhhHhhhhhhcCCCCccccCCCCcccccc
Q psy12016         54 FSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPHRTKHI   95 (111)
Q Consensus        54 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~~   95 (111)
                      ..|+.|.....-...+..=+.....-++|--|.-||+.|.+.
T Consensus        40 ~qcp~csasirgd~~vegvlglg~dye~psfchncgs~fpwt   81 (160)
T COG4306          40 TQCPICSASIRGDYYVEGVLGLGGDYEPPSFCHNCGSRFPWT   81 (160)
T ss_pred             hcCCccCCcccccceeeeeeccCCCCCCcchhhcCCCCCCcH
Confidence            367777655443333322222222223356688888888764


No 151
>KOG1146|consensus
Probab=59.45  E-value=2.9  Score=31.82  Aligned_cols=48  Identities=19%  Similarity=0.189  Sum_probs=28.5

Q ss_pred             ccCcccCCchhhHhhhhhhcCCCCccccCCCCcccccchhHHHHHHHh
Q psy12016         58 VCGKHYKYKKGLGRHKRYECGQEPKYECDQCPHRTKHISSLKKHMALK  105 (111)
Q Consensus        58 ~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~  105 (111)
                      .++..+.+...+..++.+.....+.+.|+.|+..|.....|..|++.-
T Consensus       441 ~~e~~~~s~r~~~~~t~~L~S~~kt~~cpkc~~~yk~a~~L~vhmRsk  488 (1406)
T KOG1146|consen  441 KAEPLLESKRSLEGQTVVLHSFFKTLKCPKCNWHYKLAQTLGVHMRSK  488 (1406)
T ss_pred             chhhhhhhhcccccceeeeecccccccCCccchhhhhHHHhhhccccc
Confidence            344444444444444444333233777888887777777777777763


No 152
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=59.06  E-value=4.6  Score=23.05  Aligned_cols=15  Identities=13%  Similarity=0.297  Sum_probs=12.8

Q ss_pred             ccccCCCCcccccch
Q psy12016         82 KYECDQCPHRTKHIS   96 (111)
Q Consensus        82 ~~~C~~C~~~f~~~~   96 (111)
                      |..|..||+.|+|-.
T Consensus        68 PsYC~~CGkpyPWt~   82 (158)
T PF10083_consen   68 PSYCHNCGKPYPWTE   82 (158)
T ss_pred             ChhHHhCCCCCchHH
Confidence            788999999998864


No 153
>PRK04023 DNA polymerase II large subunit; Validated
Probab=58.89  E-value=9.6  Score=28.60  Aligned_cols=11  Identities=45%  Similarity=0.748  Sum_probs=7.5

Q ss_pred             CceecCCCccc
Q psy12016         18 GMFTCDVCFKE   28 (111)
Q Consensus        18 ~~~~C~~C~~~   28 (111)
                      ....|+.||..
T Consensus       625 g~RfCpsCG~~  635 (1121)
T PRK04023        625 GRRKCPSCGKE  635 (1121)
T ss_pred             cCccCCCCCCc
Confidence            34568888866


No 154
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=58.59  E-value=6.6  Score=18.02  Aligned_cols=20  Identities=30%  Similarity=0.524  Sum_probs=9.6

Q ss_pred             hhhHhhhhhhcCCCCccccCC
Q psy12016         67 KGLGRHKRYECGQEPKYECDQ   87 (111)
Q Consensus        67 ~~l~~h~~~~~~~~~~~~C~~   87 (111)
                      ..|..|........ +..|..
T Consensus        24 ~~l~~H~~~~C~~~-~v~C~~   43 (60)
T PF02176_consen   24 KELDDHLENECPKR-PVPCPY   43 (60)
T ss_dssp             CCHHHHHHTTSTTS-EEE-SS
T ss_pred             HHHHHHHHccCCCC-cEECCC
Confidence            34555555444434 555665


No 155
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=58.08  E-value=6.2  Score=16.57  Aligned_cols=16  Identities=19%  Similarity=0.266  Sum_probs=8.3

Q ss_pred             cccCCCCcccccchhH
Q psy12016         83 YECDQCPHRTKHISSL   98 (111)
Q Consensus        83 ~~C~~C~~~f~~~~~l   98 (111)
                      -.|..|++.|.+.++.
T Consensus         3 ~~CprC~kg~Hwa~~C   18 (36)
T PF14787_consen    3 GLCPRCGKGFHWASEC   18 (36)
T ss_dssp             -C-TTTSSSCS-TTT-
T ss_pred             ccCcccCCCcchhhhh
Confidence            3577777777766554


No 156
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=58.05  E-value=11  Score=23.96  Aligned_cols=25  Identities=28%  Similarity=0.503  Sum_probs=17.5

Q ss_pred             ccccCCCCcccccchhHHHHHHHhh
Q psy12016         82 KYECDQCPHRTKHISSLKKHMALKH  106 (111)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~~~~  106 (111)
                      -|.|+.|-+.|.....+.+|+..+.
T Consensus        48 lyiCe~Clky~~~~~~l~~H~~~C~   72 (290)
T PLN03238         48 LYICEYCLKYMRKKKSLLRHLAKCD   72 (290)
T ss_pred             EEEcCCCcchhCCHHHHHHHHHhCC
Confidence            6777777777777777777766443


No 157
>COG2879 Uncharacterized small protein [Function unknown]
Probab=57.19  E-value=13  Score=17.82  Aligned_cols=17  Identities=24%  Similarity=0.274  Sum_probs=12.5

Q ss_pred             chhHHHHHHHhhCCCCC
Q psy12016         95 ISSLKKHMALKHGVESQ  111 (111)
Q Consensus        95 ~~~l~~H~~~~~~ek~~  111 (111)
                      -.+..+|++.+|.++|.
T Consensus        25 YdnYVehmr~~hPd~p~   41 (65)
T COG2879          25 YDNYVEHMRKKHPDKPP   41 (65)
T ss_pred             HHHHHHHHHHhCcCCCc
Confidence            45677788888888773


No 158
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=57.18  E-value=5.8  Score=21.46  Aligned_cols=16  Identities=19%  Similarity=0.401  Sum_probs=10.2

Q ss_pred             CCceecCCCcccccch
Q psy12016         17 SGMFTCDVCFKEYKYK   32 (111)
Q Consensus        17 ~~~~~C~~C~~~f~~~   32 (111)
                      +..+.|..|+..|...
T Consensus        69 p~~~~C~~Cg~~~~~~   84 (117)
T PRK00564         69 KVELECKDCSHVFKPN   84 (117)
T ss_pred             CCEEEhhhCCCccccC
Confidence            3446788888666543


No 159
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=56.76  E-value=11  Score=20.26  Aligned_cols=12  Identities=25%  Similarity=0.542  Sum_probs=6.1

Q ss_pred             eecCCCcccccc
Q psy12016         20 FTCDVCFKEYKY   31 (111)
Q Consensus        20 ~~C~~C~~~f~~   31 (111)
                      ..|..|+..|..
T Consensus        71 ~~C~~Cg~~~~~   82 (113)
T PF01155_consen   71 ARCRDCGHEFEP   82 (113)
T ss_dssp             EEETTTS-EEEC
T ss_pred             EECCCCCCEEec
Confidence            456666655544


No 160
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=56.62  E-value=2.1  Score=26.12  Aligned_cols=20  Identities=20%  Similarity=0.381  Sum_probs=14.7

Q ss_pred             CCCceecCCCcccccchhHH
Q psy12016         16 DSGMFTCDVCFKEYKYKRGL   35 (111)
Q Consensus        16 ~~~~~~C~~C~~~f~~~~~l   35 (111)
                      .++...|++|+..|......
T Consensus        16 ~kk~ieCPvC~tkFkkeev~   35 (267)
T COG1655          16 YKKTIECPVCNTKFKKEEVK   35 (267)
T ss_pred             hhceeccCcccchhhhhhee
Confidence            45568899999988766543


No 161
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=55.96  E-value=5.6  Score=27.24  Aligned_cols=9  Identities=33%  Similarity=0.755  Sum_probs=5.5

Q ss_pred             ccccCCCCc
Q psy12016         82 KYECDQCPH   90 (111)
Q Consensus        82 ~~~C~~C~~   90 (111)
                      |..|+.|+.
T Consensus       253 ~~~Cp~C~s  261 (505)
T TIGR00595       253 PKTCPQCGS  261 (505)
T ss_pred             CCCCCCCCC
Confidence            556666664


No 162
>KOG0717|consensus
Probab=55.91  E-value=8.6  Score=26.10  Aligned_cols=22  Identities=32%  Similarity=0.677  Sum_probs=19.7

Q ss_pred             eecCCCcccccchhHHHHHHhh
Q psy12016         20 FTCDVCFKEYKYKRGLVRHKKN   41 (111)
Q Consensus        20 ~~C~~C~~~f~~~~~l~~h~~~   41 (111)
                      +.|.+|++.|.+...+..|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            7899999999999999988753


No 163
>KOG0717|consensus
Probab=55.60  E-value=7.1  Score=26.49  Aligned_cols=21  Identities=29%  Similarity=0.406  Sum_probs=18.2

Q ss_pred             cccCCCCcccccchhHHHHHH
Q psy12016         83 YECDQCPHRTKHISSLKKHMA  103 (111)
Q Consensus        83 ~~C~~C~~~f~~~~~l~~H~~  103 (111)
                      +.|.+|++.|.+...|..|..
T Consensus       293 lyC~vCnKsFKseKq~kNHEn  313 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHEN  313 (508)
T ss_pred             eEEeeccccccchHHHHhhHH
Confidence            789999999999988888854


No 164
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=54.92  E-value=16  Score=16.56  Aligned_cols=12  Identities=17%  Similarity=0.545  Sum_probs=5.2

Q ss_pred             ecCCCcccccch
Q psy12016         21 TCDVCFKEYKYK   32 (111)
Q Consensus        21 ~C~~C~~~f~~~   32 (111)
                      .|++|+..|...
T Consensus        22 ~CPlC~r~l~~e   33 (54)
T PF04423_consen   22 CCPLCGRPLDEE   33 (54)
T ss_dssp             E-TTT--EE-HH
T ss_pred             cCCCCCCCCCHH
Confidence            677777766554


No 165
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=54.65  E-value=1  Score=19.16  Aligned_cols=10  Identities=50%  Similarity=1.066  Sum_probs=5.9

Q ss_pred             cccCCCCccc
Q psy12016         83 YECDQCPHRT   92 (111)
Q Consensus        83 ~~C~~C~~~f   92 (111)
                      |.|..|+..|
T Consensus        29 y~C~~C~~~w   38 (39)
T PF01096_consen   29 YVCCNCGHRW   38 (39)
T ss_dssp             EEESSSTEEE
T ss_pred             EEeCCCCCee
Confidence            5566666544


No 166
>KOG0782|consensus
Probab=54.13  E-value=1  Score=31.17  Aligned_cols=46  Identities=22%  Similarity=0.327  Sum_probs=26.8

Q ss_pred             hhhhcCCCCceecCCCcccccchhHHHHHHhhhcCC-CCCCCCCccccCccCcccCCch
Q psy12016         10 LSVWQNDSGMFTCDVCFKEYKYKRGLVRHKKNSCKQ-KPQNLDGLFSCDVCGKHYKYKK   67 (111)
Q Consensus        10 ~~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~-~~~~~~~~~~c~~c~~~~~~~~   67 (111)
                      |.+.|.+...-.|..|++.|.++-.+.      ..+ ..      ..|.+|..+|-.+.
T Consensus       244 HHWVHrrRqeGkC~~CgKgFQQKf~Fh------sKEivA------isCSWCKqayH~Kv  290 (1004)
T KOG0782|consen  244 HHWVHRRRQEGKCNTCGKGFQQKFFFH------SKEIVA------ISCSWCKQAYHLKV  290 (1004)
T ss_pred             HhHhhHhhhccccchhhhhhhhheeec------cccEEE------EEehHHHHHhhcch
Confidence            445554444456888888876654332      222 12      57788877766554


No 167
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=53.51  E-value=9.9  Score=16.66  Aligned_cols=8  Identities=38%  Similarity=1.385  Sum_probs=4.1

Q ss_pred             ccccCCCC
Q psy12016         82 KYECDQCP   89 (111)
Q Consensus        82 ~~~C~~C~   89 (111)
                      .|.|..|.
T Consensus        37 ~~~C~~C~   44 (46)
T PF12760_consen   37 RYRCKACR   44 (46)
T ss_pred             eEECCCCC
Confidence            45555554


No 168
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=53.32  E-value=5.6  Score=17.87  Aligned_cols=14  Identities=14%  Similarity=0.299  Sum_probs=10.2

Q ss_pred             ccCCCCcccccchh
Q psy12016         84 ECDQCPHRTKHISS   97 (111)
Q Consensus        84 ~C~~C~~~f~~~~~   97 (111)
                      .|++|++.|.+..-
T Consensus        14 ICpvCqRPFsWRkK   27 (54)
T COG4338          14 ICPVCQRPFSWRKK   27 (54)
T ss_pred             hhhhhcCchHHHHH
Confidence            58888888876543


No 169
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=52.04  E-value=8.7  Score=21.92  Aligned_cols=33  Identities=33%  Similarity=0.887  Sum_probs=21.4

Q ss_pred             cccCccCcccCCchhhHhhhhhhcCCCCccccCCCCccc
Q psy12016         54 FSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPHRT   92 (111)
Q Consensus        54 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~~~f   92 (111)
                      |.|. |+..+....   .|..+..| + .|.|..|+...
T Consensus       118 Y~C~-C~q~~l~~R---Rhn~~~~g-~-~YrC~~C~gkL  150 (156)
T COG3091         118 YRCQ-CQQHYLRIR---RHNTVRRG-E-VYRCGKCGGKL  150 (156)
T ss_pred             EEee-cCCccchhh---hccccccc-c-eEEeccCCceE
Confidence            8888 888876654   33333323 4 68898887554


No 170
>KOG2807|consensus
Probab=51.40  E-value=37  Score=22.17  Aligned_cols=22  Identities=18%  Similarity=0.232  Sum_probs=13.8

Q ss_pred             CceecCCCcccccchhHHHHHH
Q psy12016         18 GMFTCDVCFKEYKYKRGLVRHK   39 (111)
Q Consensus        18 ~~~~C~~C~~~f~~~~~l~~h~   39 (111)
                      -|-.|+.|+-.......|.+..
T Consensus       289 LP~eCpiC~ltLVss~hLARSy  310 (378)
T KOG2807|consen  289 LPIECPICSLTLVSSPHLARSY  310 (378)
T ss_pred             CCccCCccceeEecchHHHHHH
Confidence            4556777777666666665543


No 171
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=50.47  E-value=16  Score=16.15  Aligned_cols=22  Identities=27%  Similarity=0.380  Sum_probs=16.8

Q ss_pred             eecCCCcccccchhHHHHHHhh
Q psy12016         20 FTCDVCFKEYKYKRGLVRHKKN   41 (111)
Q Consensus        20 ~~C~~C~~~f~~~~~l~~h~~~   41 (111)
                      |.|-.|......++.|-.||+.
T Consensus        21 ykcfqcpftc~~kshl~nhmky   42 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMKY   42 (54)
T ss_pred             ceeecCCcccchHHHHHHHHHH
Confidence            5677888777778888888764


No 172
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=49.71  E-value=14  Score=24.79  Aligned_cols=12  Identities=33%  Similarity=0.935  Sum_probs=6.1

Q ss_pred             cccCccCcccCC
Q psy12016         54 FSCDVCGKHYKY   65 (111)
Q Consensus        54 ~~c~~c~~~~~~   65 (111)
                      |.|..|+..+..
T Consensus       368 ~rC~kCg~~~~~  379 (421)
T COG1571         368 FRCKKCGTRARE  379 (421)
T ss_pred             cccccccccCCc
Confidence            555555544443


No 173
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=49.50  E-value=13  Score=23.53  Aligned_cols=33  Identities=24%  Similarity=0.431  Sum_probs=21.1

Q ss_pred             eecCCCcccccchhHHHHHHhhhcCCCCCCCCCccccCccCcccCCch
Q psy12016         20 FTCDVCFKEYKYKRGLVRHKKNSCKQKPQNLDGLFSCDVCGKHYKYKK   67 (111)
Q Consensus        20 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~   67 (111)
                      ..|+.|+.....+. |..        .-      +.|+.|+..+....
T Consensus        27 ~~c~~c~~~~~~~~-l~~--------~~------~vc~~c~~h~rl~a   59 (285)
T TIGR00515        27 TKCPKCGQVLYTKE-LER--------NL------EVCPKCDHHMRMDA   59 (285)
T ss_pred             eECCCCcchhhHHH-HHh--------hC------CCCCCCCCcCcCCH
Confidence            46999987765443 211        11      68999998877553


No 174
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=49.47  E-value=12  Score=25.31  Aligned_cols=13  Identities=23%  Similarity=0.577  Sum_probs=9.4

Q ss_pred             CceecCCCccccc
Q psy12016         18 GMFTCDVCFKEYK   30 (111)
Q Consensus        18 ~~~~C~~C~~~f~   30 (111)
                      ..|.|..||....
T Consensus         6 ~~y~C~~Cg~~~~   18 (454)
T TIGR00416         6 SKFVCQHCGADSP   18 (454)
T ss_pred             CeEECCcCCCCCc
Confidence            3588999986643


No 175
>KOG2071|consensus
Probab=48.61  E-value=13  Score=25.95  Aligned_cols=26  Identities=23%  Similarity=0.474  Sum_probs=22.8

Q ss_pred             ccccCCCCcccccchhHHHHHHHhhC
Q psy12016         82 KYECDQCPHRTKHISSLKKHMALKHG  107 (111)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~~~~~  107 (111)
                      |-.|..||..|........||.+|-.
T Consensus       418 pnqC~~CG~R~~~~ee~sk~md~H~d  443 (579)
T KOG2071|consen  418 PNQCKSCGLRFDDSEERSKHMDIHDD  443 (579)
T ss_pred             cchhcccccccccchhhhhHhhhhhh
Confidence            77899999999999999888887754


No 176
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=48.20  E-value=17  Score=23.06  Aligned_cols=12  Identities=33%  Similarity=0.539  Sum_probs=6.2

Q ss_pred             ccccCccCcccC
Q psy12016         53 LFSCDVCGKHYK   64 (111)
Q Consensus        53 ~~~c~~c~~~~~   64 (111)
                      +|.|+.|...|.
T Consensus       255 GyvCs~Clsi~C  266 (279)
T TIGR00627       255 GFVCSVCLSVLC  266 (279)
T ss_pred             eEECCCccCCcC
Confidence            356666554443


No 177
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=48.00  E-value=18  Score=16.84  Aligned_cols=7  Identities=57%  Similarity=1.578  Sum_probs=3.9

Q ss_pred             cccCccC
Q psy12016         54 FSCDVCG   60 (111)
Q Consensus        54 ~~c~~c~   60 (111)
                      |.|+.||
T Consensus        15 ~~Cp~cG   21 (55)
T PF13824_consen   15 FECPDCG   21 (55)
T ss_pred             CcCCCCC
Confidence            5555555


No 178
>PRK05978 hypothetical protein; Provisional
Probab=47.97  E-value=9  Score=21.77  Aligned_cols=8  Identities=38%  Similarity=1.282  Sum_probs=3.7

Q ss_pred             ccCccCcc
Q psy12016         55 SCDVCGKH   62 (111)
Q Consensus        55 ~c~~c~~~   62 (111)
                      .|+.||..
T Consensus        54 ~C~~CG~~   61 (148)
T PRK05978         54 HCAACGED   61 (148)
T ss_pred             CccccCCc
Confidence            44555443


No 179
>PRK11823 DNA repair protein RadA; Provisional
Probab=47.81  E-value=14  Score=25.00  Aligned_cols=14  Identities=21%  Similarity=0.498  Sum_probs=9.7

Q ss_pred             CCceecCCCccccc
Q psy12016         17 SGMFTCDVCFKEYK   30 (111)
Q Consensus        17 ~~~~~C~~C~~~f~   30 (111)
                      ...|.|..||....
T Consensus         5 ~~~y~C~~Cg~~~~   18 (446)
T PRK11823          5 KTAYVCQECGAESP   18 (446)
T ss_pred             CCeEECCcCCCCCc
Confidence            34588998886643


No 180
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=47.44  E-value=20  Score=15.15  Aligned_cols=14  Identities=36%  Similarity=0.785  Sum_probs=5.5

Q ss_pred             ccccCCCCcccccc
Q psy12016         82 KYECDQCPHRTKHI   95 (111)
Q Consensus        82 ~~~C~~C~~~f~~~   95 (111)
                      .|-|+.|+..+...
T Consensus         3 ryyCdyC~~~~~~d   16 (38)
T PF06220_consen    3 RYYCDYCKKYLTHD   16 (38)
T ss_dssp             S-B-TTT--B-S--
T ss_pred             CeecccccceecCC
Confidence            57799999888443


No 181
>KOG4124|consensus
Probab=46.89  E-value=3.7  Score=26.67  Aligned_cols=51  Identities=37%  Similarity=0.725  Sum_probs=31.3

Q ss_pred             CCccccCc--cCcccCCchhhHhhhhhhc------------------CCCCccccCCCCcccccchhHHHH
Q psy12016         51 DGLFSCDV--CGKHYKYKKGLGRHKRYEC------------------GQEPKYECDQCPHRTKHISSLKKH  101 (111)
Q Consensus        51 ~~~~~c~~--c~~~~~~~~~l~~h~~~~~------------------~~~~~~~C~~C~~~f~~~~~l~~H  101 (111)
                      ++.+.|.+  |.+.......|..|....+                  .+.++++|++|.+.++....|+-|
T Consensus       347 ~~~~~~~vp~~~~~~~n~ng~~~~~~~~h~s~i~~~s~~~~ph~~~~~~nk~~r~~i~~~~~k~~~~l~~~  417 (442)
T KOG4124|consen  347 DKPYKCPVPNCDKAYKNQNGLKYHKLHGHCSPITTPTPAPIPHQGFVVENKPYRCEVCSKRYKNLNGLKYH  417 (442)
T ss_pred             cCCCCCCCCcchhhcccCcceeeccccCcCCCCCCCCCCCCCcceeeeccCcccChhhhhhhccCCCCCce
Confidence            34566665  6666666655554433211                  123489999999888777666544


No 182
>PF12907 zf-met2:  Zinc-binding
Probab=46.16  E-value=9  Score=16.53  Aligned_cols=22  Identities=18%  Similarity=0.543  Sum_probs=10.2

Q ss_pred             cccCccCcccC---CchhhHhhhhh
Q psy12016         54 FSCDVCGKHYK---YKKGLGRHKRY   75 (111)
Q Consensus        54 ~~c~~c~~~~~---~~~~l~~h~~~   75 (111)
                      +.|.+|...|.   +...|..|-..
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~en   26 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAEN   26 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHc
Confidence            45666663332   22345555443


No 183
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=46.12  E-value=10  Score=21.26  Aligned_cols=17  Identities=24%  Similarity=0.366  Sum_probs=13.3

Q ss_pred             CCceecCCCcccccchh
Q psy12016         17 SGMFTCDVCFKEYKYKR   33 (111)
Q Consensus        17 ~~~~~C~~C~~~f~~~~   33 (111)
                      .++.+|+.||..|....
T Consensus       110 g~~~RCpeCG~~fkL~~  126 (136)
T PF01215_consen  110 GKPQRCPECGQVFKLKY  126 (136)
T ss_dssp             TSEEEETTTEEEEEEEE
T ss_pred             CCccCCCCCCeEEEEEE
Confidence            45789999999887653


No 184
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=46.10  E-value=15  Score=17.44  Aligned_cols=11  Identities=18%  Similarity=0.739  Sum_probs=7.0

Q ss_pred             ccccCCCCccc
Q psy12016         82 KYECDQCPHRT   92 (111)
Q Consensus        82 ~~~C~~C~~~f   92 (111)
                      .|.|+.||..+
T Consensus        46 ~~~C~~Cg~~~   56 (69)
T PF07282_consen   46 VFTCPNCGFEM   56 (69)
T ss_pred             eEEcCCCCCEE
Confidence            66777776553


No 185
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=45.46  E-value=13  Score=22.80  Aligned_cols=18  Identities=17%  Similarity=0.515  Sum_probs=14.2

Q ss_pred             CCCceecCCCcccccchh
Q psy12016         16 DSGMFTCDVCFKEYKYKR   33 (111)
Q Consensus        16 ~~~~~~C~~C~~~f~~~~   33 (111)
                      ..++.+|.+||..|....
T Consensus       178 EGkpqRCpECGqVFKLVr  195 (268)
T PTZ00043        178 EGFLYRCGECDQIFMLVR  195 (268)
T ss_pred             CCCCccCCCCCcEEEEEE
Confidence            456789999999997643


No 186
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=45.22  E-value=20  Score=20.09  Aligned_cols=19  Identities=21%  Similarity=0.590  Sum_probs=13.9

Q ss_pred             CCCceecCCCcccccchhH
Q psy12016         16 DSGMFTCDVCFKEYKYKRG   34 (111)
Q Consensus        16 ~~~~~~C~~C~~~f~~~~~   34 (111)
                      ..+.|+|..|..+......
T Consensus        77 d~~lYeCnIC~etS~ee~F   95 (140)
T PF05290_consen   77 DPKLYECNICKETSAEERF   95 (140)
T ss_pred             CCCceeccCcccccchhhc
Confidence            4577999999877655544


No 187
>KOG1842|consensus
Probab=45.20  E-value=12  Score=25.26  Aligned_cols=27  Identities=26%  Similarity=0.368  Sum_probs=21.5

Q ss_pred             cccCccCcccCCchhhHhhhhhhcCCC
Q psy12016         54 FSCDVCGKHYKYKKGLGRHKRYECGQE   80 (111)
Q Consensus        54 ~~c~~c~~~~~~~~~l~~h~~~~~~~~   80 (111)
                      |.|+.|...|.+...|..|..+.|.++
T Consensus        16 flCPiC~~dl~~~~~L~~H~d~eH~~e   42 (505)
T KOG1842|consen   16 FLCPICLLDLPNLSALNDHLDVEHFEE   42 (505)
T ss_pred             ccCchHhhhhhhHHHHHHHHhhhcccc
Confidence            788888888888888888887766544


No 188
>KOG1842|consensus
Probab=44.54  E-value=11  Score=25.52  Aligned_cols=23  Identities=22%  Similarity=0.437  Sum_probs=20.3

Q ss_pred             ceecCCCcccccchhHHHHHHhh
Q psy12016         19 MFTCDVCFKEYKYKRGLVRHKKN   41 (111)
Q Consensus        19 ~~~C~~C~~~f~~~~~l~~h~~~   41 (111)
                      -|.|+.|...|.....|..|...
T Consensus        15 gflCPiC~~dl~~~~~L~~H~d~   37 (505)
T KOG1842|consen   15 GFLCPICLLDLPNLSALNDHLDV   37 (505)
T ss_pred             cccCchHhhhhhhHHHHHHHHhh
Confidence            48999999999999999999754


No 189
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=44.50  E-value=17  Score=23.21  Aligned_cols=33  Identities=30%  Similarity=0.557  Sum_probs=21.1

Q ss_pred             eecCCCcccccchhHHHHHHhhhcCCCCCCCCCccccCccCcccCCch
Q psy12016         20 FTCDVCFKEYKYKRGLVRHKKNSCKQKPQNLDGLFSCDVCGKHYKYKK   67 (111)
Q Consensus        20 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~   67 (111)
                      ..|+.|+.....+. |..        ..      +.|+.|+..|....
T Consensus        39 ~kc~~C~~~~~~~~-l~~--------~~------~vcp~c~~h~rltA   71 (296)
T CHL00174         39 VQCENCYGLNYKKF-LKS--------KM------NICEQCGYHLKMSS   71 (296)
T ss_pred             eECCCccchhhHHH-HHH--------cC------CCCCCCCCCcCCCH
Confidence            46888887654443 211        12      68999998877653


No 190
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=43.96  E-value=4.8  Score=28.77  Aligned_cols=59  Identities=19%  Similarity=0.475  Sum_probs=33.0

Q ss_pred             ecCCCcccccchhHHHHHHhhhcCCCCCCCCCccccCccCcccCCchhhHhhhhhhcCCCCccccCCCCccc
Q psy12016         21 TCDVCFKEYKYKRGLVRHKKNSCKQKPQNLDGLFSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPHRT   92 (111)
Q Consensus        21 ~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~~~f   92 (111)
                      .|..||-.|+....|- ..+.++.-..     .-.|+.|.+.+..+.+    .+-| . + |..|+.||-..
T Consensus       125 ~CT~CGPRfTIi~alP-YDR~nTsM~~-----F~lC~~C~~EY~dP~n----RRfH-A-Q-p~aCp~CGP~~  183 (750)
T COG0068         125 NCTNCGPRFTIIEALP-YDRENTSMAD-----FPLCPFCDKEYKDPLN----RRFH-A-Q-PIACPKCGPHL  183 (750)
T ss_pred             ccCCCCcceeeeccCC-CCcccCcccc-----CcCCHHHHHHhcCccc----cccc-c-c-cccCcccCCCe
Confidence            4777887776654432 1111111111     1378888887776643    2333 2 3 88999999643


No 191
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=43.24  E-value=9.3  Score=16.46  Aligned_cols=11  Identities=27%  Similarity=0.543  Sum_probs=8.5

Q ss_pred             ccccCCCCccc
Q psy12016         82 KYECDQCPHRT   92 (111)
Q Consensus        82 ~~~C~~C~~~f   92 (111)
                      +..|++|+..|
T Consensus        29 ~~~CpYCg~~y   39 (40)
T PF10276_consen   29 PVVCPYCGTRY   39 (40)
T ss_dssp             EEEETTTTEEE
T ss_pred             eEECCCCCCEE
Confidence            57888888766


No 192
>PHA02998 RNA polymerase subunit; Provisional
Probab=42.94  E-value=8  Score=22.69  Aligned_cols=38  Identities=18%  Similarity=0.414  Sum_probs=21.3

Q ss_pred             cccCccCcccCCchhhHhhhhhhcCCCC---ccccCCCCcccccc
Q psy12016         54 FSCDVCGKHYKYKKGLGRHKRYECGQEP---KYECDQCPHRTKHI   95 (111)
Q Consensus        54 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~---~~~C~~C~~~f~~~   95 (111)
                      ..|+.|+..-.....+    ++....++   -|.|..|+..|...
T Consensus       144 v~CPkCg~~~A~f~ql----QTRSADEPmT~FYkC~~CG~~wkpp  184 (195)
T PHA02998        144 TPCPNCKSKNTTPMMI----QTRAADEPPLVRHACRDCKKHFKPP  184 (195)
T ss_pred             CCCCCCCCCceEEEEE----eeccCCCCceEEEEcCCCCCccCCc
Confidence            5788888543332222    22223332   36899999887543


No 193
>PRK04351 hypothetical protein; Provisional
Probab=42.81  E-value=13  Score=21.18  Aligned_cols=34  Identities=35%  Similarity=0.929  Sum_probs=21.9

Q ss_pred             ccccCccCcccCCchhhHhhhhhhcCCCCccccCCCCcccccc
Q psy12016         53 LFSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPHRTKHI   95 (111)
Q Consensus        53 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~~   95 (111)
                      .|.|..|+..+.+..      + + ... .|.|..|+..+...
T Consensus       112 ~Y~C~~Cg~~~~r~R------r-~-n~~-~yrCg~C~g~L~~~  145 (149)
T PRK04351        112 LYECQSCGQQYLRKR------R-I-NTK-RYRCGKCRGKLKLI  145 (149)
T ss_pred             EEECCCCCCEeeeee------e-c-CCC-cEEeCCCCcEeeec
Confidence            489988987665432      1 1 224 79999998766443


No 194
>PLN00104 MYST -like histone acetyltransferase; Provisional
Probab=42.59  E-value=16  Score=24.79  Aligned_cols=25  Identities=28%  Similarity=0.469  Sum_probs=21.6

Q ss_pred             ccccCCCCcccccchhHHHHHHHhh
Q psy12016         82 KYECDQCPHRTKHISSLKKHMALKH  106 (111)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~~~~  106 (111)
                      .|.|+.|-+.|.....|.+|+..+.
T Consensus       198 lyiCe~Cl~y~~~~~~~~~H~~~C~  222 (450)
T PLN00104        198 LYFCEFCLKFMKRKEQLQRHMKKCD  222 (450)
T ss_pred             EEEchhhhhhhcCHHHHHHHHhcCC
Confidence            6889999999999999999987554


No 195
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=42.41  E-value=11  Score=19.45  Aligned_cols=14  Identities=21%  Similarity=0.382  Sum_probs=11.2

Q ss_pred             CceecCCCcccccc
Q psy12016         18 GMFTCDVCFKEYKY   31 (111)
Q Consensus        18 ~~~~C~~C~~~f~~   31 (111)
                      .|..|..||..|..
T Consensus        57 ~Pa~CkkCGfef~~   70 (97)
T COG3357          57 RPARCKKCGFEFRD   70 (97)
T ss_pred             cChhhcccCccccc
Confidence            56789999988865


No 196
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=41.98  E-value=12  Score=15.67  Aligned_cols=7  Identities=43%  Similarity=1.678  Sum_probs=4.3

Q ss_pred             ccccCCC
Q psy12016         82 KYECDQC   88 (111)
Q Consensus        82 ~~~C~~C   88 (111)
                      .|.|..|
T Consensus        29 ryrC~~C   35 (36)
T PF03811_consen   29 RYRCKDC   35 (36)
T ss_pred             eEecCcC
Confidence            5666655


No 197
>PTZ00064 histone acetyltransferase; Provisional
Probab=41.95  E-value=20  Score=24.85  Aligned_cols=25  Identities=16%  Similarity=0.192  Sum_probs=21.6

Q ss_pred             ccccCCCCcccccchhHHHHHHHhh
Q psy12016         82 KYECDQCPHRTKHISSLKKHMALKH  106 (111)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~~~~  106 (111)
                      .|.|+.|-+.|.....|.+|+..+.
T Consensus       280 LYICEfCLkY~~s~~~l~rH~~~C~  304 (552)
T PTZ00064        280 LHFCEYCLDFFCFEDELIRHLSRCQ  304 (552)
T ss_pred             EEEccchhhhhCCHHHHHHHHhcCC
Confidence            6889999999999999999987654


No 198
>PF10272 Tmpp129:  Putative transmembrane protein precursor;  InterPro: IPR018801  This entry consists of proteins conserved from worms to humans. They are purported to be transmembrane protein-precursors but their function is unknown. 
Probab=40.83  E-value=5  Score=26.22  Aligned_cols=11  Identities=18%  Similarity=0.709  Sum_probs=6.4

Q ss_pred             cccCccCcccC
Q psy12016         54 FSCDVCGKHYK   64 (111)
Q Consensus        54 ~~c~~c~~~~~   64 (111)
                      ..|+.|...|.
T Consensus       341 ~~CPtCRa~FC  351 (358)
T PF10272_consen  341 CPCPTCRAKFC  351 (358)
T ss_pred             CCCCCCcccce
Confidence            45666665554


No 199
>PRK05580 primosome assembly protein PriA; Validated
Probab=40.65  E-value=20  Score=25.72  Aligned_cols=9  Identities=22%  Similarity=0.722  Sum_probs=5.3

Q ss_pred             ccccCCCCc
Q psy12016         82 KYECDQCPH   90 (111)
Q Consensus        82 ~~~C~~C~~   90 (111)
                      |..|+.|+.
T Consensus       421 ~~~Cp~Cg~  429 (679)
T PRK05580        421 PKACPECGS  429 (679)
T ss_pred             CCCCCCCcC
Confidence            556666654


No 200
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=39.56  E-value=5.5  Score=16.46  Aligned_cols=6  Identities=50%  Similarity=1.553  Sum_probs=2.5

Q ss_pred             ccCccC
Q psy12016         55 SCDVCG   60 (111)
Q Consensus        55 ~c~~c~   60 (111)
                      .|+.|+
T Consensus        24 vC~~Cg   29 (34)
T PF14803_consen   24 VCPACG   29 (34)
T ss_dssp             EETTTT
T ss_pred             ECCCCC
Confidence            444443


No 201
>COG1773 Rubredoxin [Energy production and conversion]
Probab=39.52  E-value=15  Score=17.08  Aligned_cols=14  Identities=29%  Similarity=0.615  Sum_probs=9.7

Q ss_pred             ceecCCCcccccch
Q psy12016         19 MFTCDVCFKEYKYK   32 (111)
Q Consensus        19 ~~~C~~C~~~f~~~   32 (111)
                      .|.|..|+..|.-.
T Consensus         3 ~~~C~~CG~vYd~e   16 (55)
T COG1773           3 RWRCSVCGYVYDPE   16 (55)
T ss_pred             ceEecCCceEeccc
Confidence            47788888776543


No 202
>PTZ00448 hypothetical protein; Provisional
Probab=39.28  E-value=24  Score=23.32  Aligned_cols=24  Identities=17%  Similarity=0.375  Sum_probs=19.7

Q ss_pred             ccccCCCCcccccchhHHHHHHHh
Q psy12016         82 KYECDQCPHRTKHISSLKKHMALK  105 (111)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~~~  105 (111)
                      .|.|..|+-.|.+....+.|.++.
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KSD  337 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRSE  337 (373)
T ss_pred             CccccccccccCCHHHHHHHhhhh
Confidence            477999999998888888887753


No 203
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=39.04  E-value=21  Score=22.79  Aligned_cols=33  Identities=24%  Similarity=0.450  Sum_probs=20.8

Q ss_pred             eecCCCcccccchhHHHHHHhhhcCCCCCCCCCccccCccCcccCCch
Q psy12016         20 FTCDVCFKEYKYKRGLVRHKKNSCKQKPQNLDGLFSCDVCGKHYKYKK   67 (111)
Q Consensus        20 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~   67 (111)
                      ..|+.|+.....+. |..        ..      +.|+.|+..+....
T Consensus        28 ~~c~~c~~~~~~~~-l~~--------~~------~vc~~c~~h~rl~a   60 (292)
T PRK05654         28 TKCPSCGQVLYRKE-LEA--------NL------NVCPKCGHHMRISA   60 (292)
T ss_pred             eECCCccchhhHHH-HHh--------cC------CCCCCCCCCeeCCH
Confidence            46999987654443 221        11      68999998876553


No 204
>PRK12496 hypothetical protein; Provisional
Probab=38.74  E-value=23  Score=20.48  Aligned_cols=28  Identities=21%  Similarity=0.379  Sum_probs=17.7

Q ss_pred             CccccCccCcccCCchhhHhhhhhhcCCCCccccCCCCccc
Q psy12016         52 GLFSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPHRT   92 (111)
Q Consensus        52 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~~~f   92 (111)
                      +.+.|.-|++.|....            . .-.|+.||...
T Consensus       126 w~~~C~gC~~~~~~~~------------~-~~~C~~CG~~~  153 (164)
T PRK12496        126 WRKVCKGCKKKYPEDY------------P-DDVCEICGSPV  153 (164)
T ss_pred             eeEECCCCCccccCCC------------C-CCcCCCCCChh
Confidence            4478888988775321            1 23588888554


No 205
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism]
Probab=38.65  E-value=17  Score=23.84  Aligned_cols=7  Identities=43%  Similarity=1.578  Sum_probs=3.6

Q ss_pred             cccCccC
Q psy12016         54 FSCDVCG   60 (111)
Q Consensus        54 ~~c~~c~   60 (111)
                      |.|..||
T Consensus       355 YRC~~CG  361 (389)
T COG2956         355 YRCQNCG  361 (389)
T ss_pred             ceecccC
Confidence            4555554


No 206
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=38.50  E-value=19  Score=20.22  Aligned_cols=13  Identities=38%  Similarity=1.170  Sum_probs=7.7

Q ss_pred             cccCccCcccCCc
Q psy12016         54 FSCDVCGKHYKYK   66 (111)
Q Consensus        54 ~~c~~c~~~~~~~   66 (111)
                      |.|..|+..+...
T Consensus       124 ~~C~~C~~~~~r~  136 (157)
T PF10263_consen  124 YRCPSCGREYKRH  136 (157)
T ss_pred             EEcCCCCCEeeee
Confidence            6666676555443


No 207
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=38.47  E-value=7.8  Score=19.52  Aligned_cols=13  Identities=15%  Similarity=0.434  Sum_probs=7.0

Q ss_pred             ccccCCCCccccc
Q psy12016         82 KYECDQCPHRTKH   94 (111)
Q Consensus        82 ~~~C~~C~~~f~~   94 (111)
                      ...|..|+..|..
T Consensus        46 ~~~C~~Cg~~~~~   58 (81)
T PF05129_consen   46 ILSCRVCGESFQT   58 (81)
T ss_dssp             EEEESSS--EEEE
T ss_pred             EEEecCCCCeEEE
Confidence            4567777766643


No 208
>KOG3507|consensus
Probab=38.18  E-value=11  Score=17.71  Aligned_cols=11  Identities=27%  Similarity=0.724  Sum_probs=7.7

Q ss_pred             cccCccCcccC
Q psy12016         54 FSCDVCGKHYK   64 (111)
Q Consensus        54 ~~c~~c~~~~~   64 (111)
                      +.|.+||....
T Consensus        38 irCReCG~RIl   48 (62)
T KOG3507|consen   38 IRCRECGYRIL   48 (62)
T ss_pred             EehhhcchHHH
Confidence            78888886533


No 209
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=38.00  E-value=14  Score=19.74  Aligned_cols=22  Identities=18%  Similarity=0.282  Sum_probs=16.7

Q ss_pred             ccccCCCCcccccchhHHHHHH
Q psy12016         82 KYECDQCPHRTKHISSLKKHMA  103 (111)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~  103 (111)
                      .+.|..|.+.|.....|..|.+
T Consensus        55 qhYCieCaryf~t~~aL~~Hkk   76 (126)
T COG5112          55 QHYCIECARYFITEKALMEHKK   76 (126)
T ss_pred             eeeeehhHHHHHHHHHHHHHhc
Confidence            5678888888888777777754


No 210
>PLN02748 tRNA dimethylallyltransferase
Probab=37.85  E-value=24  Score=24.15  Aligned_cols=23  Identities=17%  Similarity=0.460  Sum_probs=19.0

Q ss_pred             ccccCCCCc-ccccchhHHHHHHH
Q psy12016         82 KYECDQCPH-RTKHISSLKKHMAL  104 (111)
Q Consensus        82 ~~~C~~C~~-~f~~~~~l~~H~~~  104 (111)
                      .|.|+.|+. .+.....|..|++.
T Consensus       418 ~~~Ce~C~~~~~~G~~eW~~Hlks  441 (468)
T PLN02748        418 QYVCEACGNKVLRGAHEWEQHKQG  441 (468)
T ss_pred             cccccCCCCcccCCHHHHHHHhcc
Confidence            678999997 78888888888753


No 211
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=37.68  E-value=40  Score=20.20  Aligned_cols=12  Identities=25%  Similarity=0.650  Sum_probs=9.1

Q ss_pred             cccCccCcccCC
Q psy12016         54 FSCDVCGKHYKY   65 (111)
Q Consensus        54 ~~c~~c~~~~~~   65 (111)
                      ..|..||..++.
T Consensus        31 vrC~eCG~V~~~   42 (201)
T COG1326          31 VRCEECGTVHPA   42 (201)
T ss_pred             EEccCCCcEeec
Confidence            788889877643


No 212
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=37.05  E-value=17  Score=24.80  Aligned_cols=13  Identities=31%  Similarity=0.687  Sum_probs=9.5

Q ss_pred             cccCccCcccCCc
Q psy12016         54 FSCDVCGKHYKYK   66 (111)
Q Consensus        54 ~~c~~c~~~~~~~   66 (111)
                      |.|..|+..+...
T Consensus       426 ~~c~~c~~~yd~~  438 (479)
T PRK05452        426 MQCSVCQWIYDPA  438 (479)
T ss_pred             EEECCCCeEECCC
Confidence            7888888776654


No 213
>PRK11032 hypothetical protein; Provisional
Probab=36.97  E-value=22  Score=20.56  Aligned_cols=8  Identities=25%  Similarity=1.007  Sum_probs=3.9

Q ss_pred             cccCccCc
Q psy12016         54 FSCDVCGK   61 (111)
Q Consensus        54 ~~c~~c~~   61 (111)
                      ..|..||.
T Consensus       125 LvC~~Cg~  132 (160)
T PRK11032        125 LVCEKCHH  132 (160)
T ss_pred             EEecCCCC
Confidence            44555553


No 214
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=36.87  E-value=21  Score=23.60  Aligned_cols=7  Identities=29%  Similarity=0.785  Sum_probs=3.2

Q ss_pred             ecCCCcc
Q psy12016         21 TCDVCFK   27 (111)
Q Consensus        21 ~C~~C~~   27 (111)
                      .|+.|+.
T Consensus        16 ~cp~c~~   22 (372)
T cd01121          16 KCPECGE   22 (372)
T ss_pred             ECcCCCC
Confidence            3555543


No 215
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=36.03  E-value=19  Score=19.73  Aligned_cols=12  Identities=25%  Similarity=0.265  Sum_probs=6.8

Q ss_pred             ceecCCCcccccc
Q psy12016         19 MFTCDVCFKEYKY   31 (111)
Q Consensus        19 ~~~C~~C~~~f~~   31 (111)
                      ...| .|+..|..
T Consensus        70 ~~~C-~Cg~~~~~   81 (124)
T PRK00762         70 EIEC-ECGYEGVV   81 (124)
T ss_pred             eEEe-eCcCcccc
Confidence            3566 66655543


No 216
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=35.87  E-value=21  Score=14.79  Aligned_cols=12  Identities=33%  Similarity=0.678  Sum_probs=4.1

Q ss_pred             ecCCCcccccch
Q psy12016         21 TCDVCFKEYKYK   32 (111)
Q Consensus        21 ~C~~C~~~f~~~   32 (111)
                      .|..|++.|..+
T Consensus         5 ~C~eC~~~f~dS   16 (34)
T PF01286_consen    5 KCDECGKPFMDS   16 (34)
T ss_dssp             E-TTT--EES-S
T ss_pred             hHhHhCCHHHHH
Confidence            455555555443


No 217
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=35.80  E-value=42  Score=14.18  Aligned_cols=20  Identities=15%  Similarity=0.152  Sum_probs=14.8

Q ss_pred             ceecCCCcccccchhHHHHH
Q psy12016         19 MFTCDVCFKEYKYKRGLVRH   38 (111)
Q Consensus        19 ~~~C~~C~~~f~~~~~l~~h   38 (111)
                      ...|+.|+..+.....|.+-
T Consensus        19 id~C~~C~G~W~d~~el~~~   38 (41)
T PF13453_consen   19 IDVCPSCGGIWFDAGELEKL   38 (41)
T ss_pred             EEECCCCCeEEccHHHHHHH
Confidence            45788898888887776643


No 218
>KOG3352|consensus
Probab=35.56  E-value=21  Score=20.34  Aligned_cols=15  Identities=33%  Similarity=0.603  Sum_probs=11.8

Q ss_pred             CCCccccCCCCccccc
Q psy12016         79 QEPKYECDQCPHRTKH   94 (111)
Q Consensus        79 ~~~~~~C~~C~~~f~~   94 (111)
                      ++ ..+|.+|+..|..
T Consensus       131 ge-~~rc~eCG~~fkL  145 (153)
T KOG3352|consen  131 GE-TQRCPECGHYFKL  145 (153)
T ss_pred             CC-cccCCcccceEEe
Confidence            35 6789999998864


No 219
>PF14369 zf-RING_3:  zinc-finger
Probab=35.55  E-value=19  Score=14.86  Aligned_cols=11  Identities=18%  Similarity=0.594  Sum_probs=8.9

Q ss_pred             ecCCCcccccc
Q psy12016         21 TCDVCFKEYKY   31 (111)
Q Consensus        21 ~C~~C~~~f~~   31 (111)
                      .|+.|+..|..
T Consensus        23 ~CP~C~~gFvE   33 (35)
T PF14369_consen   23 ACPRCHGGFVE   33 (35)
T ss_pred             CCcCCCCcEeE
Confidence            59999988854


No 220
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=35.39  E-value=23  Score=16.88  Aligned_cols=9  Identities=22%  Similarity=0.907  Sum_probs=5.4

Q ss_pred             cccCccCcc
Q psy12016         54 FSCDVCGKH   62 (111)
Q Consensus        54 ~~c~~c~~~   62 (111)
                      |-|++|...
T Consensus        32 ymC~eC~~R   40 (68)
T COG4896          32 YMCPECEHR   40 (68)
T ss_pred             EechhhHhh
Confidence            666666543


No 221
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=35.16  E-value=50  Score=14.95  Aligned_cols=13  Identities=31%  Similarity=0.951  Sum_probs=7.0

Q ss_pred             cccCccCcccCCc
Q psy12016         54 FSCDVCGKHYKYK   66 (111)
Q Consensus        54 ~~c~~c~~~~~~~   66 (111)
                      +.|..|+..+...
T Consensus        29 W~C~~Cgh~w~~~   41 (55)
T PF14311_consen   29 WKCPKCGHEWKAS   41 (55)
T ss_pred             EECCCCCCeeEcc
Confidence            5666665544443


No 222
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=35.12  E-value=22  Score=14.96  Aligned_cols=12  Identities=17%  Similarity=0.598  Sum_probs=6.2

Q ss_pred             CceecCCCcccc
Q psy12016         18 GMFTCDVCFKEY   29 (111)
Q Consensus        18 ~~~~C~~C~~~f   29 (111)
                      ..|.|..|+...
T Consensus         5 ~~YkC~~CGniV   16 (36)
T PF06397_consen    5 EFYKCEHCGNIV   16 (36)
T ss_dssp             EEEE-TTT--EE
T ss_pred             cEEEccCCCCEE
Confidence            457888888654


No 223
>KOG3214|consensus
Probab=34.77  E-value=14  Score=19.46  Aligned_cols=13  Identities=23%  Similarity=0.531  Sum_probs=7.7

Q ss_pred             ccccCCCCccccc
Q psy12016         82 KYECDQCPHRTKH   94 (111)
Q Consensus        82 ~~~C~~C~~~f~~   94 (111)
                      ...|.+|+..|..
T Consensus        47 ~~sC~iC~esFqt   59 (109)
T KOG3214|consen   47 KASCRICEESFQT   59 (109)
T ss_pred             eeeeeehhhhhcc
Confidence            4456666666643


No 224
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=34.66  E-value=24  Score=19.77  Aligned_cols=33  Identities=24%  Similarity=0.706  Sum_probs=19.6

Q ss_pred             ccccCccCcccCCchhhHhhhhhhcCCCCccccCCCCcccc
Q psy12016         53 LFSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPHRTK   93 (111)
Q Consensus        53 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~   93 (111)
                      .|.|..|+..+....      + +..-. .+.|..|+..+.
T Consensus       112 ~y~C~~C~~~~~~~r------r-~~~~~-~y~C~~C~g~l~  144 (146)
T smart00731      112 PYRCTGCGQRYLRVR------R-SNNVS-RYRCGKCGGKLI  144 (146)
T ss_pred             EEECCCCCCCCceEc------c-ccCcc-eEEcCCCCCEEE
Confidence            478888887654321      1 11113 688988886653


No 225
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=34.55  E-value=26  Score=16.69  Aligned_cols=36  Identities=17%  Similarity=0.254  Sum_probs=19.3

Q ss_pred             cccCccCcccCCchhhHhhhhhhcCCCCccccCCCCccccc
Q psy12016         54 FSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPHRTKH   94 (111)
Q Consensus        54 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~   94 (111)
                      +.|+--+..+..+....   ..  ++++-..|++|+..|..
T Consensus        25 l~C~g~~~p~~HPrV~L---~m--g~~gev~CPYC~t~y~l   60 (62)
T COG4391          25 LMCPGPEPPNDHPRVFL---DM--GDEGEVVCPYCSTRYRL   60 (62)
T ss_pred             EEcCCCCCCCCCCEEEE---Ec--CCCCcEecCccccEEEe
Confidence            67765444433332211   11  33335679999988753


No 226
>KOG2906|consensus
Probab=34.10  E-value=11  Score=19.85  Aligned_cols=19  Identities=21%  Similarity=0.557  Sum_probs=13.7

Q ss_pred             CceecCCCcccccchhHHH
Q psy12016         18 GMFTCDVCFKEYKYKRGLV   36 (111)
Q Consensus        18 ~~~~C~~C~~~f~~~~~l~   36 (111)
                      ..|.|..|.+.|.....+.
T Consensus        20 ~rf~C~tCpY~~~I~~ei~   38 (105)
T KOG2906|consen   20 NRFSCRTCPYVFPISREIS   38 (105)
T ss_pred             eeEEcCCCCceeeEeeeee
Confidence            3578999998887765443


No 227
>KOG0562|consensus
Probab=33.67  E-value=35  Score=19.96  Aligned_cols=26  Identities=23%  Similarity=0.432  Sum_probs=20.5

Q ss_pred             ccccCCCCcccccchhHHHHHHHhhC
Q psy12016         82 KYECDQCPHRTKHISSLKKHMALKHG  107 (111)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~~~~~  107 (111)
                      +..|..|+..-....-|+.|++.+..
T Consensus       153 dLrC~~Cq~~~~~~~kLK~Hl~~~~~  178 (184)
T KOG0562|consen  153 DLRCWRCQTFGPHFPKLKAHLREEYD  178 (184)
T ss_pred             ceeehhhhhcccccHHHHHHHHHHHh
Confidence            67899999555667889999887764


No 228
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=33.65  E-value=20  Score=14.24  Aligned_cols=10  Identities=20%  Similarity=0.936  Sum_probs=5.6

Q ss_pred             cccCCCCccc
Q psy12016         83 YECDQCPHRT   92 (111)
Q Consensus        83 ~~C~~C~~~f   92 (111)
                      |.|..|+..+
T Consensus        28 f~C~~C~~~L   37 (39)
T smart00132       28 FKCSKCGKPL   37 (39)
T ss_pred             CCCcccCCcC
Confidence            5566665544


No 229
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=33.18  E-value=24  Score=19.55  Aligned_cols=14  Identities=21%  Similarity=0.634  Sum_probs=10.4

Q ss_pred             ccccCCCCcccccc
Q psy12016         82 KYECDQCPHRTKHI   95 (111)
Q Consensus        82 ~~~C~~C~~~f~~~   95 (111)
                      .|.|..|++.|...
T Consensus        53 RyrC~~C~~tf~~~   66 (129)
T COG3677          53 RYKCKSCGSTFTVE   66 (129)
T ss_pred             ccccCCcCcceeee
Confidence            68888888887543


No 230
>PF03966 Trm112p:  Trm112p-like protein;  InterPro: IPR005651 This family of short proteins have no known function. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The entry contains 2 families:  Trm112, which is required for tRNA methylation in Saccharomyces cerevisiae (Baker's yeast) and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W []. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast []. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices []. UPF0434, which are proteins that are functionally uncharacterised.  ; PDB: 3Q87_A 2KPI_A 2K5R_A 2HF1_A 2JS4_A 2J6A_A 2JR6_A 2PK7_A 2JNY_A.
Probab=32.96  E-value=24  Score=16.88  Aligned_cols=19  Identities=26%  Similarity=0.485  Sum_probs=13.0

Q ss_pred             hcCCCCceecCCCcccccc
Q psy12016         13 WQNDSGMFTCDVCFKEYKY   31 (111)
Q Consensus        13 ~~~~~~~~~C~~C~~~f~~   31 (111)
                      .+..++...|+.|+..|..
T Consensus        47 ~~i~eg~L~Cp~c~r~YPI   65 (68)
T PF03966_consen   47 VEIVEGELICPECGREYPI   65 (68)
T ss_dssp             EETTTTEEEETTTTEEEEE
T ss_pred             ccccCCEEEcCCCCCEEeC
Confidence            4455667788888877754


No 231
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=32.93  E-value=16  Score=19.74  Aligned_cols=17  Identities=24%  Similarity=0.425  Sum_probs=12.1

Q ss_pred             CCceecCCCcccccchh
Q psy12016         17 SGMFTCDVCFKEYKYKR   33 (111)
Q Consensus        17 ~~~~~C~~C~~~f~~~~   33 (111)
                      ..-+.|..|+.......
T Consensus        20 ~~~l~C~kCgye~~~~~   36 (113)
T COG1594          20 GGKLVCRKCGYEEEASN   36 (113)
T ss_pred             CcEEECCCCCcchhccc
Confidence            44688999987766553


No 232
>PRK00420 hypothetical protein; Validated
Probab=32.02  E-value=36  Score=18.41  Aligned_cols=11  Identities=9%  Similarity=0.042  Sum_probs=6.9

Q ss_pred             ccccCCCCccc
Q psy12016         82 KYECDQCPHRT   92 (111)
Q Consensus        82 ~~~C~~C~~~f   92 (111)
                      ...|+.|+...
T Consensus        40 ~~~Cp~Cg~~~   50 (112)
T PRK00420         40 EVVCPVHGKVY   50 (112)
T ss_pred             ceECCCCCCee
Confidence            45677777644


No 233
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=31.74  E-value=10  Score=23.87  Aligned_cols=13  Identities=23%  Similarity=0.452  Sum_probs=8.8

Q ss_pred             ccccCCCCccccc
Q psy12016         82 KYECDQCPHRTKH   94 (111)
Q Consensus        82 ~~~C~~C~~~f~~   94 (111)
                      ...|..|+..++.
T Consensus       238 ve~C~~C~~YlK~  250 (290)
T PF04216_consen  238 VEVCESCGSYLKT  250 (290)
T ss_dssp             EEEETTTTEEEEE
T ss_pred             EEECCcccchHHH
Confidence            5678888865543


No 234
>KOG1088|consensus
Probab=31.71  E-value=22  Score=19.39  Aligned_cols=13  Identities=15%  Similarity=0.529  Sum_probs=6.5

Q ss_pred             cccCccCcccCCc
Q psy12016         54 FSCDVCGKHYKYK   66 (111)
Q Consensus        54 ~~c~~c~~~~~~~   66 (111)
                      ..|++||..|+-.
T Consensus        99 l~CpetG~vfpI~  111 (124)
T KOG1088|consen   99 LVCPETGRVFPIS  111 (124)
T ss_pred             EecCCCCcEeecc
Confidence            4555555555443


No 235
>PF10537 WAC_Acf1_DNA_bd:  ATP-utilising chromatin assembly and remodelling N-terminal;  InterPro: IPR013136 ACF (for ATP-utilising chromatin assembly and remodeling factor) is a chromatin-remodeling complex that catalyzes the ATP-dependent assembly of periodic nucleosome arrays. This reaction utilises the energy of ATP hydrolysis by ISWI, the smaller of the two subunits of ACF. Acf1, the large subunit of ACF, is essential for the full activity of the complex. The WAC (WSTF/Acf1/cbp146) domain is an ~110-residue module present at the N-termini of Acf1-related proteins in a variety of organisms. It is found in association with other domains such as the bromodomain, the PHD-type zinc finger, DDT or WAKS. The DNA-binding region of Acf1 includes the WAC domain, which is necessary for the efficient binding of ACF complex to DNA. It seems probable that the WAC domain will be involved in DNA binding in other related factors [, ].   Some proteins known to contain a WAC domain are the Drosophila melanogaster (Fruit fly) ATP-dependent chromatin assembly factor large subunit Acf1, human WSTF (Williams syndrome transcription factor), mouse cbp146, yeast imitation switch two complex protein 1 (ITC1 or YGL133w), and yeast protein YPL216w. 
Probab=31.15  E-value=89  Score=16.57  Aligned_cols=38  Identities=11%  Similarity=0.250  Sum_probs=26.3

Q ss_pred             CceecCCCcccccchhHHHHHHhhhcCCCCCCCCCccccCccCcc
Q psy12016         18 GMFTCDVCFKEYKYKRGLVRHKKNSCKQKPQNLDGLFSCDVCGKH   62 (111)
Q Consensus        18 ~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~c~~c~~~   62 (111)
                      ..|.|+.=+..|.....+...+..-.. ..      |.|...|+.
T Consensus         2 eVf~i~~T~EiF~dYe~Y~~R~~~y~~-~v------wtC~~TGk~   39 (102)
T PF10537_consen    2 EVFYIPFTGEIFRDYEEYLKRMILYNQ-RV------WTCEITGKS   39 (102)
T ss_pred             ceEEeCCCCcccCCHHHHHHHHHHHhC-Ce------eEEecCCCC
Confidence            356778888888888777766654333 33      888887764


No 236
>KOG2907|consensus
Probab=30.19  E-value=31  Score=18.67  Aligned_cols=40  Identities=23%  Similarity=0.453  Sum_probs=20.5

Q ss_pred             cccCccCcccCCchhhHhhhhhhcCCCCccccCCCCccccc
Q psy12016         54 FSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPHRTKH   94 (111)
Q Consensus        54 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~   94 (111)
                      -.|+.||..=-....++. .....|.---|.|..|+..|..
T Consensus        75 ~kCpkCghe~m~Y~T~Ql-RSADEGQTVFYTC~kC~~k~~e  114 (116)
T KOG2907|consen   75 HKCPKCGHEEMSYHTLQL-RSADEGQTVFYTCPKCKYKFTE  114 (116)
T ss_pred             ccCcccCCchhhhhhhhc-ccccCCceEEEEcCccceeeec
Confidence            478888854333222221 1112222214779889877754


No 237
>PRK12722 transcriptional activator FlhC; Provisional
Probab=29.80  E-value=46  Score=19.85  Aligned_cols=28  Identities=25%  Similarity=0.629  Sum_probs=18.6

Q ss_pred             cccCccCcccCCchhhHhhhhhhcCCCCccccCCCCc
Q psy12016         54 FSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPH   90 (111)
Q Consensus        54 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~~   90 (111)
                      ..|..|+..|.....        .... .|.|+.|..
T Consensus       135 ~~C~~Cgg~fv~~~~--------e~~~-~f~CplC~~  162 (187)
T PRK12722        135 SSCNCCGGHFVTHAH--------DPVG-SFVCGLCQP  162 (187)
T ss_pred             ccCCCCCCCeecccc--------ccCC-CCcCCCCCC
Confidence            478889888774432        1123 789999874


No 238
>KOG4317|consensus
Probab=29.53  E-value=27  Score=22.66  Aligned_cols=13  Identities=23%  Similarity=0.623  Sum_probs=6.3

Q ss_pred             cccCccCcccCCc
Q psy12016         54 FSCDVCGKHYKYK   66 (111)
Q Consensus        54 ~~c~~c~~~~~~~   66 (111)
                      |+|+.|+..+.+.
T Consensus        20 YtCPRCn~~YCsl   32 (383)
T KOG4317|consen   20 YTCPRCNLLYCSL   32 (383)
T ss_pred             ccCCCCCccceee
Confidence            4555555444433


No 239
>PF15616 TerY-C:  TerY-C metal binding domain
Probab=29.38  E-value=24  Score=19.69  Aligned_cols=11  Identities=18%  Similarity=0.561  Sum_probs=8.3

Q ss_pred             ccccCCCCccc
Q psy12016         82 KYECDQCPHRT   92 (111)
Q Consensus        82 ~~~C~~C~~~f   92 (111)
                      ...|++|+..-
T Consensus       105 ~~~CPwCg~~g  115 (131)
T PF15616_consen  105 EVTCPWCGNEG  115 (131)
T ss_pred             CEECCCCCCee
Confidence            67899998653


No 240
>KOG1280|consensus
Probab=29.24  E-value=56  Score=21.58  Aligned_cols=27  Identities=22%  Similarity=0.442  Sum_probs=15.9

Q ss_pred             cccCccCcccCCchhhHhhhhhhcCCC
Q psy12016         54 FSCDVCGKHYKYKKGLGRHKRYECGQE   80 (111)
Q Consensus        54 ~~c~~c~~~~~~~~~l~~h~~~~~~~~   80 (111)
                      |.|++|+..=.....+..|....+.+-
T Consensus        80 ftCPyC~~~Gfte~~f~~Hv~s~Hpda  106 (381)
T KOG1280|consen   80 FTCPYCGIMGFTERQFGTHVLSQHPEA  106 (381)
T ss_pred             ccCCcccccccchhHHHHHhhhcCccc
Confidence            566666666555666666655544443


No 241
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=29.07  E-value=26  Score=14.84  Aligned_cols=11  Identities=18%  Similarity=0.770  Sum_probs=6.4

Q ss_pred             ccccCCCCccc
Q psy12016         82 KYECDQCPHRT   92 (111)
Q Consensus        82 ~~~C~~C~~~f   92 (111)
                      .|.|..|+...
T Consensus        24 ~w~C~~C~~~N   34 (40)
T PF04810_consen   24 TWICNFCGTKN   34 (40)
T ss_dssp             EEEETTT--EE
T ss_pred             EEECcCCCCcC
Confidence            77888887543


No 242
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=28.78  E-value=43  Score=13.28  Aligned_cols=16  Identities=19%  Similarity=0.428  Sum_probs=8.2

Q ss_pred             CCceecCCCcccccch
Q psy12016         17 SGMFTCDVCFKEYKYK   32 (111)
Q Consensus        17 ~~~~~C~~C~~~f~~~   32 (111)
                      ...|.|+.|+..+.+.
T Consensus        11 ~~kY~Cp~C~~~~CSl   26 (30)
T PF04438_consen   11 PAKYRCPRCGARYCSL   26 (30)
T ss_dssp             EESEE-TTT--EESSH
T ss_pred             CCEEECCCcCCceeCc
Confidence            3457788887766554


No 243
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=28.58  E-value=23  Score=15.87  Aligned_cols=10  Identities=20%  Similarity=0.936  Sum_probs=4.4

Q ss_pred             cccCCCCccc
Q psy12016         83 YECDQCPHRT   92 (111)
Q Consensus        83 ~~C~~C~~~f   92 (111)
                      |.|..|++.+
T Consensus        27 f~C~~C~~~l   36 (58)
T PF00412_consen   27 FKCSKCGKPL   36 (58)
T ss_dssp             SBETTTTCBT
T ss_pred             cccCCCCCcc
Confidence            4444444433


No 244
>PRK12860 transcriptional activator FlhC; Provisional
Probab=28.51  E-value=49  Score=19.75  Aligned_cols=27  Identities=19%  Similarity=0.511  Sum_probs=18.0

Q ss_pred             cccCccCcccCCchhhHhhhhhhcCCCCccccCCCC
Q psy12016         54 FSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCP   89 (111)
Q Consensus        54 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~   89 (111)
                      ..|..|+..|.....        .... .|.|+.|.
T Consensus       135 ~~C~~Cgg~fv~~~~--------e~~~-~f~CplC~  161 (189)
T PRK12860        135 ARCCRCGGKFVTHAH--------DLRH-NFVCGLCQ  161 (189)
T ss_pred             ccCCCCCCCeecccc--------ccCC-CCcCCCCC
Confidence            478889888774422        1123 78899887


No 245
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=28.46  E-value=50  Score=15.04  Aligned_cols=10  Identities=20%  Similarity=0.913  Sum_probs=6.7

Q ss_pred             ccccCCCCcc
Q psy12016         82 KYECDQCPHR   91 (111)
Q Consensus        82 ~~~C~~C~~~   91 (111)
                      .+.|..|+.+
T Consensus        37 R~~CGkCgyT   46 (51)
T COG1998          37 RWACGKCGYT   46 (51)
T ss_pred             eeEeccccce
Confidence            4677777743


No 246
>PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=27.75  E-value=15  Score=17.90  Aligned_cols=29  Identities=24%  Similarity=0.595  Sum_probs=14.3

Q ss_pred             cccCccCcccCCchhhHhhhhhhcCCCCccccCCCCcc
Q psy12016         54 FSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPHR   91 (111)
Q Consensus        54 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~~~   91 (111)
                      ..|..|+........       ..+ . .+.|+.|+..
T Consensus        42 v~Cg~C~~~~~~~~~-------~c~-~-~~~C~~C~~~   70 (71)
T PF05495_consen   42 VICGKCRTEQPIDEY-------SCG-A-DYFCPICGLY   70 (71)
T ss_dssp             EEETTT--EEES-SB-------TT----SEEETTTTEE
T ss_pred             eECCCCCCccChhhh-------hcC-C-CccCcCcCCC
Confidence            677777766554432       111 2 5778877644


No 247
>PF13821 DUF4187:  Domain of unknown function (DUF4187)
Probab=27.46  E-value=47  Score=15.37  Aligned_cols=18  Identities=17%  Similarity=0.285  Sum_probs=10.9

Q ss_pred             ccccCCCCcccccchhHH
Q psy12016         82 KYECDQCPHRTKHISSLK   99 (111)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~   99 (111)
                      .+-|-+|+..|.+...|.
T Consensus        27 ~~YC~~Cg~~Y~d~~dL~   44 (55)
T PF13821_consen   27 HNYCFWCGTKYDDEEDLE   44 (55)
T ss_pred             CceeeeeCCccCCHHHHH
Confidence            455666666666655554


No 248
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=27.09  E-value=40  Score=13.52  Aligned_cols=12  Identities=25%  Similarity=0.742  Sum_probs=7.8

Q ss_pred             CceecCCCcccc
Q psy12016         18 GMFTCDVCFKEY   29 (111)
Q Consensus        18 ~~~~C~~C~~~f   29 (111)
                      +.|.|..|+...
T Consensus         6 ~~ykC~~Cgniv   17 (34)
T TIGR00319         6 QVYKCEVCGNIV   17 (34)
T ss_pred             cEEEcCCCCcEE
Confidence            357777777654


No 249
>COG1779 C4-type Zn-finger protein [General function prediction only]
Probab=27.05  E-value=10  Score=22.61  Aligned_cols=7  Identities=43%  Similarity=0.923  Sum_probs=4.1

Q ss_pred             ecCCCcc
Q psy12016         21 TCDVCFK   27 (111)
Q Consensus        21 ~C~~C~~   27 (111)
                      .|+.|+.
T Consensus        16 ~CPvCg~   22 (201)
T COG1779          16 DCPVCGG   22 (201)
T ss_pred             cCCcccc
Confidence            4666665


No 250
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=26.54  E-value=56  Score=17.68  Aligned_cols=27  Identities=7%  Similarity=-0.107  Sum_probs=18.5

Q ss_pred             ccCccCcccCCchhhHhhhhhhcCCCCccccCCCCcccc
Q psy12016         55 SCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPHRTK   93 (111)
Q Consensus        55 ~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~   93 (111)
                      .|+.|++.|.-.            ++.|..|++||+.|.
T Consensus        11 idPetg~KFYDL------------NrdPiVsPytG~s~P   37 (129)
T COG4530          11 IDPETGKKFYDL------------NRDPIVSPYTGKSYP   37 (129)
T ss_pred             cCccccchhhcc------------CCCccccCcccccch
Confidence            577777776532            123888889998883


No 251
>KOG2747|consensus
Probab=26.52  E-value=34  Score=22.91  Aligned_cols=25  Identities=28%  Similarity=0.515  Sum_probs=21.9

Q ss_pred             ccccCCCCcccccchhHHHHHHHhh
Q psy12016         82 KYECDQCPHRTKHISSLKKHMALKH  106 (111)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~~~~  106 (111)
                      .|.|+.|-+.+.+...|.+|+..+.
T Consensus       158 lYiCEfCLkY~~s~~~l~rH~~kC~  182 (396)
T KOG2747|consen  158 LYICEFCLKYMKSRTSLQRHLKKCK  182 (396)
T ss_pred             EEEehHHHhHhchHHHHHHHHHhcC
Confidence            6889999999999999999988765


No 252
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=26.44  E-value=44  Score=13.44  Aligned_cols=11  Identities=18%  Similarity=0.830  Sum_probs=5.9

Q ss_pred             ceecCCCcccc
Q psy12016         19 MFTCDVCFKEY   29 (111)
Q Consensus        19 ~~~C~~C~~~f   29 (111)
                      .|.|..|+...
T Consensus         4 ~ykC~~CGniv   14 (34)
T cd00974           4 VYKCEICGNIV   14 (34)
T ss_pred             EEEcCCCCcEE
Confidence            35566665543


No 253
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=26.41  E-value=33  Score=14.49  Aligned_cols=12  Identities=33%  Similarity=0.703  Sum_probs=8.5

Q ss_pred             eecCCCcccccc
Q psy12016         20 FTCDVCFKEYKY   31 (111)
Q Consensus        20 ~~C~~C~~~f~~   31 (111)
                      +.|+.||..+..
T Consensus        33 ~~C~~CGE~~~~   44 (46)
T TIGR03831        33 LVCPQCGEEYLD   44 (46)
T ss_pred             cccccCCCEeeC
Confidence            568889876643


No 254
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=26.26  E-value=77  Score=24.99  Aligned_cols=9  Identities=33%  Similarity=0.608  Sum_probs=6.9

Q ss_pred             eecCCCccc
Q psy12016         20 FTCDVCFKE   28 (111)
Q Consensus        20 ~~C~~C~~~   28 (111)
                      +.|+.|+..
T Consensus       668 rkCPkCG~~  676 (1337)
T PRK14714        668 RRCPSCGTE  676 (1337)
T ss_pred             EECCCCCCc
Confidence            678888864


No 255
>KOG1994|consensus
Probab=26.02  E-value=31  Score=21.23  Aligned_cols=20  Identities=30%  Similarity=0.489  Sum_probs=17.8

Q ss_pred             ccccCCCCcccccchhHHHH
Q psy12016         82 KYECDQCPHRTKHISSLKKH  101 (111)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H  101 (111)
                      .|.|-+||-.|.....|-.|
T Consensus       239 h~YC~fCG~~y~~~edl~eh  258 (268)
T KOG1994|consen  239 HYYCFFCGIKYKDEEDLYEH  258 (268)
T ss_pred             ceEEEEeccccCCHHHHHHh
Confidence            79999999999998888776


No 256
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=25.77  E-value=19  Score=18.83  Aligned_cols=14  Identities=29%  Similarity=0.664  Sum_probs=11.0

Q ss_pred             CceecCCCcccccc
Q psy12016         18 GMFTCDVCFKEYKY   31 (111)
Q Consensus        18 ~~~~C~~C~~~f~~   31 (111)
                      ..+.|+.|+..+..
T Consensus        15 ~~~~C~~C~~~~~~   28 (104)
T TIGR01384        15 GVYVCPSCGYEKEK   28 (104)
T ss_pred             CeEECcCCCCcccc
Confidence            46889999977665


No 257
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=25.46  E-value=40  Score=17.79  Aligned_cols=11  Identities=27%  Similarity=0.757  Sum_probs=6.2

Q ss_pred             cccCccCcccC
Q psy12016         54 FSCDVCGKHYK   64 (111)
Q Consensus        54 ~~c~~c~~~~~   64 (111)
                      ..|..||..+.
T Consensus        43 ~~C~~CG~y~~   53 (99)
T PRK14892         43 ITCGNCGLYTE   53 (99)
T ss_pred             EECCCCCCccC
Confidence            46666665443


No 258
>COG1885 Uncharacterized protein conserved in archaea [Function unknown]
Probab=24.28  E-value=41  Score=17.94  Aligned_cols=12  Identities=17%  Similarity=0.564  Sum_probs=7.7

Q ss_pred             ceecCCCccccc
Q psy12016         19 MFTCDVCFKEYK   30 (111)
Q Consensus        19 ~~~C~~C~~~f~   30 (111)
                      ...|+.||..|.
T Consensus        49 ~t~CP~Cg~~~e   60 (115)
T COG1885          49 STSCPKCGEPFE   60 (115)
T ss_pred             cccCCCCCCccc
Confidence            456777776654


No 259
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=24.19  E-value=60  Score=17.63  Aligned_cols=9  Identities=44%  Similarity=1.161  Sum_probs=5.8

Q ss_pred             cccCccCcc
Q psy12016         54 FSCDVCGKH   62 (111)
Q Consensus        54 ~~c~~c~~~   62 (111)
                      ..|+.|++.
T Consensus        70 V~CP~C~K~   78 (114)
T PF11023_consen   70 VECPNCGKQ   78 (114)
T ss_pred             eECCCCCCh
Confidence            567777654


No 260
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=23.96  E-value=41  Score=22.28  Aligned_cols=22  Identities=18%  Similarity=0.344  Sum_probs=19.1

Q ss_pred             ceecCCCcccccchhHHHHHHh
Q psy12016         19 MFTCDVCFKEYKYKRGLVRHKK   40 (111)
Q Consensus        19 ~~~C~~C~~~f~~~~~l~~h~~   40 (111)
                      -+.|..|++.|.....+..|..
T Consensus       238 ~~YC~~C~r~f~~~~VFe~Hl~  259 (470)
T COG5188         238 KVYCVKCGREFSRSKVFEYHLE  259 (470)
T ss_pred             ceeeHhhhhHhhhhHHHHHHHh
Confidence            4679999999999999988874


No 261
>PLN03239 histone acetyltransferase; Provisional
Probab=23.94  E-value=61  Score=21.41  Aligned_cols=23  Identities=22%  Similarity=0.135  Sum_probs=19.3

Q ss_pred             ccccCCCCcccccchhHHHHHHH
Q psy12016         82 KYECDQCPHRTKHISSLKKHMAL  104 (111)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~~  104 (111)
                      -|.|+.|-+.|.....|.+|+..
T Consensus       106 lYiCE~Clky~~~~~~l~~H~~~  128 (351)
T PLN03239        106 LYVCEFSFGFFARKSELLRFQAK  128 (351)
T ss_pred             EEEeccchhhhcCHHHHHHHHHh
Confidence            78899999888888888888753


No 262
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=23.80  E-value=51  Score=12.85  Aligned_cols=6  Identities=50%  Similarity=1.437  Sum_probs=2.6

Q ss_pred             cCCCCc
Q psy12016         85 CDQCPH   90 (111)
Q Consensus        85 C~~C~~   90 (111)
                      |..|++
T Consensus         3 C~~C~~    8 (30)
T PF03107_consen    3 CDVCRR    8 (30)
T ss_pred             CCCCCC
Confidence            444443


No 263
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones]
Probab=23.50  E-value=55  Score=22.35  Aligned_cols=14  Identities=21%  Similarity=0.320  Sum_probs=10.2

Q ss_pred             CceecCCCcccccc
Q psy12016         18 GMFTCDVCFKEYKY   31 (111)
Q Consensus        18 ~~~~C~~C~~~f~~   31 (111)
                      ..|.|..||.....
T Consensus         6 t~f~C~~CG~~s~K   19 (456)
T COG1066           6 TAFVCQECGYVSPK   19 (456)
T ss_pred             cEEEcccCCCCCcc
Confidence            46889999976543


No 264
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=23.45  E-value=46  Score=21.07  Aligned_cols=9  Identities=22%  Similarity=0.973  Sum_probs=4.5

Q ss_pred             ccccCCCCc
Q psy12016         82 KYECDQCPH   90 (111)
Q Consensus        82 ~~~C~~C~~   90 (111)
                      .+.|+.||.
T Consensus       322 ~~~C~~cg~  330 (364)
T COG0675         322 LFKCPRCGF  330 (364)
T ss_pred             eEECCCCCC
Confidence            445555553


No 265
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=23.45  E-value=74  Score=13.04  Aligned_cols=24  Identities=21%  Similarity=0.361  Sum_probs=12.1

Q ss_pred             ccccCCCCcccccchhHHHHHHHhh
Q psy12016         82 KYECDQCPHRTKHISSLKKHMALKH  106 (111)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~~~~  106 (111)
                      .+.|+.|++.... +-+..|+....
T Consensus         4 ~~~C~nC~R~v~a-~RfA~HLekCm   27 (33)
T PF08209_consen    4 YVECPNCGRPVAA-SRFAPHLEKCM   27 (33)
T ss_dssp             EEE-TTTSSEEEG-GGHHHHHHHHT
T ss_pred             eEECCCCcCCcch-hhhHHHHHHHH
Confidence            4567777765433 34455655443


No 266
>PF10071 DUF2310:  Zn-ribbon-containing, possibly nucleic-acid-binding protein (DUF2310);  InterPro: IPR016908 This group represents uncharacterised conserved proteins.
Probab=23.45  E-value=54  Score=20.67  Aligned_cols=28  Identities=29%  Similarity=0.763  Sum_probs=18.7

Q ss_pred             cccCccCcccCCchhhHhhhhhhcCCCCccccCCCC
Q psy12016         54 FSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCP   89 (111)
Q Consensus        54 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~   89 (111)
                      -.|+.||..-.....+       ++-- .|+|+.|.
T Consensus       221 r~CP~Cg~~W~L~~pl-------h~iF-dFKCD~CR  248 (258)
T PF10071_consen  221 RKCPSCGGDWRLKEPL-------HDIF-DFKCDPCR  248 (258)
T ss_pred             CCCCCCCCccccCCch-------hhce-eccCCcce
Confidence            4789998876655444       1223 78898885


No 267
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=23.08  E-value=59  Score=17.30  Aligned_cols=10  Identities=20%  Similarity=0.414  Sum_probs=6.0

Q ss_pred             ceecCCCccc
Q psy12016         19 MFTCDVCFKE   28 (111)
Q Consensus        19 ~~~C~~C~~~   28 (111)
                      |-.|+.|+..
T Consensus         2 p~~CpYCg~~   11 (102)
T PF11672_consen    2 PIICPYCGGP   11 (102)
T ss_pred             CcccCCCCCe
Confidence            4557777653


No 268
>TIGR01385 TFSII transcription elongation factor S-II. This model represents eukaryotic transcription elongation factor S-II. This protein allows stalled RNA transcription complexes to perform a cleavage of the nascent RNA and restart at the newly generated 3-prime end.
Probab=23.03  E-value=35  Score=21.91  Aligned_cols=37  Identities=30%  Similarity=0.577  Sum_probs=20.3

Q ss_pred             ccccCccCcccCCchhhHhhhhhhcCCCC---ccccCCCCcccc
Q psy12016         53 LFSCDVCGKHYKYKKGLGRHKRYECGQEP---KYECDQCPHRTK   93 (111)
Q Consensus        53 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~---~~~C~~C~~~f~   93 (111)
                      .+.|+.|+..=.....++    +...+++   -|.|..|+..|.
T Consensus       258 ~~~C~~C~~~~~~~~q~Q----trsaDEpmT~f~~C~~Cg~~w~  297 (299)
T TIGR01385       258 LFTCGKCKQKKCTYYQLQ----TRSADEPMTTFVTCEECGNRWK  297 (299)
T ss_pred             cccCCCCCCccceEEEec----ccCCCCCCeEEEEcCCCCCeee
Confidence            379999985433332222    2222231   367988987654


No 269
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=22.71  E-value=65  Score=14.42  Aligned_cols=8  Identities=38%  Similarity=1.360  Sum_probs=2.6

Q ss_pred             cccCccCc
Q psy12016         54 FSCDVCGK   61 (111)
Q Consensus        54 ~~c~~c~~   61 (111)
                      |.|+.|++
T Consensus        42 W~CPiC~~   49 (50)
T PF02891_consen   42 WKCPICNK   49 (50)
T ss_dssp             -B-TTT--
T ss_pred             eECcCCcC
Confidence            66666653


No 270
>COG5027 SAS2 Histone acetyltransferase (MYST family) [Chromatin structure and dynamics]
Probab=22.56  E-value=43  Score=22.16  Aligned_cols=26  Identities=23%  Similarity=0.271  Sum_probs=22.0

Q ss_pred             ccccCCCCcccccchhHHHHHHHhhC
Q psy12016         82 KYECDQCPHRTKHISSLKKHMALKHG  107 (111)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~~~~~  107 (111)
                      .|.|+.|-+.|.+...|.+|.+.+.-
T Consensus       158 vyICefClkY~~s~~~~~rH~~kC~~  183 (395)
T COG5027         158 VYICEFCLKYYGSQTSLVRHRKKCSL  183 (395)
T ss_pred             EEEhhhhHHHhcchhHHHHHHhcCcC
Confidence            67899999999999999999887653


No 271
>PF02148 zf-UBP:  Zn-finger in ubiquitin-hydrolases and other protein;  InterPro: IPR001607 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents UBP-type zinc finger domains, which display some similarity with the Zn-binding domain of the insulinase family. The UBP-type zinc finger domain is found only in a small subfamily of ubiquitin C-terminal hydrolases (deubiquitinases or UBP) [, ], All members of this subfamily are isopeptidase-T, which are known to cleave isopeptide bonds between ubiquitin moieties. Some of the proteins containing an UBP zinc finger include:    Homo sapiens (Human) deubiquitinating enzyme 13 (UBPD) Human deubiquitinating enzyme 5 (UBP5)  Dictyostelium discoideum (Slime mold) deubiquitinating enzyme A (UBPA)  Saccharomyces cerevisiae (Baker's yeast) deubiquitinating enzyme 8 (UBP8) Yeast deubiquitinating enzyme 14 (UBP14)   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3GV4_A 3PHD_B 3C5K_A 2UZG_A 3IHP_B 2G43_B 2G45_D 2I50_A 3MHH_A 3MHS_A ....
Probab=22.40  E-value=49  Score=15.48  Aligned_cols=16  Identities=19%  Similarity=0.198  Sum_probs=9.3

Q ss_pred             CCceecCCCcccccch
Q psy12016         17 SGMFTCDVCFKEYKYK   32 (111)
Q Consensus        17 ~~~~~C~~C~~~f~~~   32 (111)
                      +..+.|-.|+..+...
T Consensus         9 ~~lw~CL~Cg~~~C~~   24 (63)
T PF02148_consen    9 SNLWLCLTCGYVGCGR   24 (63)
T ss_dssp             SSEEEETTTS-EEETT
T ss_pred             CceEEeCCCCcccccC
Confidence            4456677777666654


No 272
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=22.30  E-value=54  Score=14.96  Aligned_cols=16  Identities=13%  Similarity=0.295  Sum_probs=9.1

Q ss_pred             CCCceecCCCcccccc
Q psy12016         16 DSGMFTCDVCFKEYKY   31 (111)
Q Consensus        16 ~~~~~~C~~C~~~f~~   31 (111)
                      ....+.|..|++.+..
T Consensus        32 ~~~~~rC~YCe~~~~~   47 (52)
T PF02748_consen   32 EPIKLRCHYCERIITE   47 (52)
T ss_dssp             TTCEEEETTT--EEEH
T ss_pred             CCCEEEeeCCCCEecc
Confidence            4455778888776654


No 273
>PF04328 DUF466:  Protein of unknown function (DUF466);  InterPro: IPR007423 This is a small bacterial protein of unknown function.
Probab=22.27  E-value=84  Score=15.12  Aligned_cols=13  Identities=31%  Similarity=0.337  Sum_probs=8.2

Q ss_pred             HHHHHHHhhCCCC
Q psy12016         98 LKKHMALKHGVES  110 (111)
Q Consensus        98 l~~H~~~~~~ek~  110 (111)
                      +..|++.+|.++|
T Consensus        28 Yv~H~~~~HP~~p   40 (65)
T PF04328_consen   28 YVEHMRRHHPDEP   40 (65)
T ss_pred             HHHHHHHHCcCCC
Confidence            3457777776655


No 274
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=22.25  E-value=48  Score=14.19  Aligned_cols=7  Identities=29%  Similarity=0.529  Sum_probs=3.7

Q ss_pred             eecCCCc
Q psy12016         20 FTCDVCF   26 (111)
Q Consensus        20 ~~C~~C~   26 (111)
                      ..|+.|+
T Consensus         3 ~~Cp~Cg    9 (47)
T PF14690_consen    3 PRCPHCG    9 (47)
T ss_pred             ccCCCcC
Confidence            4455555


No 275
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=21.73  E-value=37  Score=15.75  Aligned_cols=8  Identities=25%  Similarity=0.845  Sum_probs=3.6

Q ss_pred             cCCCCccc
Q psy12016         85 CDQCPHRT   92 (111)
Q Consensus        85 C~~C~~~f   92 (111)
                      |..|+..|
T Consensus         8 C~~Cg~~~   15 (54)
T PF14446_consen    8 CPVCGKKF   15 (54)
T ss_pred             ChhhCCcc
Confidence            44444444


No 277
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=21.54  E-value=1.2e+02  Score=16.21  Aligned_cols=21  Identities=19%  Similarity=0.263  Sum_probs=15.7

Q ss_pred             ceecCCCcccccchhHHHHHH
Q psy12016         19 MFTCDVCFKEYKYKRGLVRHK   39 (111)
Q Consensus        19 ~~~C~~C~~~f~~~~~l~~h~   39 (111)
                      -+.|+.||..+........-.
T Consensus        31 ~~~C~~CGe~~~~~e~~~~~~   51 (127)
T TIGR03830        31 GWYCPACGEELLDPEESKRNS   51 (127)
T ss_pred             eeECCCCCCEEEcHHHHHHHH
Confidence            367999999888877665443


No 278
>KOG2857|consensus
Probab=21.43  E-value=51  Score=18.71  Aligned_cols=22  Identities=23%  Similarity=0.375  Sum_probs=19.9

Q ss_pred             ceecCCCcccccchhHHHHHHh
Q psy12016         19 MFTCDVCFKEYKYKRGLVRHKK   40 (111)
Q Consensus        19 ~~~C~~C~~~f~~~~~l~~h~~   40 (111)
                      -|.|+.|.-.+++-.-++.|..
T Consensus        17 KYKCpkC~vPYCSl~CfKiHk~   38 (157)
T KOG2857|consen   17 KYKCPKCSVPYCSLPCFKIHKS   38 (157)
T ss_pred             hccCCCCCCccccchhhhhccC
Confidence            5999999999999999998865


No 279
>COG5595 Zn-ribbon-containing, possibly nucleic-acid-binding protein [General function prediction only]
Probab=21.25  E-value=35  Score=20.54  Aligned_cols=14  Identities=29%  Similarity=0.691  Sum_probs=7.3

Q ss_pred             ecCCCcccccchhH
Q psy12016         21 TCDVCFKEYKYKRG   34 (111)
Q Consensus        21 ~C~~C~~~f~~~~~   34 (111)
                      .|+.|++.+..+..
T Consensus       220 ~CPsC~k~Wqlk~~  233 (256)
T COG5595         220 CCPSCGKDWQLKNP  233 (256)
T ss_pred             CCCcccccceeccc
Confidence            45666655544443


No 280
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=20.88  E-value=51  Score=15.10  Aligned_cols=9  Identities=22%  Similarity=0.726  Sum_probs=5.4

Q ss_pred             ccCCCCccc
Q psy12016         84 ECDQCPHRT   92 (111)
Q Consensus        84 ~C~~C~~~f   92 (111)
                      .|+.||..+
T Consensus         2 ~CPyCge~~   10 (52)
T PF14255_consen    2 QCPYCGEPI   10 (52)
T ss_pred             CCCCCCCee
Confidence            466666554


No 281
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=20.83  E-value=49  Score=13.48  Aligned_cols=11  Identities=27%  Similarity=0.770  Sum_probs=7.2

Q ss_pred             cccCccCcccC
Q psy12016         54 FSCDVCGKHYK   64 (111)
Q Consensus        54 ~~c~~c~~~~~   64 (111)
                      +.|..|+..|+
T Consensus        22 ~~C~~Cg~~~~   32 (33)
T PF08792_consen   22 EVCIFCGSSFP   32 (33)
T ss_pred             EEcccCCcEee
Confidence            56777776653


No 282
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=20.69  E-value=59  Score=17.51  Aligned_cols=11  Identities=27%  Similarity=0.942  Sum_probs=4.9

Q ss_pred             eecCCCccccc
Q psy12016         20 FTCDVCFKEYK   30 (111)
Q Consensus        20 ~~C~~C~~~f~   30 (111)
                      |.|++|+..+.
T Consensus        20 ~iCpeC~~EW~   30 (109)
T TIGR00686        20 LICPSCLYEWN   30 (109)
T ss_pred             eECcccccccc
Confidence            44444444443


No 283
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=20.65  E-value=57  Score=13.91  Aligned_cols=9  Identities=33%  Similarity=0.874  Sum_probs=4.3

Q ss_pred             cccCccCcc
Q psy12016         54 FSCDVCGKH   62 (111)
Q Consensus        54 ~~c~~c~~~   62 (111)
                      +.|..||..
T Consensus        20 ~vC~~CG~V   28 (43)
T PF08271_consen   20 LVCPNCGLV   28 (43)
T ss_dssp             EEETTT-BB
T ss_pred             EECCCCCCE
Confidence            455555543


No 284
>PF12773 DZR:  Double zinc ribbon
Probab=20.63  E-value=89  Score=13.60  Aligned_cols=7  Identities=43%  Similarity=1.165  Sum_probs=3.2

Q ss_pred             ccCccCc
Q psy12016         55 SCDVCGK   61 (111)
Q Consensus        55 ~c~~c~~   61 (111)
                      .|+.|+.
T Consensus        31 ~C~~Cg~   37 (50)
T PF12773_consen   31 ICPNCGA   37 (50)
T ss_pred             CCcCCcC
Confidence            4444443


No 285
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=20.57  E-value=21  Score=15.76  Aligned_cols=6  Identities=33%  Similarity=0.656  Sum_probs=2.8

Q ss_pred             CCcccc
Q psy12016         88 CPHRTK   93 (111)
Q Consensus        88 C~~~f~   93 (111)
                      ||..|.
T Consensus        33 Cg~tfv   38 (47)
T PF04606_consen   33 CGHTFV   38 (47)
T ss_pred             CCCEEE
Confidence            554443


No 286
>KOG3362|consensus
Probab=20.51  E-value=39  Score=19.21  Aligned_cols=20  Identities=35%  Similarity=0.737  Sum_probs=9.4

Q ss_pred             ccccCCCCcccccchhHHHH
Q psy12016         82 KYECDQCPHRTKHISSLKKH  101 (111)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H  101 (111)
                      +|.|.-||-.+.+..-+..|
T Consensus       129 ~ysC~~CG~kyCsv~C~~~H  148 (156)
T KOG3362|consen  129 KYSCVNCGTKYCSVRCLKTH  148 (156)
T ss_pred             hhHHHhcCCceeechhhhhc
Confidence            34454555444444444444


No 287
>KOG2636|consensus
Probab=20.31  E-value=94  Score=21.42  Aligned_cols=23  Identities=26%  Similarity=0.560  Sum_probs=13.7

Q ss_pred             CCceecCCCc-ccccchhHHHHHH
Q psy12016         17 SGMFTCDVCF-KEYKYKRGLVRHK   39 (111)
Q Consensus        17 ~~~~~C~~C~-~~f~~~~~l~~h~   39 (111)
                      ...|.|.+|| +++.-...+.+|-
T Consensus       399 ~~ey~CEICGNy~Y~GrkaF~RHF  422 (497)
T KOG2636|consen  399 DIEYNCEICGNYVYKGRKAFDRHF  422 (497)
T ss_pred             CcccceeeccCccccCcHHHHHHh
Confidence            3446677776 5555556666664


Done!